(data stored in SCRATCH zone)

EMBL: CU928166.PE96

CU928166.PE96        Location/Qualifiers
FT   CDS_pept        complement(200122..200841)
FT                   /locus_tag="KLTH0B02508g"
FT                   /old_locus_tag="KLTH-ORF15663"
FT                   /product="KLTH0B02508p"
FT                   /note="similar to uniprot|P53039 Saccharomyces cerevisiae
FT                   YGR172C YIP1 Golgi integral membrane protein binds to the
FT                   transport GTPases Ypt1p and Ypt31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21461"
FT                   /db_xref="GOA:C5DCF0"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF0"
FT                   /protein_id="CAR21461.1"
FT                   /translation="MSFNNGANPQGGFGFYQPSPQFQMPQGSMNFAQQPATQAFSQDPL
FT                   PPGLLNALSTKGYPHELPLLEEIGINFSHILTKTKNVLQPLRRSDSLPLEIISDCDLAG
FT                   PLIFCLLFGTLLLAAGKVHFGYIYGVALFGTISLHTLLRLMGNEDNKAQPQQLFLRTAS
FT                   ILGYCFLPLCLLSLVGVFFPLNNMMGYALALIFVCWCTWSSSGFFTAVLQLKNARVLIA
FT                   YPLSIFYSVFALMAIFV"
     atgtccttca acaacggtgc aaatccacaa ggaggcttcg gattctacca gccatcaccg        60
     cagttccaga tgccacaggg ctcaatgaac ttcgcgcaac aaccagcgac acaggcgttt       120
     tcgcaggacc ccctcccccc aggcctgctg aatgccttgt caaccaaagg gtatccccac       180
     gaactccccc ttctcgagga gataggaatc aatttcagcc atattctgac caagaccaaa       240
     aacgttttgc agccattgag acggtcagac tcgctgcctc tggagatcat atctgactgc       300
     gacctcgcag ggccgcttat attctgtctt ctttttggaa cactactact agccgcagga       360
     aaggttcatt tcgggtacat ctacggagtc gcactttttg gcactatttc attacacaca       420
     ctcctccgtc tcatgggcaa tgaggacaac aaagcccaac cacaacaact tttcctaaga       480
     acagcctcta tcctaggata ttgcttcctc cctctatgcc tcttgtcgct ggtaggcgtt       540
     ttcttccctc tcaacaacat gatgggctac gcgctggcac ttatctttgt gtgctggtgc       600
     acatggtcct cctctggatt tttcaccgct gtactacaac ttaaaaatgc tagggttttg       660
     atcgcgtacc cgctctccat cttctacagt gtgttcgccc tcatggctat atttgtgtag       720
//

If you have problems or comments...

PBIL Back to PBIL home page