(data stored in ACNUC8465 zone)

EMBL: CU928166.PE99

CU928166.PE99        Location/Qualifiers
FT   CDS_pept        204289..204732
FT                   /locus_tag="KLTH0B02596g"
FT                   /old_locus_tag="KLTH-ORF15654"
FT                   /product="KLTH0B02596p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21464"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF3"
FT                   /protein_id="CAR21464.1"
FT                   /translation="MSILVVDMDEVRSLAQRHSIEMGLERLRVVGQYVGSWWDAGRLRL
FT                   EFGNVSGLASAGGRAVLDASESALERVRRARAGLVEGAVCDVRCCVMGRDVEVMELRVL
FT                   TLREVQALGEFLAGDAGREFMSLSSGALQHAGHDRRDDEDRAR"
     atgagcatat tggtagtaga tatggatgaa gttcggagtt tggcccagcg ccacagcatc        60
     gagatggggc tcgaacggct gcgcgtagtt ggccagtacg tgggatcgtg gtgggacgca       120
     ggccggctgc gtctagagtt tgggaatgtg agtggcctgg cgagcgcagg tgggcgtgcg       180
     gtgctggatg ctagcgagag cgcgctggag cgggtccgtc gcgcacgcgc agggctcgtg       240
     gaaggtgctg tgtgcgacgt gcggtgctgc gtaatgggcc gggacgtgga ggtgatggag       300
     ctgcgagtgc taacgctgcg ggaagtgcaa gctctgggcg agtttttggc cggggacgcg       360
     gggcgagagt tcatgagcct gagctctggg gctctgcaac acgctgggca cgacagacgc       420
     gacgatgagg accgggcccg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page