(data stored in ACNUC8465 zone)

EMBL: CU928166.PE50

CU928166.PE50        Location/Qualifiers
FT   CDS_pept        complement(118238..119137)
FT                   /locus_tag="KLTH0B01452g"
FT                   /old_locus_tag="KLTH-ORF15821"
FT                   /product="KLTH0B01452p"
FT                   /note="similar to uniprot|P42938 Saccharomyces cerevisiae
FT                   YGR205W Protein that binds ATP crystal structure resembles
FT                   that of E.coli pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA4"
FT                   /protein_id="CAR21415.1"
FT                   /translation="MTKRTLVDESTHFVLTHYDSKPEGKEGDDRSPFLVLISGPQGSGK
FT                   TTSTHAIKQKLHELRPELKCLCVSIDDFYLTHADQQKVSNNNSGNGLQQGRGLPGTHDM
FT                   RLLDSFMQRLHENKGSVHVPVYDKSLFGGEGDRSASADEVALPVDVVIVEGWFLGFEAV
FT                   GEKTLEQMRSEVSSPRGKLLRTHELQHLLQVDSGLGAYARALWNNPTFRSVGVVIAADV
FT                   ANIYRWRQQQEAQMIAKYGSGMNEEQVKAFVLRYMPCYELYYRSLMEHGSLGTEAALVV
FT                   HIDADRTVTGVEEKTRAA"
     atgaccaaga gaacgctcgt ggacgaatcc acacatttcg tactgaccca ttatgacagc        60
     aagcccgagg gaaaagaggg ggatgaccga tccccatttt tggtccttat ctccggtcct       120
     caaggctccg gcaagacgac ttccacgcac gccataaaac aaaagctgca tgaactgagg       180
     ccggagctga aatgcctctg cgtctcaatc gacgactttt acctcacaca tgctgaccag       240
     cagaaagtgt cgaacaacaa ctcgggcaat ggccttcaac aagggcgggg cctcccgggc       300
     acgcacgaca tgcgtcttct tgacagtttc atgcagcgtt tgcatgaaaa taaaggttct       360
     gtgcatgtgc ccgtgtacga caaatcgctc ttcggcgggg agggcgacag gtctgccagc       420
     gcggacgagg tagcactgcc cgtagacgtg gtgatcgtgg agggctggtt cctggggttt       480
     gaggccgtcg gcgagaagac gctggaacaa atgcggtccg aggtgtcctc gccgcgggga       540
     aaactgctac ggacgcacga actgcagcat ctgctccaag tagattcggg tctaggagct       600
     tacgcacgtg ctctttggaa caacccaaca tttcggtcgg tgggcgttgt gatcgcggcc       660
     gacgtggcca acatttaccg ctggaggcag caacaggagg cgcagatgat tgcgaaatac       720
     ggtagcggaa tgaatgagga gcaagtcaag gcgtttgtgc tgaggtacat gccctgttac       780
     gagctgtatt accggtccct catggagcac ggcagcttgg gcactgaggc agctctggta       840
     gtgcacattg acgccgacag aacagtcacg ggcgttgaag agaaaacgcg agccgcatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page