(data stored in ACNUC8465 zone)

EMBL: CU928166.PE68

CU928166.PE68        Location/Qualifiers
FT   CDS_pept        146051..146317
FT                   /locus_tag="KLTH0B01848g"
FT                   /old_locus_tag="KLTH-ORF15766"
FT                   /product="KLTH0B01848p"
FT                   /note="similar to uniprot|P46965 Saccharomyces cerevisiae
FT                   YJR010C-A SPC1 Subunit of the signal peptidase complex
FT                   (SPC) which cleaves the signal sequence from proteins
FT                   targeted to the endoplasmic reticulum (ER) homolog of the
FT                   SPC12 subunit of mammalian signal peptidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21433"
FT                   /db_xref="GOA:C5DCC2"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC2"
FT                   /protein_id="CAR21433.1"
FT                   /translation="MSEVLQEIQKKLVFPIDFASQRRLDRSVYLCLMIGTVVSCFIGLF
FT                   TQSLFNLVVSFGLTFCVCLALGLPSYPAYNKQRLEWVKPKISH"
     atgtctgagg tgctacaaga gatacaaaag aagctggtct tccctattga ctttgcgagt        60
     caacgcagac tcgaccgctc tgtctactta tgcctcatga tagggacagt ggtttcctgc       120
     ttcataggtt tgttcaccca atcgctattc aacctggtgg tatcgttcgg gctaaccttc       180
     tgcgtctgcc tagccttggg actacccagc taccctgcat ataacaagca gcgtcttgag       240
     tgggtcaagc ctaagatcag ccattaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page