(data stored in SCRATCH zone)

EMBL: CU928166.PE425

CU928166.PE425       Location/Qualifiers
FT   CDS_pept        861584..862198
FT                   /locus_tag="KLTH0B10230g"
FT                   /old_locus_tag="KLTH-ORF14472"
FT                   /product="KLTH0B10230p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21790"
FT                   /db_xref="GOA:C5DDC9"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC9"
FT                   /protein_id="CAR21790.1"
FT                   /translation="MKGERAEEHLIQTPHVDDQNLRLPRDTFPNRFLYEISRHRTFVIA
FT                   VSSELILYAFSIYRGLTSKDRDIGFLIALFMIVLGSTGIILTGIITICLLNDCGTDPSN
FT                   TLHFMKEIVAVGLQMEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFKNYYLK
FT                   HYSRGEKTSGTNTYGLEEFQPFVDQAVEAYKKSETRMCSPF"
     atgaaagggg aaagagcaga agagcatttg attcaaactc cacatgtgga tgatcaaaac        60
     ctgaggcttc ctcgcgatac tttccctaac aggtttctat acgagattag tcgccacaga       120
     acctttgtaa ttgctgttag ctcggagctg atattgtatg ctttttcgat ttacagaggt       180
     ctgaccagca aggatcgcga tatagggttt ttgattgcgc tttttatgat agtattagga       240
     tctaccggta ttatactaac aggcatcatt accatatgct tgctgaacga ctgtgggaca       300
     gatccatcaa atacactgca ttttatgaaa gaaatagttg ctgtaggact acaaatggaa       360
     atgagagagt gggatattat agccgctaga atgaacaggg ttttttacct taataattca       420
     tgggcaaccc cttatttttt ttacgacgga gaagcgtgtc attctttctt taaaaactac       480
     taccttaagc attattcaag aggagaaaaa accagtggca cgaatacata cggtctcgaa       540
     gaatttcaac cttttgtcga ccaagctgtg gaagcataca aaaaaagcga gacaaggatg       600
     tgcagtccat tttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page