(data stored in SCRATCH zone)

EMBL: CU928166.PE62

CU928166.PE62        Location/Qualifiers
FT   CDS_pept        137755..140211
FT                   /locus_tag="KLTH0B01716g"
FT                   /old_locus_tag="KLTH-ORF15778"
FT                   /product="KLTH0B01716p"
FT                   /note="weakly similar to uniprot|P46949 Saccharomyces
FT                   cerevisiae YGR196C FYV8 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21427"
FT                   /db_xref="InterPro:IPR026248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB6"
FT                   /protein_id="CAR21427.1"
FT                   /translation="MSDNVERRKSQRWVSVGKGSYDGKEWDSSDEDGSYEAWEDDNGET
FT                   AQSPKRSGTVTKLPPLPKLQYGRDVDSAPEGSNGSSPKLESTSSNLDQLMSQISHEMTP
FT                   RSESRERFSPNDGTPRPPRQFGDEGDEHSSAFSYSDSEEELQVSKTGYFSNMVGATQSA
FT                   GRSGSYSDDEVYVTPDPSSLSRATAEPEAARMDTRGSDSASSAAHASKSELERYNASPD
FT                   DRESMSASTTEVSKSSSPKENSASLSGGQPASVKSDNGSSETDHLTGSVLSSADEVHTG
FT                   SKDVQSGLESVQGSQPSGSAVEESKETISKGTLAHQGDDTAPQQEPHESHGTPIKDARN
FT                   NSSDEYGDNESFFNHYGNNSSQSSPANNPDNSPKKHDSSPLKLRQSSKTQLGYENVKSQ
FT                   AQDENSSDNASSTSEPGSFKFKDRVRESILESSDEDIGDDESVLRVPTSGYYAKMLKDS
FT                   SQAERGDDQSTETEGSSIVSSETDTGSITKSINGSNQDGATTPEAISPRKHNEEDQTTD
FT                   TEPLEEQEGSKNLQSRQSINLGKWQPDTDATRAAFLGEARPEVPEDFVIDQDGNMVDVN
FT                   PSSMRNPRVVSTYSEAESAWNAFPSAGNAEGDLDTIYDTKTIYDNQTIYNVPGIATNNS
FT                   SLPPLPNNISALESSDSAAVTDSDSILRHLSGEKKPHFSNLKENFSVHTPNSEEIAQVR
FT                   GREAPSVNLDSLISAKGKTHAMKISDLRNHSEQLNAYDTGLHTWINYALKNSSSDKDYI
FT                   FQDYKVNKHVRDAYAQADELSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEKSKGLFSS
FT                   IGKKKA"
     atgtctgata atgttgagag gagaaagtcc cagagatggg tgagtgtcgg caaaggttct        60
     tatgacggca aagaatggga cagcagcgat gaggacggat cgtatgaggc ttgggaagat       120
     gacaatgggg aaactgcgca gtcgccaaaa agaagcggaa ctgtgactaa gttgccaccg       180
     ctgccaaagc tccagtatgg cagggacgtt gacagcgccc ccgaggggag caatggctcg       240
     agcccgaagc tcgaatccac gagttccaac ctcgaccagc ttatgagcca aatttcgcac       300
     gagatgaccc cgaggtctga gtcgagagag cgattttccc ccaacgatgg gactcctagg       360
     ccaccgcggc aattcggtga tgaaggcgat gaacactcga gcgcgttcag ttactcggat       420
     tctgaggaag agctgcaagt ttcgaagacc gggtacttct caaacatggt aggtgccacg       480
     caaagcgccg ggagaagtgg tagttactcg gatgatgaag tgtatgtcac ccctgatccc       540
     tccagcctgt cgcgagcaac tgccgagcca gaagccgcga ggatggacac gcgtgggtcg       600
     gactcggcct caagcgcagc acacgcatcc aaatctgaac ttgagagata taatgcctct       660
     cctgatgacc gagaatccat gtcagcctct actactgagg tctcaaagtc atcctctcct       720
     aaagaaaata gtgcttcact cagcggcggg cagcccgcct cagttaaaag tgacaatgga       780
     agctccgaaa ctgaccatct gaccggttct gtcctctctt ctgcggatga ggtacatact       840
     ggaagcaagg atgtgcaatc tggcctcgaa agtgttcaag gctcacaacc gtcaggcagt       900
     gcagtagaag aaagcaagga aacaatttca aagggtactc tagcgcatca aggcgacgat       960
     actgcgcctc aacaagagcc acatgaatcg catgggaccc caattaaaga tgcaagaaac      1020
     aattcttctg acgagtacgg cgataatgag tcgtttttca accattatgg taacaatagc      1080
     tcgcaatctt ctcccgcgaa taatccagat aattccccaa aaaagcacga ttcatcccct      1140
     ctgaaactgc ggcaatcatc taagactcaa cttggttacg agaatgtgaa gtctcaagca      1200
     caagatgaga acagcagcga caacgctagc tccacgtcgg agccagggag tttcaaattc      1260
     aaggaccgcg taagagaatc cattcttgaa agcagcgatg aagacatcgg agatgatgaa      1320
     agtgttctta gggtgccgac aagcggctac tacgcaaaaa tgttgaaaga ttcatcgcag      1380
     gccgagcgcg gcgatgatca gagtactgaa actgagggta gcagcatagt gagctctgaa      1440
     acagatacag gctcaataac gaaaagcatt aatggaagta atcaagacgg ggcaactaca      1500
     cctgaagcta tttcgccaag gaaacataat gaggaagacc agaccactga cactgaaccg      1560
     cttgaggagc aggaaggctc aaaaaatctt caatcaagac aatcaataaa ccttggtaag      1620
     tggcagcccg atactgacgc tacgagagcg gcatttctcg gagaggcaag gccggaggtg      1680
     cccgaggact tcgtgattga ccaggatgga aatatggttg acgtaaaccc ctccagtatg      1740
     agaaatcctc gtgtagtttc aacctactcg gaggccgaaa gcgcttggaa tgcatttcct      1800
     tccgctggaa acgctgaagg tgatcttgat accatttatg acacgaaaac gatatatgat      1860
     aatcaaacga tttacaacgt tcctggcatc gccaccaata acagttcgtt accgcctctc      1920
     cctaataaca tctcagcctt agaatctagc gacagtgctg cagtaactga ctcagattcg      1980
     atcctcaggc atctcagcgg cgagaagaaa ccacattttt caaatctgaa ggaaaacttc      2040
     tcagtacaca ctccaaactc tgaggaaatt gctcaagtta gaggccgaga ggctccatca      2100
     gtcaatttag actcgctgat aagcgctaaa ggaaaaacgc atgccatgaa aatcagtgat      2160
     ctcaggaatc actccgaaca acttaatgct tacgatacag ggctacacac atggataaat      2220
     tatgcgctga agaattcaag ttctgacaaa gattacatct tccaggacta taaagtcaac      2280
     aaacatgtta gggacgcata tgcgcaagca gacgaattga gtaaaaagat gactgtcagt      2340
     aacacggtgg caaacgtaaa ccagaacgtc tcacatctga aacgcaaagt tttctctcac      2400
     acaatgaagg aaaagtccaa gggtctgttt tcttctattg gtaagaagaa agcttag         2457
//

If you have problems or comments...

PBIL Back to PBIL home page