(data stored in SCRATCH zone)

EMBL: CU928166.PE85

CU928166.PE85        Location/Qualifiers
FT   CDS_pept        join(180934..181515,181757..182203)
FT                   /locus_tag="KLTH0B02266g"
FT                   /old_locus_tag="Klth0B.mRNA.120.p"
FT                   /product="KLTH0B02266p"
FT                   /note="similar to uniprot|P53292 Saccharomyces cerevisiae
FT                   YGR165W MRPS35 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21450"
FT                   /db_xref="InterPro:IPR021036"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD9"
FT                   /protein_id="CAR21450.1"
FT                   /translation="MLSPARSGPALQQVQLQQVRFISRRRTAYPFYAFKRLGKQHPKKH
FT                   DSNLKYAMRQFLGPKNFKGEYVYNKYYGVPQNHEPNYIMPEIERGQSLKDNVTGEQLAI
FT                   QTDGSIAPARVGAGRPRDPVSGKRKLQPFPSNRHCLTNRVLGEELKLQVHDDIQNKHLS
FT                   AQEVSQKYGLKIPRVEAAVKLVELEQKWEKYNRIAPSLKSMSSVLYKMFPLFVPRVEVS
FT                   RENLSEIPVPAKALRSRFMTIAESEPFGPIDAAKALELEPAAETLEKLATLGEHSAHHA
FT                   SRSSAHKEKVIYGELLKGEKSLFKFENKHVGKVGFRYGSGNRDSKKDRKIGFNELGKMV
FT                   YL"
     atgctaagtc cagcccgctc gggtccagca ctacagcaag ttcaattaca gcaggtgcgc        60
     tttatctcgc gaaggagaac tgcgtatcca ttctatgcat tcaaaagact gggtaagcaa       120
     cacccaaaga agcatgacag taatctgaag tatgctatgc gccagttttt gggcccaaag       180
     aacttcaagg gtgaatatgt ttacaacaag tactacgggg tgcctcagaa ccacgaaccc       240
     aactacataa tgccggagat cgaaagaggc cagagcttga aagacaacgt gaccggggag       300
     caattggcta ttcagacgga cggctctatt gcgcctgctc gcgtgggtgc aggacgtccg       360
     cgcgatcccg tttccggcaa gcgcaagctg caaccgttcc ctagcaacag gcattgtctt       420
     acgaaccgtg ttttgggcga agagctcaag ctacaagtac acgacgacat ccaaaacaaa       480
     cacctctcag cacaggaggt gtcccagaaa tatggcctca aaattccccg ggtggaggcc       540
     gcggtcaagt tggtggaact cgaacagaaa tgggaaaaat acaaccgcat cgcgccaagc       600
     ttaaagagca tgtcttccgt gctttacaag atgttcccgc ttttcgtccc tcgggtcgag       660
     gtttctaggg aaaatctatc tgaaattcca gttcccgcga aagcgctaag gtccaggttt       720
     atgactattg cagagtccga gccttttggg ccaatcgacg ctgctaaagc cttggaactg       780
     gaacctgccg cggagacctt ggaaaagctt gccacgctgg gcgaacattc tgctcaccac       840
     gcatcaaggt cttcggcaca caaggagaaa gttatttacg gcgagttgtt gaagggcgaa       900
     aagtctttgt tcaagtttga aaacaaacat gtcggcaaag tcgggtttcg ttatggttca       960
     ggtaatcgcg acagtaaaaa agaccgtaaa atcggattta atgaacttgg taagatggtg      1020
     tatttgtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page