(data stored in SCRATCH zone)

EMBL: CU928166.PE421

CU928166.PE421       Location/Qualifiers
FT   CDS_pept        complement(843319..844122)
FT                   /locus_tag="KLTH0B10098g"
FT                   /old_locus_tag="KLTH-ORF14491"
FT                   /product="KLTH0B10098p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21786"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC5"
FT                   /protein_id="CAR21786.1"
FT                   /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFED
FT                   LCTRNPVACPILSKTEGGPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNNCV
FT                   NEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQCPYV
FT                   VSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGIEDLQKPDYGDPIDIGEQE
FT                   IPMFWACGVTPQLAVTTVGDRIEGSVIGHTPGHMLILDATDVDWC"
     atgtcaaatc ctgagtcctt cagagagctt tgtcgtaaag aaattcacac tgggccgacg        60
     tcaggcgtgt tgccagggta tattcaagca aatttgctga tattgcccaa atgtgtagct       120
     gaaagttttg aagatctttg taccagaaac cctgtagcct gcccaattct ctcaaaaact       180
     gaaggtgggc cccaatttct cagaaatcac gccagcctca ttaaacaggg cacgtttgat       240
     atccgcaccg atttcccacg gtacaacgtc tactcaagag gcaaactcgt gcagcaaaag       300
     aacaattgcg ttaatgaatg gtccagcgac catgttggtt ttcttatagg gtgctccttc       360
     acttttgaac atgcattgga aaaggccggg cttgtgccga aaaatgtcct ttacaataaa       420
     aacgtgtcca tgtttaggac taccaagttc cttgactcag ccgggatttt tcaccaatgc       480
     ccttacgtgg taagcatgag accctataaa ctaacggaag ttgaaatcgt gagagaaata       540
     accagaaagt tcaaaaagac gcatggagaa cctctcgact ggggctatga cggggcaaaa       600
     cgcctgggaa tagaagatct ccaaaagcca gactatggcg acccgataga cattggtgaa       660
     caagagatac caatgttctg ggcgtgcgga gtcacaccgc aactggcagt tacgacagtc       720
     ggagatcgta ttgaaggttc tgtaatcggc catacgcctg ggcatatgct tatattagat       780
     gcaacagatg tagattggtg ctag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page