(data stored in ACNUC8465 zone)

EMBL: CU928166.PE434

CU928166.PE434       Location/Qualifiers
FT   CDS_pept        888176..889927
FT                   /locus_tag="KLTH0B10472g"
FT                   /old_locus_tag="KLTH-ORF14441"
FT                   /product="KLTH0B10472p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21799"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD8"
FT                   /protein_id="CAR21799.1"
FT                   /translation="MKIQSVCVLFLVLCLVEPSSLNQSRRKYASKSQTLFQTANTTTHL
FT                   SSQIESDGLLLINSRSNVSLGYATIDQLQDYLSNGSLSSQDLVRYYLQRFQQLNPHVKG
FT                   ILQLNPDALKIAKERDEERTQGLVRGPLHGIPFLVKDNYATKDKMETTCGSWSLLGSVV
FT                   PRDAFVVAKLRDAGAVLLGHTTLSEWADMRSSCYSEGYSARGGQARCPFDLSVSPGGSS
FT                   SGSAVAVAADMVTFSLGTETDGSIIDPAMKNGIVGFKPTVGLTSRAGVVPESEHQDSTG
FT                   PMARTVRDAVYAFQYMWGVDERDVYTLNQTGHVPQDGDYVKFLSDKESLKGARFGIPWQ
FT                   KLWTLAEENEISRLAEVIKMIESAGATIYNNTNFKNLDVVSSSGWDWNMGPANESEFTV
FT                   VKVDFFNNIESYLSELENSDMRSLKDIVEYNNRNYETEGGTENTHHAFQSGQDSFMESL
FT                   SWGGVQNETYWQAVEFVQKTSRGEGIDYALNYTDPETGENFNLDGLLVPSGLPITHQQA
FT                   AKAGYPMITLPVASKESNGRPFGLGIIQSAWEEPKLIKYGSAIEDLLNYQLKPWSNDNL
FT                   DKNISTT"
     atgaaaattc aatctgtgtg tgttctcttt ctggtccttt gccttgtgga gccatcgtct        60
     ctcaatcaat caaggagaaa atatgcctcg aaaagccaaa ccctttttca aacggctaac       120
     accacaacgc atttatcctc gcagatcgag tcagacggat tgctccttat aaattcacgc       180
     tcgaatgtct cattaggata tgcaacaata gaccagctgc aagattacct gagcaacggg       240
     tctttatcat cccaagatct ggttcgttac tatcttcagc gcttccagca actcaaccct       300
     catgtgaaag gcattctgca gctgaatcca gacgcgctaa aaattgctaa ggaaagggat       360
     gaagagcgca cccaaggtct ggttagagga ccattacatg gcataccatt cttagttaaa       420
     gataattatg cgaccaaaga caaaatggaa acaacatgtg gatcttggtc attattagga       480
     tcagttgttc caagggatgc atttgttgtt gcaaaattga gagatgctgg agccgttttg       540
     cttggacata cgacgcttag cgaatgggcc gatatgaggt cttcatgtta ctctgaaggc       600
     tattctgctc gtggtgggca ggctcgttgc ccttttgatt tgagtgtaag ccctggcggg       660
     agctcttctg gaagcgcggt ggctgttgcg gccgacatgg taacctttag ccttggaaca       720
     gaaaccgatg gtagcattat cgacccagct atgaaaaacg gcattgttgg ctttaagcca       780
     acagtagggc tgacttcaag ggcaggggtg gttcctgaat ccgagcatca agactctact       840
     ggaccgatgg caagaactgt aagagatgct gtttacgctt ttcagtacat gtggggtgtg       900
     gatgagcgag acgtatacac tttgaaccaa accggacacg taccccagga cggagattat       960
     gtgaaatttt tgtcagacaa ggaatcgttg aaaggcgcca gattcggcat accttggcaa      1020
     aaactttgga cgttggctga agaaaatgaa atatcaagat tagcagaagt tatcaaaatg      1080
     atagaaagtg ctggtgccac tatctacaat aatactaatt tcaagaatct tgacgtcgtt      1140
     tcgagcagtg gttgggactg gaatatggga ccggccaatg aaagtgagtt cacagtagtc      1200
     aaagtcgact tcttcaacaa tattgaaagc tatttgagtg aactcgaaaa tagtgatatg      1260
     aggtctctaa aagatattgt ggagtacaat aaccgaaact atgaaactga gggggggact      1320
     gagaacacac atcatgcatt ccagtcgggc caagactcgt tcatggagtc tttatcgtgg      1380
     ggaggcgttc aaaacgaaac atactggcaa gctgtggagt ttgttcaaaa aacttctcgt      1440
     ggtgaaggta ttgactacgc tttaaattac actgaccccg aaacaggaga aaactttaac      1500
     ttagatggac tgctagttcc tagtggtctc cctattacac atcaacaggc tgcaaaggca      1560
     ggatatccaa tgataaccct gccagtcgct tccaaagagt ccaacggaag accctttggt      1620
     ttgggtatta tacaaagtgc ttgggaggag ccaaagctta ttaagtatgg atctgccatc      1680
     gaggatctat taaattatca gctgaaacca tggtctaacg acaacttaga taaaaatatc      1740
     tcaacaactt aa                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page