(data stored in ACNUC8465 zone)

EMBL: CU928166.PE423

CU928166.PE423       Location/Qualifiers
FT   CDS_pept        complement(852039..852989)
FT                   /locus_tag="KLTH0B10164g"
FT                   /old_locus_tag="KLTH-ORF14483"
FT                   /product="KLTH0B10164p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21788"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC7"
FT                   /protein_id="CAR21788.1"
FT                   /translation="MMFAAFSPSKIAMYRFFVFGLSFLAIAASFPLYKRADLDVDILQF
FT                   ALTLERLENKFYKEALSMWSVDDFVDANFTEDFYTQLKYIAHDEEAHLLFLEQVIKAAG
FT                   AEPVQACTYNLPLDSPVSFVQSIAAFEGVGVSAYLGAASLISSKKYLTAAGSILSTEAI
FT                   HQAAARNAIGEIPMANPFATPLSANAIYSIASKFIKSCPANNTKLPFKAYPELLVTQGL
FT                   PTAMNSSITFASNGTLPNSTQIYVTFVSGLDVIPVVGSRNGSSIRATVPEDVSGQSYVF
FT                   LTTGNSSNLTDSNILYGPAIIEVTPSSPTFNVSIF"
     atgatgtttg ctgccttttc gccaagcaaa atagcaatgt accgtttttt tgttttcggt        60
     ttgtcctttc tagcaatagc agcgtcgttc cctctttaca aaagagctga tctggatgtc       120
     gacattttac aattcgctct cactttagag cgattggaaa acaagtttta caaggaagcg       180
     ctatctatgt ggtctgtgga cgactttgtc gacgcgaatt ttacggagga cttttacacg       240
     cagctgaagt acattgcgca cgacgaggaa gcacacttac tatttctcga gcaggttatc       300
     aaagcagcgg gagcagagcc tgttcaggca tgtacatata accttcctct agatagccct       360
     gtcagttttg tccaaagtat agcagctttt gaaggcgtgg gcgtatctgc ttatctgggt       420
     gcagcttcgc tgatctcctc aaaaaaatac cttacagcgg caggctcaat tttgagcact       480
     gaagctattc atcaagctgc ggctcgtaat gccattggcg aaattcccat ggcaaatccg       540
     ttcgcgacgc cgctgagtgc taatgcaatc tactcgattg cctccaagtt tatcaagagc       600
     tgccctgcca ataacacaaa gctgcctttc aaagcctatc ccgagctttt agttacgcag       660
     gggctgccaa ctgctatgaa ctcgtctata acatttgcca gtaatggtac actaccaaac       720
     tcaactcaga tctacgtgac gtttgtgagc ggccttgatg ttatcccagt cgttggctca       780
     agaaatggca gttcgataag agcaaccgtt cccgaagatg tttctggcca atcttatgtg       840
     tttttgacta ctggtaattc cagcaacttg acagactcta atatcctgta tggacctgca       900
     atcatcgagg ttacaccttc aagccccacg ttcaacgtgt ctatcttttg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page