(data stored in SCRATCH zone)

EMBL: CU928166.PE427

CU928166.PE427       Location/Qualifiers
FT   CDS_pept        865279..865761
FT                   /locus_tag="KLTH0B10274g"
FT                   /old_locus_tag="KLTH-ORF14468"
FT                   /product="KLTH0B10274p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21792"
FT                   /db_xref="GOA:C5DDD1"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD1"
FT                   /protein_id="CAR21792.1"
FT                   /translation="MARKFISGDDLAAIRIFIVSLGMAGTAITGAIIEGRVESVILMPS
FT                   NKVQFMKEIAILGPGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDGESCYSCFRNEYL
FT                   HPYLRRKNTNDTQAYIVDEFKPFVDQVLKSYEESLNKDLQHMLEEEISVESQHIKL"
     atggcccgta aattcattag tggcgatgac cttgcagcca tacgaatatt tatcgtaagt        60
     ttaggaatgg caggcacagc aatcacgggt gcaatcatcg agggtcgagt cgagagcgtg       120
     attttaatgc catcaaacaa agtacaattt atgaaagaaa tagcgattct aggtcccgga       180
     ctagaaatga aaaagggggg cgttgttgct gctaagatga atccagtttt acacaaaagc       240
     agcttattgg caacgccata ttacttttac gacggagaat catgctattc ctgcttcaga       300
     aatgaatatc ttcatccata tttgagaaga aagaatacta acgacacaca agcatatatt       360
     gtcgatgaat tcaaaccctt tgtcgatcaa gttttgaagt catatgagga gagtttgaac       420
     aaagatttgc agcatatgtt agaagaagag atttctgttg agagtcagca tatcaagcta       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page