(data stored in ACNUC8465 zone)
EMBL: CU928166.PE428
CU928166.PE428 Location/Qualifiers
FT CDS_pept 867082..867360
FT /locus_tag="KLTH0B10296g"
FT /old_locus_tag="KLTH-ORF14466"
FT /product="KLTH0B10296p"
FT /note="conserved hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:KLTH0B10296g"
FT /db_xref="EnsemblGenomes-Tr:CAR21793"
FT /db_xref="InterPro:IPR001142"
FT /db_xref="UniProtKB/TrEMBL:C5DDD2"
FT /protein_id="CAR21793.1"
FT /translation="MVKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFK
FT AKYLLPHLERKGANSTGEMPLYDLEPFYGQILDAYEERTKKEWQHIL"
atggtaaagc caggaatcga tatgagaaaa tgggatttta ttgcggcaaa aatgaacgca 60
aatctttatc aaaacaattc gttgatttcg ccatattatt attataatgg cgaggcctgt 120
tactgtttct tcaaagccaa atatttgcta cctcaccttg aaaggaaggg tgcgaacagc 180
acaggtgaaa tgcctctcta tgatctggag cctttttatg gtcaaatatt ggatgcatac 240
gaagaaagga ccaaaaaaga atggcagcac atattatga 279
//
If you have problems or comments...
Back to PBIL home page