(data stored in SCRATCH zone)

EMBL: CU928166.PE430

CU928166.PE430       Location/Qualifiers
FT   CDS_pept        874656..875879
FT                   /locus_tag="KLTH0B10340g"
FT                   /old_locus_tag="KLTH-ORF14454"
FT                   /product="KLTH0B10340p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21795"
FT                   /db_xref="GOA:C5DDD4"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD4"
FT                   /protein_id="CAR21795.1"
FT                   /translation="MSIVWVGAIRKNAQQDIMLKKLCLGLLALATTTLCESISRDVTTT
FT                   TVIAAVSSSSSSLTVATPGTPVSPKVLLIANEFEFGYLDAYNFTTQYTGVLFDQTFACT
FT                   EDGAICKLECGQELVSASQITALMMIPGVDLKKTYVIITGTGGVNPKYGTAGGAAISTF
FT                   GIQWEWGSMFLGDDLPANFSGQYFASYAQLSPDKYPVTVGSEVYKLNEALVDRFYATGS
FT                   KVTYEDVSETSQGLRATYEYDAAKQDPFLARCDTVSAQVYWHGNVAGENVEYYSNVITN
FT                   GQARPCNTNEDDQGRLLALFLGAVHHMVDFGRVSMIKAFSNFDRPPPQLSAYQSRFYVG
FT                   EGATEPGLRNAWKSIIVIVDDVLENWDSVFDAGIKPNTYMGDIKGTLGGVCDFNSTASA
FT                   AKGSVQGS"
     atgagtatag tatgggtagg agcaatacga aagaacgcac aacaagacat aatgctcaaa        60
     aagctttgtt taggcctact ggctctagca acaacgacat tgtgtgaatc catctcacgt       120
     gacgtgacga caacgactgt cattgcagcc gtaagttcaa gttcttcgtc cttaactgtc       180
     gctacgcctg gtactcctgt gtctccaaag gttctcctta tcgccaatga gtttgaattt       240
     ggatacctcg acgcctacaa tttcaccacc caatacaccg gtgtgctctt tgatcaaact       300
     tttgcctgta ctgaggatgg cgctatttgt aaacttgagt gtggccaaga gcttgtttcc       360
     gcctcacaga tcacagcgct catgatgatc cccggagtgg acctcaaaaa aacttacgtt       420
     atcattactg gcactggcgg tgtgaatccc aagtacggaa cagctggggg tgcggcaatc       480
     agcacgtttg gaattcaatg ggagtggggc agtatgtttt tgggagacga cctacccgcc       540
     aacttctcgg gacaatattt cgctagctac gctcagcttt cccctgacaa gtaccccgta       600
     acagtgggct ctgaagtgta caagctcaac gaagcacttg tggatcgctt ctatgctact       660
     ggtagtaaag tcacatatga agatgtttca gagacctctc aaggcttaag ggcaacttat       720
     gagtacgatg cagccaagca agaccctttc ttggcaaggt gcgatactgt ttcagcacaa       780
     gtttactggc acggcaatgt ggctggagaa aatgtcgagt attactccaa cgtaatcaca       840
     aacggacagg cacgcccatg taacaccaac gaagatgatc aggggaggct actggctctc       900
     ttcttgggtg cggttcatca tatggttgac tttgggcggg tttcaatgat caaagccttt       960
     agtaactttg accgcccccc tccacagcta agcgcttacc aatcgaggtt ttatgttgga      1020
     gaaggtgcaa cagagcctgg attgagaaat gcttggaaat caatcattgt aattgtggat      1080
     gacgttcttg aaaactggga tagtgtgttt gatgctggta taaagccaaa tacgtacatg      1140
     ggcgacataa agggaacctt gggtggcgtg tgtgacttta attccactgc aagtgcagca      1200
     aaagggtcgg tgcaagggag ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page