(data stored in ACNUC8465 zone)

EMBL: CU928166.PE69

CU928166.PE69        Location/Qualifiers
FT   CDS_pept        146628..148373
FT                   /locus_tag="KLTH0B01870g"
FT                   /old_locus_tag="KLTH-ORF15764"
FT                   /product="KLTH0B01870p"
FT                   /note="similar to uniprot|P42826 Saccharomyces cerevisiae
FT                   YGR194C XKS1 third enzyme in the xylose pathway;
FT                   Xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21434"
FT                   /db_xref="GOA:C5DCC3"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC3"
FT                   /protein_id="CAR21434.1"
FT                   /translation="MTADKVGAFYLGFDLSTQQLKCLVIDQNLALVHSETIGFDKDLSH
FT                   YKTTKGVYLHEDGTVECPVAMWLEAVDLVFERMSKHKHIDLSLVRAMSGSCQQHGSVYW
FT                   AESGPGLLPKLDSKQSLKQQLYPEAFSRNVAPNWQDHSTGEECREFEESCGGAAQLAQV
FT                   TGSRAHHRFTGPQIMKIAKKEPEVYRATSKVSLVSSFLASILAGEFTPLEEADACGMNL
FT                   YNIDKRDYDDKLLRNVDDDTETLRSKLGGPPINCDKPAPVGTLSPYFVEKYGLNPECQI
FT                   FPFTGDNLATICSLPLQPNDVLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPRHYMGM
FT                   ICYCNGALARERIRDQLSETHDWEPFNAAVKSTTLNTDNEIACYFPLGEIVPNVPSSYR
FT                   RATFAKSPDSQEVKLELKDAFADIAHDAKNIVESQALSCRVRISPLLSKDCADPSVDLG
FT                   DSMVHFDCDDFPLSEYKKRPRRAFFVGGASKNDAIVERFAQVLGATDGNFRLETPNSCA
FT                   LGGCYRAMWSHLYYGGLTKAPFDNFLNEQFRWDTDVQSLSLTKDKEWQYFNNKIQALSE
FT                   LEKTL"
     atgacagctg acaaggttgg cgcattctat ctgggattcg acctctcaac acagcaactg        60
     aagtgtttgg tgatcgacca aaatctggcc ttagtacact ctgagaccat aggattcgac       120
     aaagacctga gccactacaa aaccaccaaa ggcgtctatc tgcatgaaga tgggactgtg       180
     gagtgtccag tagcgatgtg gctcgaggcc gtcgatctag tcttcgagag gatgtcaaag       240
     cacaagcaca ttgacctgag cttggtccgt gcaatgagtg gctcttgtca gcagcacggt       300
     tcggtttact gggctgaatc aggacccggg ttgcttccga agctcgattc caagcaatca       360
     ttaaagcagc aattgtatcc ggaggcgttc tccagaaacg tggcgccaaa ctggcaagac       420
     cacagtaccg gagaggagtg ccgagagttc gaggaaagct gcggaggcgc ggcacaactc       480
     gctcaagtca ccggctctcg tgctcaccac agatttacgg gtccgcaaat aatgaagatc       540
     gctaaaaaag aaccagaggt ttatcgtgca acatctaaag tctcgctggt gtcgtccttt       600
     ttagcttcta tcctggcagg tgaattcacg ccgttggaag aagcggacgc atgcggtatg       660
     aacctgtaca atattgacaa gcgcgactac gacgacaaac tgttacgcaa cgtggacgac       720
     gacacagaaa ccctaagatc aaagctcgga gggcccccta tcaattgcga caaacccgcg       780
     cctgttggca ctttatcacc atactttgtt gagaagtatg gtttgaaccc cgagtgccag       840
     atcttcccct tcactggcga taacttggca actatctgtt ctctaccgct tcagcccaat       900
     gatgttctgg tgtccttggg tacaagcact acgattcttc tggtcaccga ccaataccac       960
     ccatccccta actaccatct gttcatccat cccaccattc cccgtcacta catggggatg      1020
     atttgttact gtaacggtgc gttggctaga gagcgtatca gagaccaact cagcgaaact      1080
     cacgactggg agcctttcaa cgcggcggta aaatctacca cgctcaacac tgacaacgaa      1140
     attgcttgct actttcccct gggggagatt gtgccaaacg tacccagctc ttatcgcaga      1200
     gcaacgtttg ccaagtctcc agactctcag gaggtgaagt tggaattaaa agatgcattc      1260
     gctgacattg cacacgatgc caaaaacatc gttgaaagcc aagctctcag ctgccgtgtg      1320
     agaatcagcc ccctgctatc aaaggattgt gcggatccaa gcgtcgactt gggcgactca      1380
     atggtgcatt ttgactgtga tgactttcct ctctcagagt acaaaaagcg tccaagaaga      1440
     gcgttttttg tgggtggtgc ttcgaaaaac gatgcaattg tcgagcgctt tgctcaagtg      1500
     ctcggagcca cagatggaaa cttccgtctg gaaaccccca actcatgcgc acttggtggt      1560
     tgctacaggg ctatgtggtc ccatttgtac tacggaggtc tcactaaagc acccttcgac      1620
     aacttcctca acgagcagtt cagatgggac acggatgttc agtctctgag cttaacaaag      1680
     gacaaagagt ggcagtactt taacaacaag atacaagccc tcagtgagtt agagaagact      1740
     ctctaa                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page