(data stored in SCRATCH zone)

EMBL: CU928166.PE58

CU928166.PE58        Location/Qualifiers
FT   CDS_pept        129632..132004
FT                   /locus_tag="KLTH0B01628g"
FT                   /product="KLTH0B01628p"
FT                   /note="similar to uniprot|P42935 Saccharomyces cerevisiae
FT                   YGR200C ELP2 Elongator protein part of the six- subunit RNA
FT                   polymerase II Elongator histone acetyltransferase complex
FT                   target of Kluyveromyces lactis zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21423"
FT                   /db_xref="GOA:C5DCB2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR037289"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB2"
FT                   /protein_id="CAR21423.1"
FT                   /translation="MSGMAKAEAIFIGGNRQTQASDYNPKHGILAYGAGKTIAFWKPLD
FT                   PAHRGVYATLKGHDAEVTCVRFVPGTEFMITASEDSQVRLWAFDGEDNSAMACIQSTDH
FT                   HKHTITSLSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVFPLCMALKSVEDS
FT                   KVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDFYEEGPGNMLLATG
FT                   SQDRYIRLWRIRTNDLIDNSDEDDSKLKLLSNKQSKFYIDGSLRVAINFEALIIGHDDW
FT                   VSCLKWHSDKLQLLASTADTAVMVWEPDAESGIWVCASRLGELSSKGASTATGSSGGFW
FT                   SCNWFTQEKADYILTNGKTGSWRMWKSDDISGWEQQLAITGPTKPTTDVAWSPNGLYLL
FT                   GTSLDQTTRLFARCKLDGEQDKISGSWFEFSRPQIHGYDMICVEPISNTRFISGGDEKI
FT                   MRSFDEPKGVAQILQKFAGVPFENEKYMPESASLPALGLSSKATADVDEDEDEDPDARE
FT                   TNETKNISFDIVASLHSPPVEDQLQRHTLWPEIEKLYGHGYEISCLDVSPDAKIIASAC
FT                   RSNNLQHAVIRFFDSNTWLHLEPAPQFHNLTITRLRFSKDNTQLLSVSRDRQWAVWKRD
FT                   LETNQFTLAYKNEKAHTRIIWDCEWAPLSFGSVFLTASRDKSIKLWRFSEEEQDYLQEA
FT                   SIKLGISVTAISVHEKLFDNKLIIAAGLENGSLQVYTYENEFQKVLEIEDRYTPADRIS
FT                   RLRWSSNGNELFLAAASADTSFRIYSVKSESIKNSPN"
     atgtcaggga tggctaaggc tgaggccatt ttcattggtg gtaacaggca aacacaggct        60
     agtgactaca atcctaaaca tggcattttg gcttatggcg ctggtaaaac catcgcgttc       120
     tggaaacctt tggatccagc tcatcgcgga gtttacgcaa cattgaaggg ccatgatgcc       180
     gaagttacgt gcgtgaggtt tgttcctgga accgagttca tgataactgc gtcagaagac       240
     tcgcaagttc gtttgtgggc ttttgatgga gaggacaaca gcgcaatggc atgcatccag       300
     tcaaccgatc accacaagca caccatcacg tcactttctg tgctctctaa tttgctaaca       360
     gtgggctgtg ctgatggttc ggtctctgtt tggcaaataa acgagcgtca gatctcgctt       420
     gtccactctt ttgttctcaa ggcaggcgta ttccctctgt gtatggcatt gaaaagcgtc       480
     gaagacagca aagtcctgct ggcggtgggc ggaacaaact cgaatgtatt tatttattct       540
     ttcacgcgcg aagcggcagc gctggagaat ttccaactag cagctaccct agaaggccat       600
     gaggactgga ttaaggctat ggacttttac gaggaaggcc cagggaacat gcttctcgct       660
     acaggctctc aagaccgcta cattaggtta tggagaatac gaacaaacga tctaatagac       720
     aactctgatg aagacgacag taagttgaaa ctgttgagca acaagcaatc caagttttat       780
     atcgacggca gcttgagagt ggccataaat ttcgaagctc ttatcatagg gcatgatgac       840
     tgggtctctt gtctcaagtg gcacagtgac aagcttcaac tgttggcttc taccgcggat       900
     acagcggtga tggtttggga acctgatgca gagtctggaa tttgggtttg tgcgtccaga       960
     ttgggagagt tgtcctccaa aggtgcgtct actgcaactg gttcatctgg aggcttttgg      1020
     tcttgcaatt ggttcactca agaaaaagct gattacatcc ttacaaatgg taagacagga      1080
     tcatggagga tgtggaaatc tgacgatatt agcggatggg agcagcaact tgccataaca      1140
     gggcccacaa agcccactac cgatgtagca tggtcgccaa atgggcttta cctcctcgga      1200
     acctctctag accagacaac aaggcttttt gcacgttgca agcttgatgg ggaacaagac      1260
     aaaatcagcg gctcttggtt cgaattttcc aggccccaaa tccatggtta cgacatgatt      1320
     tgtgttgagc ccatttcaaa cacgaggttc atcagcggtg gtgacgagaa gattatgaga      1380
     tcgtttgatg agccaaaggg cgttgctcag atactacaaa aatttgctgg ggtgcccttt      1440
     gaaaacgaga aatacatgcc agaatccgcg tctttgcctg cattgggctt atcgagtaag      1500
     gctactgctg atgttgatga ggacgaggac gaagaccctg atgcgcgcga gacaaatgaa      1560
     acaaaaaaca tttctttcga cattgttgcc tcgcttcact ccccccctgt agaagatcag      1620
     ctccagagac acacgctttg gcctgaaatt gaaaaactct acggccacgg ttacgagatt      1680
     tcctgtctag atgtgagtcc tgacgcgaag ataatagctt ctgcttgtcg atcgaacaac      1740
     ttacagcacg ctgtcataag gttttttgat tctaacacat ggttgcactt agagccggca      1800
     ccacaatttc acaacttgac gataaccagg ctccggtttt ctaaggacaa cacccaactc      1860
     ttgagtgtca gtagagatag gcaatgggca gtatggaaga gggaccttga gaccaaccag      1920
     ttcacactag cttacaaaaa tgagaaagca catacaagaa tcatatggga ttgcgagtgg      1980
     gctccacttt cttttggcag cgtattcttg actgcttcta gggataagag tattaagctt      2040
     tggaggtttt ctgaagagga acaggactac ttgcaagagg cttccatcaa gcttggcata      2100
     tctgtgacgg caatttcagt tcacgagaaa ctttttgaca ataaacttat aatagctgcg      2160
     ggtctggaga acggttctct tcaagtctac acctacgaaa atgagttcca aaaagttctc      2220
     gaaattgaag ataggtacac gcctgcagac agaatttcaa ggctcaggtg gagttcaaac      2280
     ggcaatgagc ttttccttgc agcagcgagt gcagacacct ccttccgcat ctattctgtc      2340
     aaatcagaaa gcataaaaaa ttctccaaat taa                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page