(data stored in ACNUC8465 zone)

EMBL: CU928166.PE426

CU928166.PE426       Location/Qualifiers
FT   CDS_pept        863070..863741
FT                   /locus_tag="KLTH0B10252g"
FT                   /old_locus_tag="KLTH-ORF14470"
FT                   /product="KLTH0B10252p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21791"
FT                   /db_xref="GOA:C5DDD0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD0"
FT                   /protein_id="CAR21791.1"
FT                   /translation="MMREERVEEYSLHASQEDDQSLTLPRDIYPNKFLYQISRHRAPLF
FT                   ATSLELVLCTLLIRYFMKKNDSSARFEAVSSVVSFGLPLGLSLFSGMVHLVHNCGKAPV
FT                   NRVRFMEEIIAVEPGTETRKWDSIAARLNAIFYSNNSLATPHFFYDGNACYFYFRLHYV
FT                   RPLFEKKESSYAFREFPDEFKALIHQAMEAYKKGLDKDWQRLLNTGSSLGIRASTSEKM
FT                   T"
     atgatgaggg aagaaagagt tgaggagtac tcactgcatg catcgcaaga agatgaccaa        60
     agcttgaccc ttccgcgcga tatatatcct aacaaatttt tataccagat aagtcgacat       120
     agagcgcccc tgttcgctac tagcttggag ctggttttgt gcactctttt gatacgttac       180
     tttatgaaaa agaatgacag ctcagcaaga tttgaagccg tgtcaagtgt tgtatcattt       240
     ggattacctc ttggactgag tttattctct ggtatggtac acctagtcca caattgtgga       300
     aaggctccag tgaacagagt gcgctttatg gaagaaataa tagcagtaga accaggaact       360
     gaaacaagaa agtgggacag catagccgct agattgaacg cgatttttta ctctaataat       420
     tcactagcga ctccgcactt tttttatgat ggaaatgcat gttattttta tttcaggctc       480
     cactacgtga ggcctctttt tgagaagaaa gaatctagtt acgcttttag agagtttcct       540
     gatgagttta aggcactaat tcaccaagct atggaggcgt acaaaaaggg acttgacaaa       600
     gactggcagc gcctgctcaa caccggttct tctctaggaa tcagagcgtc gacgtctgaa       660
     aaaatgacat aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page