(data stored in SCRATCH zone)

EMBL: CU928166.PE65

CU928166.PE65        Location/Qualifiers
FT   CDS_pept        143331..143672
FT                   /locus_tag="KLTH0B01782g"
FT                   /old_locus_tag="KLTH-ORF15770"
FT                   /product="KLTH0B01782p"
FT                   /note="some similarities with uniprot|P47087 Saccharomyces
FT                   cerevisiae YJR012C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21430"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB9"
FT                   /protein_id="CAR21430.1"
FT                   /translation="MSGPLTYEELVDHIVNEKPIPNILSVPNVTLDPSLVTKSNMKPRP
FT                   KPWERNNAATSELAGEPPHQQTAVAEGPEICTRSRSSESLSKYYAIEAEFEQQLQSFLG
FT                   GNEESEKLQ"
     atgagtgggc cactaacata tgaggagtta gtagatcata tcgtgaatga gaagcccatc        60
     cccaacatac tgagcgtccc caacgttaca ttagacccat ctttagtcac taaatcaaat       120
     atgaaacccc ggcccaaacc ctgggagcgg aataacgccg caactagtga gttggctggc       180
     gaaccaccac atcagcagac tgcagtagca gaggggcccg aaatatgcac tcgttctcgc       240
     agttctgaga gtctctcaaa gtactatgct attgaggcgg agtttgagca acagttgcag       300
     agcttcctgg gcgggaacga ggaaagcgag aagttgcaat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page