(data stored in SCRATCH zone)

EMBL: CU928166.PE84

CU928166.PE84        Location/Qualifiers
FT   CDS_pept        complement(178507..180393)
FT                   /locus_tag="KLTH0B02244g"
FT                   /old_locus_tag="KLTH-ORF15699"
FT                   /product="KLTH0B02244p"
FT                   /note="weakly similar to uniprot|P47069 Saccharomyces
FT                   cerevisiae YJL019W MPS3 Essential integral membrane protein
FT                   required for spindle pole body duplication and for nuclear
FT                   fusion localizes to the spindle pole body half bridge
FT                   interacts with DnaJ-like chaperone Jem1p and with centrin
FT                   homolog Cdc31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21449"
FT                   /db_xref="GOA:C5DCD8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD8"
FT                   /protein_id="CAR21449.1"
FT                   /translation="MDTSTHSRGFYNSKTEDAYNQMLADRRSERSAQISDSDDSVSADF
FT                   SNEMLDFSNSSSHSDLGINEDYEHFKTSLLQDDWGEPLEDDDDEDYTEEADQSFIMESD
FT                   AAEALSRGPDYHIKSFSTWIRGSLVPLVASLVVVVLAIMVLAPGGSPQAPEIQNAVPGT
FT                   NAQLRTQLNSLYREFQEEKKAAKKDLDNAIKLIILQVEKHMKQLLPRDLGSVNSQLRRL
FT                   DTQVQDLSQSLSLNNVTEWQESLMHELERLLPDQIPVVLDNSTNALMVVPELHRYLAEV
FT                   IPQAVNRTLPRGLAAPFNYDAGQYVREILRDEYEYVDKSDFLRELDSALRVNKEDILRE
FT                   MEARISTLENVPQQYSNVLQRKLIHKIYNANQHQWQDDVDFATVAQGTRILNHLCSSTF
FT                   KGHQGIPPNGVSPLDLLADTPAATSTYWLCKDKRATGSCSWAMHFAQPLYLTRISYLHG
FT                   RFTNNLHLMNSAPKSIAVYVKLQSPPTAEFQRIAAKHGQGAVWDRDNSFVEIGSWDYDV
FT                   SDARIRQYFLLPPWFVQCKPQVRSLALVVRSNHGNTHYTALRKFVINAVTAQDLQLSST
FT                   YAQQRQFEIPEYASPFEDRERSRASQIAAWQRRGPSDADPAVPSFGQDEYDR"
     atggatacga gtacccattc tcggggcttt tataacagta agactgaaga cgcctataat        60
     caaatgctgg cggataggag gagcgaaaga tccgcgcaga tcagcgattc tgacgactcc       120
     gtgagcgccg atttctctaa cgagatgctt gatttcagca atagctcgag tcatagcgat       180
     ctggggatca atgaagacta cgagcacttc aaaacctcgc tgctgcaaga tgattggggc       240
     gaaccgctgg aagatgacga tgacgaggac tacacagagg aagcagacca aagctttatt       300
     atggagagcg acgcagcgga agcgcttagc cgcggcccag attaccatat taaaagcttc       360
     agcacttgga tacgagggtc acttgtcccg ctggtagcgt ctctggtggt cgtggtcctc       420
     gcgataatgg tattggcgcc aggcggatcc ccgcaagccc cggaaattca aaacgcagtt       480
     ccaggtacca acgctcagct ccgtacgcaa ctgaactctc tctatcgcga gttccaagag       540
     gaaaagaagg ccgccaaaaa ggacctcgac aatgccataa agctcataat actacaagtg       600
     gagaagcata tgaaacagct tcttccacgg gacctaggat ctgtcaactc tcaactgcga       660
     cgtcttgaca cacaagttca ggacctatcc caaagcctga gcctgaataa cgtcaccgag       720
     tggcaagaat cgctcatgca cgagctagag cggttgctcc ctgaccagat ccccgtggtg       780
     ttggataact ctaccaatgc gttgatggta gtgccggaac tgcatagata tctcgccgaa       840
     gttataccgc aagctgtaaa ccgtacgctg ccgaggggcc tggcggctcc ctttaattac       900
     gacgcaggtc agtatgtgcg ggagatcctc agagatgagt atgagtacgt ggacaagtct       960
     gacttcctgc gtgaactgga ttcggcgctg cgcgtcaaca aagaagacat cctccgcgag      1020
     atggaggcgc gtatctctac gctcgagaac gtccctcaac aatattcgaa cgtgctccaa      1080
     cgcaaactaa tacacaagat ttacaatgca aaccaacacc agtggcaaga cgatgtggac      1140
     ttcgcgaccg tagcgcaagg cacgcgcatc ctgaaccact tgtgctcttc cacctttaag      1200
     ggccatcagg gtatcccacc gaacggtgtc tcaccactgg acttgctcgc agatacaccc      1260
     gctgcgacat ccacctactg gctgtgcaaa gacaagcgcg ccacgggctc ttgctcctgg      1320
     gccatgcact ttgcgcagcc gctgtacttg acccgtatct catacttgca tgggcgtttc      1380
     acgaacaacc tacacctaat gaactccgcg cctaagtcga tcgccgtgta cgttaagcta      1440
     cagtccccac ctacagcgga gttccagcgt attgcggcca aacacgggca gggggccgtt      1500
     tgggaccgcg acaactcttt tgttgagata ggctcgtggg actacgatgt cagtgacgct      1560
     cgcatccgcc agtacttcct gctcccacct tggttcgtcc agtgcaagcc ccaggttcgc      1620
     agtctggccc ttgttgtccg ctctaaccac ggaaacactc actacactgc gctacgaaag      1680
     tttgtgatca acgctgtaac tgctcaagat ttgcagctga gctctacata tgctcagcag      1740
     aggcagttcg aaatcccaga gtatgcctcc cctttcgagg atcgtgaaag atcccgtgct      1800
     tcgcagattg cagcctggca acggcgcggg ccatcggacg ctgaccccgc agtaccctcg      1860
     ttcggccaag atgaatacga cagataa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page