(data stored in ACNUC8465 zone)

EMBL: CU928166.PE94

CU928166.PE94        Location/Qualifiers
FT   CDS_pept        join(196583..196677,196756..198121)
FT                   /locus_tag="KLTH0B02464g"
FT                   /old_locus_tag="KLTH.mRNA.163AT.p"
FT                   /product="KLTH0B02464p"
FT                   /note="similar to uniprot|P46957 Saccharomyces cerevisiae
FT                   YJR006W HYS2 DNA polymerase III (delta) 55 kDa subunit
FT                   essential for cell viability involved in DNA replication
FT                   and DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21459"
FT                   /db_xref="GOA:C5DCE8"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE8"
FT                   /protein_id="CAR21459.1"
FT                   /translation="MFKMLIKFRMSVMPTFIYGTVKSMDSVLRQFNESRETGEIEPRKR
FT                   DKLVVEPQPNEFYLKYEDRKYDEQYYSMYQYRLKVLRERVTKNCEVKWDSHFKLKNRKV
FT                   VKKNKVLDIQANEPCWCVGTIYCEMKYKPNILEEVVNDVYGAPDLVKGYLDEDGTDEVM
FT                   LEDESGRVLLVGELAKTKPLVSGTVVGILGMEADAGTFQVLDICFPSALPQTELPAGSQ
FT                   PGKVALVSGLNANPSNPRLSLKLQLLQQYLTGDVMSPESVAEIGRLIICGNSINPVDPD
FT                   QLTGCLTEAGTFFGNTLQSMPIDLMPGPRDLSDQSLPQQPLHKALFGPMISPFFEESNK
FT                   ELFCPTTNPAWFQLNGVQLLGTSGQNIDDMCKYVLPFEPDSQENLAEANIATRMDIIEG
FT                   CLRWQNIAPTAPDTLWCYPYKDEDPFVLKKWPHVFFVGNQPQFASKDVQLEGGVKVKAI
FT                   AVPEFSKTGQVVILDLETLDTTLVTIDM"
     atgttcaaga tgttaataaa gtttagaatg agtgtgatgc ccacttttat atatggcacg        60
     gtgaagagca tggattctgt tctcaggcaa ttcaacgagt cgagagagac cggtgaaatt       120
     gagccaagaa agcgcgataa gttagttgtc gaaccgcaac ctaacgaatt ttacttgaaa       180
     tatgaggata gaaagtacga tgaacagtat tactccatgt accagtaccg tttaaaggta       240
     ttgagggagc gcgtcaccaa gaattgtgaa gtcaaatggg attcacactt taagctgaaa       300
     aaccgtaaag ttgtgaagaa gaataaggtc ttagatatcc aggccaacga gccctgctgg       360
     tgtgtgggca ctatttactg cgaaatgaaa tacaagccaa acatcctaga ggaggttgtt       420
     aacgatgtgt acggcgcgcc tgatttagtg aagggttact tggatgagga cggcacggac       480
     gaagtcatgt tagaagacga aagcggtcga gtgcttcttg tgggtgaact tgcgaaaacg       540
     aaaccactgg tcagtggaac tgtagtcgga atcctcggga tggaagcaga tgcaggtact       600
     tttcaggtct tggacatttg ctttccatca gccttaccac agaccgagct tcccgcgggc       660
     tctcagcctg ggaaagttgc actagtatcg ggactaaacg caaacccttc taatccaaga       720
     ctttcactaa agctgcaatt attacagcaa tacctaacag gcgatgtgat gagcccagag       780
     tctgttgctg aaattggtag acttataata tgtggaaact caataaatcc tgttgaccca       840
     gaccagctaa cgggatgcct tacagaagct ggaactttct ttgggaatac gcttcagtcc       900
     atgccaattg atctcatgcc tggtccacgc gaccttagtg atcaaagctt acctcagcaa       960
     ccattgcata aggcactttt tgggcccatg atttccccgt tctttgagga atccaataaa      1020
     gaactctttt gtcctaccac aaacccagca tggtttcagc ttaatggtgt tcaattatta      1080
     ggcacgagcg gacagaacat tgatgatatg tgcaagtacg ttctgccttt cgaaccagac      1140
     tctcaagaaa acttagcaga agctaatatc gccactagga tggacatcat tgaggggtgc      1200
     ctaaggtggc agaatatagc accaacagcg cccgatacat tgtggtgcta tccttataaa      1260
     gatgaagacc ctttcgttct gaagaaatgg ccccacgtat ttttcgttgg caaccagccc      1320
     caatttgctt cgaaagacgt gcagttggag gggggtgtca aagtcaaagc tattgctgtt      1380
     ccagagttca gcaaaacagg gcaagttgta attttagatc ttgaaacgct ggatactact      1440
     ctcgtgacaa tcgatatgta g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page