(data stored in ACNUC8465 zone)

EMBL: CU928166.PE420

CU928166.PE420       Location/Qualifiers
FT   CDS_pept        841024..843090
FT                   /locus_tag="KLTH0B10076g"
FT                   /old_locus_tag="KLTH-ORF14492"
FT                   /product="KLTH0B10076p"
FT                   /note="some similarities with uniprot|P25502 Saccharomyces
FT                   cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21785"
FT                   /db_xref="GOA:C5DDC4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC4"
FT                   /protein_id="CAR21785.1"
FT                   /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRTK
FT                   SKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRLTP
FT                   DLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHFVAT
FT                   DGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFEDTAQH
FT                   LICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSEL
FT                   VKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIVENR
FT                   VFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQVRLAKIT
FT                   TQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRSTFNLHINY
FT                   NYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAEIQSRILAKL
FT                   YYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFDFIQHNLKILQ
FT                   GLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQAVASPRPMSRI
FT                   LRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMNYASGSL"
     atgcctcgca agaagatgat gaaagcttgt ataaaatgca agcaacgcaa gaaaaaatgc        60
     tcgggacagc tcccctgcga ttactgtgtt aagatagagc agcctggagg atgtgagtac       120
     cgcacgagaa cgaaatccaa ggtggtaaaa gtgaccgaac gatacatatc ttcattaaaa       180
     aacaagattc gtgccctcga agctgaacta gccaaggctt ctgagggccc cgacagcgag       240
     ggctgcctgg aggacggagc gacctcggca gaagtcaacc ccttgataga gcctgagttc       300
     aggcttacac ctgacctaga cagcccaaaa caagaaagct tgacgatcgg ctcagtcgag       360
     cactgtgttc aagcgagcca acattcaaaa caatttttgg gaatgtcctc gtgtgtgcaa       420
     tacttagcaa agctgaagca atcattggta aactcttgcg gaagctctac ggagcatttt       480
     gtagctacgg atggcggctg gcccccaaat gatctcgata taaatcgaag tttcgttgag       540
     aacgtggcaa caaaggaact tcctgaccta agaaaagcta aagagcttat tgagattgct       600
     catgaaatta tcggcgccga ctacatgttt ttggagaccg gttattttga ggacaccgca       660
     caacacctca tttgtaagaa cccaccgcca cttcaatcag aggccattat tgaatacaca       720
     acagagctac ttagacttgt agcacatctc gctctgggtt cacttttcga taaagaaaat       780
     gctgagtcaa ggtctttggg attaaagtat catagaacca cgttgctact ctatagcgag       840
     ttggtgaaaa catatgattg tgctgccagt acatcgctca tactatcgct attgtatatg       900
     gcgtacttct ctttgtcttt gaacaaagct acctcggcgt ttgttatgac aggcagtgcc       960
     atacgaacaa tgtttacgct gggccttcac aaaagaacaa aaactattgt tgaaaaccga      1020
     gttttttggc tatgctttat ctacgataga ctcttggccg ttagattcgg gtttcctttg      1080
     atgatagatg aacgcaatat caacattccg cttctcactg aggttgatga caacttgaca      1140
     gcagtctctc tggacatcta ccactttgtt tctcaggttc gtcttgcaaa aattacaacc      1200
     caaatcatca cgaaaattta cacgcgaaac ccatactcat ttcttcataa ctgccacgca      1260
     gttctaaagc agctgaaaaa ttggtttgaa tctttgccag cagaattgaa gtttgattac      1320
     aacgatatca aaactgcaac gacccgatcg accttcaacc tccatatcaa ttataattat      1380
     tcgatcataa tagctactag acctgtcctg ctctacgttt tcaacagtat tctcacggag      1440
     aaccgaacca aagagaagat atatgaagcg cgtcaacttg aactgatatc ggtgctgctg      1500
     gagtcatgtg ttcaagctgc agagatccaa agtcgaatat tggcaaagtt atattatgac      1560
     ggtaagttgg ccaatcgttc gttcttagat tgtcactata tctttagtgc aacaaccgtt      1620
     cttattttaa cgggctactg ttcgatgctt tcaggagaat ccattgcttt ttctggagat      1680
     attgaaggcc tttttgattt catacagcac aatctcaaga tactgcaggg gctctcagag      1740
     tacaaccttg ccgctaaaaa cttcaacaag caattaacgg agttaataga catgatgagc      1800
     tcagatgagg tagtaaaagc tctagcaaca gggcgttccc agaatgaccc cacctctgtt      1860
     gattttcagc aggccgttgc aagtccgcgt cccatgtcac gaattctaag gaagagggga      1920
     aataatccgc cgaaagattt tgaagaaatc ggctacgtgg atctttctca gttggtcaac      1980
     aatatggacg ccgaatttcg ctcaggatca actacagact tgttcttaga tgaagacttc      2040
     atgaattatg caagtggttc cctttga                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page