(data stored in ACNUC8465 zone)

EMBL: CU928166.PE82

CU928166.PE82        Location/Qualifiers
FT   CDS_pept        complement(174660..176267)
FT                   /locus_tag="KLTH0B02200g"
FT                   /old_locus_tag="KLTH-ORF15703"
FT                   /product="KLTH0B02200p"
FT                   /note="highly similar to uniprot|P39077 Saccharomyces
FT                   cerevisiae YJL014W CCT3 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21447"
FT                   /db_xref="GOA:C5DCD6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD6"
FT                   /protein_id="CAR21447.1"
FT                   /translation="MQAPVVFMNTSQERTTGREAQISNITAAKAVADVIRTCLGPKAML
FT                   KMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEIL
FT                   AQCAPYIIEKNIHPVIIIQALKRALSDALEVVKQVSRPVDVENTEAMNKLIQAAIGTKY
FT                   VNHWSEKMCDLALSAVRTVRVDQGAVDDDTNRYEIDIKRYVRVEKIPGGDVLDSRVLEG
FT                   VMLNKDVVHPKMSRYIENPRVVLLDCPLEYKKGESQTNIEITREEDWNRILQIEEEQVQ
FT                   YMCEQILSVKPDLVITEKGVSDLAQHFLLKGGCSVLRRTKKSDNNRIARVTGATIVNRV
FT                   EDLKESDVGTRCGVFKVELIGDEYFTFLDKCKDPQACTVMLRGASKDILNEIERNLQDA
FT                   MAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQ
FT                   NAGGNPIRILSQLRSKHAQGNYTAGIDGDAGKVTDMVEYGVWEPEVIKQQSIKTAIESA
FT                   CLLLRVDDIVSGVRKQEE"
     atgcaagctc cagtggtgtt tatgaatacc tcccaagaga ggacaactgg cagagaagcc        60
     cagatatcca acatcaccgc tgctaaggct gttgcagatg ttatccgcac ttgtttaggg       120
     cctaaagcca tgctcaagat gttgctagat ccaatgggcg gtttggtgct aacaaacgac       180
     ggacatgcta ttttgcgtga gattgacgta gctcacccag cagctaaatc aatgttggaa       240
     ctgtcgcgca cacaagatga agaagtgggt gacggcacaa caaccgtgat catcttggca       300
     ggtgagatct tggcccagtg tgccccgtac attatcgaaa agaacattca tccagtcatc       360
     atcatccagg ccctaaaacg cgccttgagc gacgctttgg aagttgtcaa gcaagttagc       420
     agaccagtgg acgttgaaaa cacggaggcg atgaacaaac tgattcaggc cgcaatcggt       480
     acgaagtacg tgaaccactg gtccgagaag atgtgcgatc tggcgctttc tgcagtcagg       540
     actgttcgcg ttgaccaggg ggctgtagat gacgacacaa accgctacga gatcgacatc       600
     aaaaggtacg tgcgcgttga aaagatccca ggtggcgacg tattggactc ccgcgtcctc       660
     gaaggtgtta tgctaaacaa ggatgtcgtg catccaaaaa tgtctcgtta tattgaaaat       720
     cctcgtgtgg tcttgttgga ctgtccactg gaatacaaga agggtgagtc tcaaacaaac       780
     atagaaatca cacgcgagga agactggaac cgtattctgc agattgaaga agaacaggtg       840
     caatatatgt gcgaacaaat cctttccgta aaaccagacc ttgtcatcac tgaaaaaggt       900
     gtttcggacc tggctcagca ctttttgctc aagggcggtt gtagtgtgtt gagacgtact       960
     aagaagtcgg acaacaacag aattgctcgt gttaccggtg ctaccattgt caaccgtgtc      1020
     gaggacctca aagaatctga tgtcggaaca agatgtggcg ttttcaaggt tgagctaatc      1080
     ggtgatgaat acttcacatt tttggataag tgcaaagacc cacaggcctg tactgtgatg      1140
     ctgaggggcg cttcaaaaga cattctgaac gaaatcgaac gtaacctaca agacgcgatg      1200
     gcagttgccc gcaacgtcat gctatcgcct tctctttccc caggcggtgg cgctaccgaa      1260
     atggcagtct ctgttaaatt ggcagagaag gctaagcaac tagagggtat ccagcagtgg      1320
     ccttaccagg ctgttgcaga cgctatggaa tgtattccac gtactttgat tcaaaatgct      1380
     ggtggaaacc ccattagaat cctctcacaa ctccgttcta agcacgcaca gggaaactat      1440
     actgcaggta tagatggtga tgccggtaag gttactgaca tggttgaata cggagtgtgg      1500
     gaacctgaag ttataaagca gcagagcatc aagacagcga tagagagcgc gtgcttactg      1560
     ctgagagtcg acgacattgt cagcggtgtt agaaaacagg aggaataa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page