(data stored in SCRATCH zone)

EMBL: CU928166.PE59

CU928166.PE59        Location/Qualifiers
FT   CDS_pept        complement(132053..134317)
FT                   /locus_tag="KLTH0B01650g"
FT                   /old_locus_tag="KLTH-ORF15784"
FT                   /product="KLTH0B01650p"
FT                   /note="similar to uniprot|P42934 Saccharomyces cerevisiae
FT                   YGR199W PMT6 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway dolichyl phosphate-D-
FT                   mannose:protein O-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21424"
FT                   /db_xref="GOA:C5DCB3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB3"
FT                   /protein_id="CAR21424.1"
FT                   /translation="MSSSGFLPKSSELNLRERRKNFDGDQLSDTDDNELHEKNDEKLVE
FT                   THGAELKKRKIAKFANMGGIAAITLLSFYVRFMKIDASDIVVWDEAHFGKFGSYYIKHE
FT                   FYHDVHPPLGKMLIALSEYLAGFDGNFDFSSGDPYPNGVNFKFMRQFNATFGALCAPIM
FT                   LLSAQNLGFSTLCSYLLGLMVALELSFISLSKFILLDSMLLFFTATTFHCITEVHKLRG
FT                   KQFTKKWSLWMLLLGISIGCVCSVKWVGLFVTVIAGVYTVADLLSYHYDKNMGRLRYYK
FT                   HWFIRIIDLIVIPFMIYLFCFKIHFTILSRSGTGDAATNTLFQVNLDGNNIEVGPRDVA
FT                   YGSELTIRSHGLSPNLLHSHVQLYPLGSGQHQVTGYGHSDDNNRWVVKFSRESGLSLDN
FT                   STILDSKHLLLRDNSEIRLVHKNTQANLHSHEIPAHVSKNSYEVSGYGDEVIGDTKDDW
FT                   VVEIVEQLDSSNSSLPQEDPSVLHPISTSFRLRHKELGCYLATTGLAYPAWGFKQAEIV
FT                   CKHSWTKRDKSTWWNVEDHWNPAMEKTEGYIPPKSKFWADFVLINFAMASSNNALVPDE
FT                   DKYDSLASEAWEWPILHVGLRMCGWGHHTVKYFLMGSPFQTWLSTGSLVAFVFIILRLA
FT                   YKWRRQSVLVTSDFLSKVGMQGILPFLAWLLHYLPFVAMGRVTYVHHYVPALYFALLVL
FT                   GFVLETCVPKRFYLNYIIYALLYAGCIYIYNLFSPIAQGMQGSAIDFRYLQWFNTWNIA
FT                   L"
     atgtcaagct ctggcttttt gcccaagtct tcagaactaa atctaaggga acggcgaaag        60
     aacttcgatg gagatcaatt gagcgacaca gacgacaatg aattgcacga gaagaacgat       120
     gaaaagctag tggaaactca cggagctgag ctcaagaaaa gaaagattgc caaatttgcc       180
     aacatgggag ggatagccgc tatcacattg ctgtcctttt acgtgagatt catgaaaata       240
     gatgctagcg atatcgttgt ctgggacgag gcgcattttg gaaagtttgg atcatactat       300
     atcaagcatg aattttacca cgacgttcat ccaccgcttg gaaaaatgct gatagcactc       360
     agcgaatacc ttgcaggatt cgatggaaac tttgatttct catcaggcga cccctaccct       420
     aatggcgtaa actttaagtt catgaggcag ttcaacgcta cgttcggcgc tttgtgcgca       480
     cccattatgt tactttccgc tcagaattta ggtttcagca cgctgtgctc gtacctattg       540
     ggcctcatgg ttgctttgga gctatcattc atttcgcttt cgaagtttat tcttttggac       600
     tcgatgctac tattcttcac tgcaaccact tttcactgca tcactgaggt tcataagctg       660
     cgggggaaac agttcactaa gaagtggtct ctttggatgc ttctcctcgg gatttcaatc       720
     ggatgtgtct gctctgtcaa gtgggtgggc cttttcgtaa cagttatcgc gggggtttac       780
     accgttgccg atctactgtc ttaccattat gataaaaaca tgggtcgttt gcgctactac       840
     aaacattggt tcatccgcat tattgacctc atcgtaattc ccttcatgat ttacctgttc       900
     tgtttcaaaa ttcacttcac aatcttgagc cggtctggta ccggcgacgc tgccacgaac       960
     acgcttttcc aagtaaacct cgatgggaac aacattgagg ttggcccaag agatgttgct      1020
     tacggttctg agctgaccat tcggtcacat ggacttagcc ctaatttgct acactcgcat      1080
     gtacaattgt atccattagg atcaggacaa caccaagtta ccggttatgg ccactcagat      1140
     gacaataaca ggtgggttgt aaagttttca agggaatctg gcttaagtct tgacaactcc      1200
     actatacttg atagcaagca tcttcttcta agggacaatt ccgagattcg cttggtgcac      1260
     aagaacactc aagccaatct acattcccat gaaatccctg cacatgtgtc caagaacagc      1320
     tacgaagttt caggatatgg ggacgaagtc ataggtgata caaaggatga ttgggtggtg      1380
     gaaatagtcg aacagcttga ttcctccaac tcctcactgc cacaggaaga cccatctgtt      1440
     ttgcatccca tttctacaag cttcagattg agacataaag aactcgggtg ttacttggcc      1500
     actacagggt tagcataccc tgcatgggga tttaagcagg cagagattgt ttgcaaacac      1560
     tcatggacaa agcgcgataa gtcaacatgg tggaacgttg aggaccattg gaaccctgcg      1620
     atggagaaaa ctgagggcta tatcccccca aaatccaagt tctgggctga ctttgtcttg      1680
     ataaattttg cgatggcttc ttcaaacaat gccctggtac ccgacgaaga caagtatgac      1740
     tcactggcga gcgaagcctg ggaatggcca atattgcacg ttgggttacg tatgtgcggt      1800
     tggggccatc acacagtgaa gtatttcctc atgggctcac cattccagac gtggctctcc      1860
     accggctctc ttgtagcctt tgtatttatt attctgcgac tggcttacaa gtggagaaga      1920
     caatccgttt tagtgacttc cgacttcttg agcaaggttg gaatgcaggg aattttacca      1980
     tttttggcat ggctcttaca ctatctacca tttgttgcta tgggaagagt tacgtatgtg      2040
     caccattacg tcccagcgtt atatttcgca ttgttggttc tcggtttcgt gcttgaaaca      2100
     tgcgttccaa agaggttcta cctgaattac attatttacg ccttgcttta tgcaggctgc      2160
     atctacattt acaatctctt ctcacctatc gcacagggta tgcaaggatc tgcgatcgac      2220
     tttagatact tgcaatggtt caacacttgg aatattgcat tatga                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page