(data stored in ACNUC8465 zone)

EMBL: CU928166.PE70

CU928166.PE70        Location/Qualifiers
FT   CDS_pept        148776..150023
FT                   /locus_tag="KLTH0B01892g"
FT                   /old_locus_tag="KLTH-ORF15759"
FT                   /product="KLTH0B01892p"
FT                   /note="similar to uniprot|P16451 Saccharomyces cerevisiae
FT                   YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
FT                   protein (E3BP) of the mitochondrial pyruvate dehydrogenase
FT                   (PDH) complex plays a structural role in the complex by
FT                   binding and positioning E3 to the dihydrolipoamide
FT                   acetyltransferase (E2) core"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21435"
FT                   /db_xref="GOA:C5DCC4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC4"
FT                   /protein_id="CAR21435.1"
FT                   /translation="MIARGLLRGNAGRLACLRALHRSSALSKAQTFAMPAMSPTMEKGG
FT                   IVEWKFKVGDPFSAGDVLLEVETDKAQIDVEAQDDGKLAKIVVDNGAKDINVGEVIAYL
FT                   AEPEDDLATLELPQPEKSTGKSKAETKSAAKPSATAKTSPASISQENKPEPKKNAPSKS
FT                   SSDSKSSTGVAVKANPSQTLLPSVQMLLHVNNISAEDALNNIPASGPNGRILKGDVLSY
FT                   LGKVSQESVTKLAEYIEKGSALDLTNIELKEPEPAPKAKEEVAKKEPVVLSEQLHLKVA
FT                   SGVTYEQLARSLESYVKEAKYLAHEQPTTNPYSEHFDAVFEELITPEPRAPRFEVSYDL
FT                   ISLGSSGISAKQQDDIFDLLAGTKPSPAASEVETAQPNEFLVSVRVQVSDKFTDAPTKA
FT                   ERFVQYLRDLESSAEL"
     atgattgcac gtggactatt gagaggaaat gctggcaggc tagcttgctt gagagctctt        60
     cacaggagca gtgctttatc aaaagctcaa actttcgcga tgcctgcaat gtcccctacc       120
     atggagaagg gcgggatcgt cgagtggaag tttaaggtag gcgacccatt ttcagctggc       180
     gatgttttac tagaagtgga aacagataaa gcccaaatcg atgttgaggc tcaggacgat       240
     ggtaaactgg caaaaatcgt ggtggataac ggtgcaaaag acatcaacgt cggtgaggtg       300
     attgcttacc tggcagagcc tgaggatgac ctagctactc tcgagctgcc acaacctgag       360
     aagagtacgg gcaaatccaa agcagaaaca aaatctgcag ctaaaccaag cgccaccgcc       420
     aagacctcgc ctgcgtcaat ttcgcaagag aacaagccag aacccaagaa gaatgcccca       480
     tcaaagagct cgtctgattc aaaaagtagc actggcgttg cagtcaaggc taacccttct       540
     cagactcttc ttccttccgt gcaaatgttg ttgcacgtta acaacatatc tgcggaagac       600
     gcactaaaca acattccagc ttctggaccc aacggtcgga tcctcaaagg tgacgttctg       660
     tcatatctgg gcaaggtgtc ccaggaatct gttacaaagc tggcggagta tattgagaag       720
     ggctctgcat tggacctaac caacattgaa ttgaaagagc cagagcctgc tcctaaagcc       780
     aaagaagaag tcgcaaagaa agaaccagtc gtgctttctg agcaattgca tctgaaggtt       840
     gcgtcgggcg tcacgtatga gcagctggcc agatcccttg agtcttacgt caaggaggca       900
     aagtatctag ctcacgaaca gcctaccacc aacccatatt ccgagcactt tgatgcggta       960
     tttgaagaac tgataactcc cgagccaaga gcgcctagat ttgaagtctc gtacgatctc      1020
     atttccctgg ggagcagcgg cataagcgcc aagcaacagg acgatatatt tgatctgctg      1080
     gcaggcacaa aaccctctcc tgcggcaagc gaggtcgaaa ccgcgcaacc aaatgagttt      1140
     ctagtgagcg taagggttca ggttagtgac aaattcactg acgccccaac caaggcggaa      1200
     agattcgttc aatatctaag agatttagag agttctgctg aactttaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page