(data stored in SCRATCH zone)

EMBL: CU928166.PE98

CU928166.PE98        Location/Qualifiers
FT   CDS_pept        complement(202770..203798)
FT                   /locus_tag="KLTH0B02574g"
FT                   /old_locus_tag="KLTH-ORF15658"
FT                   /product="KLTH0B02574p"
FT                   /note="highly similar to uniprot|P43534 Saccharomyces
FT                   cerevisiae YFL058W THI5 Protein involved in synthesis of
FT                   the thiamine precursor hydroxymethylpyrimidine (HMP) member
FT                   of a subtelomeric gene family including THI5 THI11 THI12
FT                   and THI13"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21463"
FT                   /db_xref="GOA:C5DCF2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF2"
FT                   /protein_id="CAR21463.1"
FT                   /translation="MSTEKITFLLNWQPAPYHIPIFLALQKGYFKEQGLDLALIEPTNP
FT                   SDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVGSLLDEPFTGLLYMAGRGITDDFQ
FT                   SLRGKKIGYVGEFGKIQLDELTKHYGMTPDDYTAVRCGMNVAKYIIEGKIDAGIGIECM
FT                   QQVELEEYLKAQGKPATDAKMLRIDKLACLGCCCFCTILYICNDKFLAANPEKVRKFLT
FT                   AVKKATDFVLAHPIDAWKEYVDFKPELDNDLSFKQFQRCYAYFSSSLFNVHRDWNKVTG
FT                   YGKRLEILPLDYKANYTNEYLSWDEPNEVEDPLEAQRLMAIHQETCRDCGGFKRLSVPL
FT                   KA"
     atgtccaccg aaaagatcac ctttctcctg aactggcaac cagcgccata ccacatccct        60
     atcttcctag cgttgcaaaa gggctacttc aaggaacagg gcttggactt ggcgctcatt       120
     gagcctacca acccctcgga cgtcactgag ctgatcgggt ccggcaaggt cgacatgggc       180
     ctcaaggcca tgatccatac cctggcagcc aaggcgcgtg gcttccctgt gacctctgtc       240
     ggctcgctgc ttgacgagcc cttcaccggg ttgttgtaca tggccggccg cggtatcacc       300
     gacgacttcc agtcactcag aggcaagaag atcggctatg tcggcgaatt cggcaagatc       360
     cagcttgacg agctcaccaa gcactacggt atgaccccag acgactacac tgccgtcaga       420
     tgtggcatga acgtcgccaa atacatcatc gagggcaaga tcgatgctgg tattggtatc       480
     gagtgcatgc agcaagtcga gctcgaggag tacctcaagg cccagggcaa gcctgccact       540
     gacgccaaga tgctccgtat cgacaagctg gcttgcctgg gctgctgctg cttctgcacc       600
     atcttgtaca tctgcaacga caagttcttg gccgccaacc ccgagaaggt tcgcaagttc       660
     ctcacggctg tcaagaaggc caccgacttc gtcttggctc atccaatcga tgcctggaag       720
     gagtacgttg acttcaagcc cgagcttgac aacgacttga gcttcaagca gttccagaga       780
     tgctacgcct acttctcttc ctccttgttc aacgtccacc gtgactggaa caaggttacc       840
     ggctacggta agagattgga gatcctgcct ctagactaca aggccaacta cactaacgag       900
     tacttgtcct gggacgagcc taacgaggtc gaggacccat tggaagccca gagattgatg       960
     gccattcacc aggagacctg cagagattgc ggtggtttca agagactctc cgtccctttg      1020
     aaggcttaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page