(data stored in ACNUC8465 zone)

EMBL: CU928166.PE428

CU928166.PE428       Location/Qualifiers
FT   CDS_pept        867082..867360
FT                   /locus_tag="KLTH0B10296g"
FT                   /old_locus_tag="KLTH-ORF14466"
FT                   /product="KLTH0B10296p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21793"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD2"
FT                   /protein_id="CAR21793.1"
FT                   /translation="MVKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFK
FT                   AKYLLPHLERKGANSTGEMPLYDLEPFYGQILDAYEERTKKEWQHIL"
     atggtaaagc caggaatcga tatgagaaaa tgggatttta ttgcggcaaa aatgaacgca        60
     aatctttatc aaaacaattc gttgatttcg ccatattatt attataatgg cgaggcctgt       120
     tactgtttct tcaaagccaa atatttgcta cctcaccttg aaaggaaggg tgcgaacagc       180
     acaggtgaaa tgcctctcta tgatctggag cctttttatg gtcaaatatt ggatgcatac       240
     gaagaaagga ccaaaaaaga atggcagcac atattatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page