(data stored in ACNUC8465 zone)

EMBL: CU928166.PE91

CU928166.PE91        Location/Qualifiers
FT   CDS_pept        191249..192256
FT                   /locus_tag="KLTH0B02398g"
FT                   /old_locus_tag="KLTH-ORF15675"
FT                   /product="KLTH0B02398p"
FT                   /note="weakly similar to uniprot|P47065 Saccharomyces
FT                   cerevisiae YJL023C PET130 Protein required for respiratory
FT                   growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21456"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE5"
FT                   /protein_id="CAR21456.1"
FT                   /translation="MTSRLVLKELKAGFKATNKFPVTEKTSPVSKATAPKLMGDVMTLG
FT                   SISATNNFCKPNKRLEKPPRGERALVEVRSMLRGTNSVAQVYQNTFRIFSGQSKVYHCD
FT                   FFRLLYFPPEHFLSVFRKSKPAVNVRIVGEVFLNGNVSKSQGRSVANTAVYARGSRIEG
FT                   YGKSQDVSNLKQLQNVFANDGSNVPRNYAYLRRSLRASLNKWFIQHWMALQGPQAVEEQ
FT                   IRRQGEAGSSAQWQYLDAQGRSKTSVAKDGFYLFQVLVFPDKTTKQEFKANVARGVKTV
FT                   ADLEWDDFLRSKSNKSRTWVQECNDRVRVPVMNSYLANDQMPRVLRKLQSSRAK"
     atgaccagtc gactggttct taaagagctc aaggccggct ttaaagcgac aaacaagttc        60
     ccagtcacag aaaaaacctc tccagtttca aaagctacgg cgccaaagct aatgggcgat       120
     gtaatgactc tggggtcgat tagtgcgacc aacaatttct gcaagcccaa caaacggcta       180
     gaaaaacctc cgaggggaga aagggcactt gtggaagtac gctcgatgct cagaggcacg       240
     aacagcgttg cccaggtcta tcaaaacact ttccgcattt tctcggggca gagcaaggtc       300
     taccattgtg acttcttcag gctgctctac tttccaccgg agcatttctt gtcggtgttt       360
     cgcaagagta agcctgcagt gaacgtgcgt atcgtgggcg aggtcttctt gaatggaaat       420
     gtctccaaga gccaaggccg cagcgtagcc aacacagcgg tgtacgcgag aggcagccgc       480
     atagaggggt acggtaagag ccaggacgtg agtaatctga agcagctgca gaatgtgttt       540
     gccaacgatg gctcgaatgt tccccgaaac tatgcgtatc tgcgcagatc cttacgcgcg       600
     tctctgaaca agtggttcat tcagcactgg atggcgctgc aagggccgca ggccgtcgag       660
     gagcagatca gacggcaggg cgaagctggc tcaagcgcac agtggcagta cttggacgct       720
     cagggccgca gcaaaaccag cgtggctaag gacggcttct acttatttca ggtccttgtg       780
     tttcccgaca agactactaa gcaggagttc aaggcaaacg ttgcgcgcgg cgtgaagacg       840
     gtggcagatc tcgagtggga cgatttcttg cgcagcaagt cgaacaagtc ccgcacctgg       900
     gtccaagaat gcaacgaccg cgtccgggtt ccagtgatga actcgtacct ggccaacgac       960
     cagatgccgc gcgtgctgcg aaagctccag tcgtcccgag caaagtag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page