(data stored in ACNUC8465 zone)

EMBL: CU928166.PE75

CU928166.PE75        Location/Qualifiers
FT   CDS_pept        complement(157328..158236)
FT                   /locus_tag="KLTH0B02002g"
FT                   /old_locus_tag="KLTH-ORF15736"
FT                   /product="KLTH0B02002p"
FT                   /note="highly similar to uniprot|P20459 Saccharomyces
FT                   cerevisiae YJR007W SUI2 Alpha subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon phosphorylation of Ser51 is required for
FT                   regulation of translation by inhibiting the exchange of GDP
FT                   for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21440"
FT                   /db_xref="GOA:C5DCC9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC9"
FT                   /protein_id="CAR21440.1"
FT                   /translation="MSTSNCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   VLLSELSRRRIRSIQKLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEERYQK
FT                   SKAVHSILRHCAEKFSFPLEDLYKSIAWPLSRKYGHAYDAFKLSIVDETVFEGIEPPSK
FT                   EIFEELRLYISRRLTPQAVKIRADIEVSCFSYEGIDAIKAALKAAEEMSTEQMQIKAKL
FT                   VAAPLYVLTTQALEKQHGIELLEKAIEKITKVITSHDGFCNITMAPKAVTATEDAELQA
FT                   LLENKALENGSDSEEEDSDYE"
     atgtctacat ctaactgtcg tttttacgaa aacaaatatc ctgaggtgga cgatgttgtg        60
     atggtgaatg tgcagcagat cgctgagatg ggagcgtacg ttaagctgct ggaatacgac       120
     aatatcgagg gtatggtgct actgagtgag ctgtcgcgta gacgtatccg ttcgattcag       180
     aagctgatcc gtgtgggcag aaacgaggtc gttgtggttc tacgtgtgga caaggaaaag       240
     ggctacatcg acttgtccaa gcgtcgtgtt tcttccgagg acatcatcaa gtgtgaggag       300
     agataccaga agtccaaggc ggtgcactcc attctcagac actgtgccga gaagttctcg       360
     ttccctctgg aggacttgta caagtcgatc gcatggcctt tgagccgaaa gtacggccat       420
     gcctacgacg cctttaagct gtcgatcgtg gacgagaccg tgttcgaagg gattgagcct       480
     ccaagcaagg aaatcttcga agagctgcgc ttgtacattt ccagaagact cacccctcaa       540
     gccgtgaaga tcagagccga cattgaggtc tcgtgcttca gctacgaggg catagacgcc       600
     atcaaggccg ccttgaaggc tgccgaggag atgtcgacag agcaaatgca gatcaaggcc       660
     aaactggtcg ccgcgccact atacgtgctg acaacccaag cgctggagaa gcagcacggt       720
     atcgagctgc tggaaaaggc tattgagaag atcaccaaag tcataaccag tcatgacggg       780
     ttctgtaaca tcaccatggc gccaaaggcc gtcactgcca ccgaggatgc cgagctgcaa       840
     gcgctgttgg agaacaaggc cttggagaac ggttccgact ccgaggaaga agactccgac       900
     tacgaatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page