(data stored in ACNUC8465 zone)

EMBL: CU928166.PE79

CU928166.PE79        Location/Qualifiers
FT   CDS_pept        168159..168626
FT                   /locus_tag="KLTH0B02134g"
FT                   /old_locus_tag="KLTH-ORF15715"
FT                   /product="KLTH0B02134p"
FT                   /note="similar to uniprot|P47076 Saccharomyces cerevisiae
FT                   YJL011C RPC17 RNA polymerase III subunit C17 physically
FT                   interacts with C31 C11 and TFIIIB70 may be involved in the
FT                   recruitment of pol III by the preinitiation complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21444"
FT                   /db_xref="GOA:C5DCD3"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="InterPro:IPR038846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD3"
FT                   /protein_id="CAR21444.1"
FT                   /translation="MKIESVRDAFLSDYEVLQFLSQLERRHDWGLNQDDELAAGNNRKR
FT                   KRRPYNHPELQAITRDTIRYLSEAKGAADAEESEAGAGDTKSPLTKLNDKKFAELMTQL
FT                   NQFSLFKAEKLQIVNQLPTNLVHLYAIVEECDSRFSEEQSGQILEIVRNAC"
     atgaagatcg agagtgtgcg agacgctttt ttgagtgact acgaagttct tcagtttctg        60
     tcgcaattgg agcgccgcca tgattggggc ctgaaccaag acgacgagct ggctgccggg       120
     aacaacagaa agcgcaagag acgcccctac aaccatccag agctgcaggc cattacaaga       180
     gacactatac ggtacctgtc agaggccaag ggagcagcag acgcggagga gagcgaggcg       240
     ggcgcgggcg acaccaagtc acctctgacg aagctcaacg acaagaagtt tgcagagctc       300
     atgacccagc tcaaccagtt ctcgctcttc aaggccgaga agctacagat agtgaatcag       360
     ctgcccacga acttggtgca cctctacgcc atcgtggagg agtgcgactc gcggttctct       420
     gaggagcagt cgggccaaat tctcgagatc gtacgcaatg cctgttga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page