(data stored in SCRATCH zone)

EMBL: CU928166.PE60

CU928166.PE60        Location/Qualifiers
FT   CDS_pept        complement(134593..136791)
FT                   /locus_tag="KLTH0B01672g"
FT                   /old_locus_tag="KLTH-ORF15782"
FT                   /product="KLTH0B01672p"
FT                   /note="similar to uniprot|P46951 Saccharomyces cerevisiae
FT                   YGR198W Essential protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21425"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB4"
FT                   /protein_id="CAR21425.1"
FT                   /translation="MQEDYEQVEAALGSRLLGASEFRTKNKRLNQVLSLQYRVHYHVHQ
FT                   KGIIKEAACKVLLEECNRFERDSSDALVEKVWLNLAGILNYHLSHPQTADKCLAESAKI
FT                   SAAQGAFGTFLSVENLYYSGLLRGDKSRDFYVKHLPEVVTSLPKESNVLTYHYLDRIIS
FT                   RLSMNWSQAISAFPRTVISSFIAIMSEPDGHDQELLALGKTILASAKFPNAEEANNASL
FT                   EQFHLVLQHYLRSTKSELSPDWHSFVVESMSRTFQSMIVTKTAMIYFGRENQLRESILN
FT                   FNVFLNYNRSYRDLNNGEWFDVLAIIDAYEHIVSRSEGRDIPKIFALKDVMKRFEGLLC
FT                   SFYEDSALPLVKVERSIEWASEGTRVFVPERASSLLARSWNALYEYSREDLDKLLNDNH
FT                   TYYLANALAARPDNSKIAFNYAFTLAQKREITHAVKFLKSNILEREPENYKAWHLLALC
FT                   ESIKEDKNVSFKIVCSVLQALENAVHEDPQAPARDRWQLIHLKLTQLAIIQEMFGVNDA
FT                   LELLPELFELFNFAFPENGKNGDLGSAYNKTKDYLHQSVWLFAVKLYLTQGLIVDAREA
FT                   LAESRNVTKNFQNLNNDLADGYLSLDVDGKKALRSFEKVLFYDALNIDAIVGFAKCLVP
FT                   TSQENSSHQLQPQTPSAAGLDAFTGEKDRSAAYARLKMVLEEVVERSIEGCHAPEVWWY
FT                   LSRVYENYDDTERLETSLWNCVKYQELQPIRDFKNCNF"
     atgcaggaag actacgagca ggtagaagcg gcccttggct cacgtttgct gggtgctagc        60
     gaattccgca caaagaacaa gcgcttgaat caagtgctaa gcttgcagta tcgagtgcac       120
     taccacgttc atcagaaagg cataattaaa gaggcggctt gcaaagtgct gttggaagag       180
     tgcaacaggt tcgagcggga ctctagcgat gcccttgtgg aaaaagtatg gctgaatttg       240
     gcgggaatct tgaactacca tctgtcgcac ccacaaacag ctgacaagtg cttggccgag       300
     tctgcaaaaa tatcggcggc acaaggtgcg tttggaacct ttctgtctgt tgaaaacttg       360
     tactacagcg ggttgctacg tggtgataaa tcaagagact tttacgtcaa acatctgcca       420
     gaagttgtta cttcactccc aaaagaatct aatgtgttga cttatcatta cctggaccgt       480
     attatatcac gtctctccat gaattggagc caagcaatct ctgcgtttcc tcgcaccgtt       540
     atctcctcct tcattgctat catgtcagag cctgatggcc atgaccagga gctgctcgca       600
     ctgggaaaga cgattttagc atctgcaaag ttccccaatg ctgaagaggc taacaatgcc       660
     tcgcttgagc aattccactt agttctccag cattacttaa ggagcaccaa gtccgaatta       720
     tctcccgatt ggcattcttt tgtggttgag tcaatgtcac gaactttcca gagtatgata       780
     gtaaccaaaa ctgctatgat atacttcgga cgcgaaaacc agcttcgaga gtcgattctg       840
     aacttcaacg ttttccttaa ctacaacaga agctacagag atctcaataa cggcgagtgg       900
     tttgacgtgc ttgccataat cgacgcttac gaacacatcg tttcaagatc tgaaggtcgt       960
     gatataccga agatatttgc attgaaggat gtaatgaaga ggtttgaagg gctcttatgc      1020
     agcttctatg aggactccgc gctccccctg gtgaaagttg agcggtccat cgaatgggcc      1080
     tcagaaggca cgagggtttt tgtgcccgaa agggcttcta gtttacttgc caggtcgtgg      1140
     aacgcattat acgaatatag tcgcgaagat ttggacaagt tgcttaacga caaccacacc      1200
     tattatctgg ctaatgcgct tgctgctagg ccagataatt ccaagatagc cttcaactac      1260
     gcattcacgt tggcacaaaa gagggagata acgcatgccg taaaattcct caagtcaaac      1320
     attctagaaa gagagcctga aaactacaaa gcctggcacc tgctagcgct ctgtgagtct      1380
     atcaaagagg acaaaaacgt ttcattcaaa atcgtttgct cagtgcttca agcgctggaa      1440
     aacgccgtcc atgaagatcc ccaagcgcca gcccgcgaca ggtggcagct gatccatttg      1500
     aagctaaccc agttggcaat catccaggaa atgtttggag ttaatgatgc gcttgaactt      1560
     ctgccagagc tatttgaact gttcaacttt gccttcccag aaaacgggaa aaacggcgac      1620
     ttgggctctg cttacaacaa aaccaaagac tacctccatc agtctgtatg gctgtttgct      1680
     gtaaagctct atttgacgca gggcctaatc gtagacgctc gtgaagccct ggcggaatca      1740
     cgtaatgtaa ccaagaattt ccaaaatttg aacaatgatc tggccgatgg atatctctcg      1800
     ttggacgtcg atggcaaaaa agcccttcgt tctttcgaga aagtcctatt ttatgatgct      1860
     ctgaatatcg atgccatcgt gggcttcgct aaatgcctgg ttccaaccag ccaagaaaat      1920
     tcctcgcatc aactacaacc ccaaacgccg tcggctgctg gtctcgacgc cttcactggc      1980
     gaaaaagata gatcagctgc atacgccaga ctgaaaatgg tactcgaaga agtagtcgaa      2040
     agatcaatcg agggctgcca tgcccctgaa gtgtggtggt atctgtcacg cgtctacgaa      2100
     aattacgacg acacagaaag attagaaacg tccctgtgga actgcgtcaa atatcaagaa      2160
     ctacagccta tccgcgactt caagaactgc aatttttag                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page