(data stored in ACNUC8465 zone)

HOGENOMDNA: CYAP4_1

ID   CYAP4_1; SV 1; empty ; DNA; empty ; PRO; 196837 BP.
XX
AC   NC_011880;
XX
PR   Project: 59435;
XX
DE   Cyanothece sp. PCC 7425 plasmid pP742501, complete sequence.
XX
OS   Cyanothece sp. PCC 7425
OC   Bacteria; Cyanobacteria; Chroococcales; Cyanothece.
XX
RN   [1]
RP   1-196837
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Complete sequence of plasmid1 Cyanothece sp. PCC 7425";
RL   Unpublished
XX
RN   [2]
RP   1-196837
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (09-JAN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-196837
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (06-JAN-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001345.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082850
CC   Source DNA and bacteria available from Himadri Pakrasi
CC   (pakrasi@biology2.wustl.edu)
CC   Contacts: Himadri Pakrasi (pakrasi@biology2.wustl.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..196837
FT                   /strain="PCC 7425"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cyanothece sp. PCC 7425"
FT                   /plasmid="pP742501"
FT                   /db_xref="taxon:395961"
FT   gene            complement(54..2252)
FT                   /db_xref="GeneID:7280430"
FT                   /locus_tag="Cyan7425_5298"
FT   CDS_pept        complement(54..2252)
FT                   /locus_tag="Cyan7425_5298"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation/phosphoacceptor; KEGG:
FT                   npu:Npun_R3572 multi-sensor hybrid histidine kinase"
FT                   /db_xref="GI:219883097"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="GeneID:7280430"
FT                   /translation="MVLSPHKILIIDDSPEDRELYRKYLKSGLDGSWHCLEADLAERGL
FT                   ELWDQHRPDLIFLDDALPDLNSLEFLARLSSLIPRSHVPVCLPVIVFANQGNAATAVQV
FT                   MKAGAQDYLVKEQVTPEVLHASVDRAMATIQLHTELDQRIERERLCTQLTRKIHNSLEL
FT                   EKILQTTVTEVRQFLQTDRILIFRLESDGWGKVSTESVGADWTALLSTSYYDPCFNETY
FT                   ADFFRQGLITLKPDIQDGSIAPCHVELLSNLEVRSNLVVPINTNTQLWGLLIAHHCAAP
FT                   RQWQPVEVELLQELATHLGIAIQQSALYQNSQQELAARKQAETIQQHRAERERALQLIT
FT                   LLIHQSLNLDETLTTTLHQVRTNMRADRVAVYRFEPDWSGQFVAESKGEAWIPLVGPHI
FT                   QRVWEDTYLQATAGGRYQNHETFILNDVYTAGLTPCHLELLEQFQAKAHAIVPIFVQNR
FT                   LWGLLAAYQNSAPREWQVEEVELLEQIAVRMAIAIHQADLYQQLQLQLQERTQAEAKLK
FT                   KSLREKELLLKEIHHRVKNNLTVVSSLLNLQSETTQDALALKLLQESQDRIATIALVHE
FT                   LLYQSPSLERIEVDQYLKRLTEQIFSTYSSQHLRLHLDLDAVSLNIETALPCGLIVNEL
FT                   LSNALKHAFPSHETGDIWISFKLEKKHYCLIVRDNGIGLPEGLNLSQSPSLGLQVVSDL
FT                   TRQLRGTIMLSQGENPAQRGSGACFRVVFQELYYRKRV"
FT                   /protein_id="YP_002478259.1"
FT   misc_feature    complement(1860..2228)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(order(1905..1910,1917..1919,1974..1976,
FT                   2052..2054,2076..2078,2214..2219))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(2076..2078)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(order(2052..2060,2064..2069))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(order(1899..1901,1905..1910))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(1314..1766)
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(756..1211)
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(441..665)
FT                   /note="Histidine kinase; Region: HisKA_2; cl06527"
FT                   /db_xref="CDD:157259"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(84..362)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(order(96..98,102..107,135..137,141..143,
FT                   189..197,231..236,240..242,246..248,252..254,330..332,
FT                   339..341,351..353))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(339..341)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5298"
FT   misc_feature    complement(order(192..194,234..236,240..242))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5298"
FT   gene            complement(2377..2880)
FT                   /db_xref="GeneID:7280263"
FT                   /locus_tag="Cyan7425_5299"
FT   CDS_pept        complement(2377..2880)
FT                   /locus_tag="Cyan7425_5299"
FT                   /gene_family="HOG000087955" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883098"
FT                   /db_xref="GeneID:7280263"
FT                   /translation="MIYIVPINLIQELESIANSTFSDTRFLIKPTDSDCNYLRAGYPLQ
FT                   FIYDDKLTVHFEAYRGARHPGFALNEHFRNKKGDFIATFAFLDRKAFIYLTLFAHWRNE
FT                   VLTLQASSDDSWLKWCDRAGQAISVPYSQAKGVKPIARRLLKWYEEKFIPNQKNFAVLP
FT                   SFYI"
FT                   /protein_id="YP_002478260.1"
FT   gene            complement(4146..4322)
FT                   /db_xref="GeneID:7280264"
FT                   /locus_tag="Cyan7425_5300"
FT   CDS_pept        complement(4146..4322)
FT                   /locus_tag="Cyan7425_5300"
FT                   /gene_family="HOG000088145" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883099"
FT                   /db_xref="GeneID:7280264"
FT                   /translation="MNPTETSFGQSEELSKETSLEEEMGLEIGELHRIAGGTRSPMTAV
FT                   VVKSQCIGNLTNG"
FT                   /protein_id="YP_002478261.1"
FT   gene            complement(4390..4548)
FT                   /db_xref="GeneID:7280265"
FT                   /locus_tag="Cyan7425_5301"
FT   CDS_pept        complement(4390..4548)
FT                   /locus_tag="Cyan7425_5301"
FT                   /gene_family="HOG000088146" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883100"
FT                   /db_xref="GeneID:7280265"
FT                   /translation="MNAKIFSQPSDEQFNQIKVGEDEDLELNVNDLKGIAGGAIYMKVE
FT                   GIQGRCD"
FT                   /protein_id="YP_002478262.1"
FT   gene            4964..5092
FT                   /db_xref="GeneID:7280266"
FT                   /locus_tag="Cyan7425_5302"
FT   CDS_pept        4964..5092
FT                   /locus_tag="Cyan7425_5302"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883101"
FT                   /db_xref="GeneID:7280266"
FT                   /translation="MNTKTTKEALIAKVADKMKAEVIGCILGAEPVSAATAFCQIL"
FT                   /protein_id="YP_002478263.1"
FT   gene            5210..5569
FT                   /db_xref="GeneID:7280267"
FT                   /locus_tag="Cyan7425_5303"
FT   CDS_pept        5210..5569
FT                   /locus_tag="Cyan7425_5303"
FT                   /gene_family="HOG000088147" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ton:TON_1554 hypothetical protein"
FT                   /db_xref="GI:219883102"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:7280267"
FT                   /translation="MTKYVTTEDQRWQGIDVRGVTMEACRLWEGDYNVRSGFFRMPKGM
FT                   QVPMHHHPYWVQVFVMSGKLEVEAEGEEAHPIAAGGYYFVEPGESHVETAVEDTLLLVV
FT                   SEEEREELRLRPSTH"
FT                   /protein_id="YP_002478264.1"
FT   misc_feature    <5294..5506
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Cyan7425_5303"
FT   gene            6228..7589
FT                   /db_xref="GeneID:7280268"
FT                   /locus_tag="Cyan7425_5304"
FT   CDS_pept        6228..7589
FT                   /locus_tag="Cyan7425_5304"
FT                   /gene_family="HOG000037219" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /codon_start="1"
FT                   /product="Chloride channel core"
FT                   /transl_table="11"
FT                   /note="PFAM: Chloride channel core; KEGG: cyt:cce_4380
FT                   putative Cl-channel, voltage gated"
FT                   /db_xref="GI:219883103"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="GeneID:7280268"
FT                   /translation="MADSQFLPLLTRVGTWAVGGLLGGLVGSLAAVMLTQMIKQVLDFV
FT                   SGLDSLWMLLLPLLGVTLAVLILFGLGKGAPVQTLVLRQDDRLDRQRPLAWYIFPHDVA
FT                   RADLTGDVVNTAGEEEGFPWKRAPLRALAILSTVGLGAAMGTESPAAHIGVAAGAWLGS
FT                   KNPALRRLVRPAAIGGGAAAVSALMGIALVGSFFMFELSRRRRVPITPERVAAMLVGGG
FT                   VGWAVNFVFKLSLIRLVVPRIPPADLWDAAAAALFVGALAGCITSLSGEAIYWARGLKT
FT                   RPATRLLVGGLAMLALAIVTAQIASPAAAFGPGGAAIVWAETVETTPYHLLAVSLLRAA
FT                   STTAAVVAGGCGGVFVPFLAIGDLSGRVFATTFGVPSDLAGAAGAAAGIAGGYRLPLTA
FT                   IAMVLGVGGPREATLTCLATVGIATLSGLIAARSAEQLFSSLRAMTGKKPSSED"
FT                   /protein_id="YP_002478265.1"
FT   misc_feature    6507..>6959
FT                   /note="CLC voltage-gated chloride channel. The ClC chloride
FT                   channels catalyse the selective flow of Cl- ions across
FT                   cell membranes, thereby regulating electrical excitation in
FT                   skeletal muscle and the flow of salt and water across
FT                   epithelial barriers. This...; Region: Voltage_gated_ClC;
FT                   cl02915"
FT                   /db_xref="CDD:186539"
FT                   /locus_tag="Cyan7425_5304"
FT   gene            8076..8852
FT                   /db_xref="GeneID:7280269"
FT                   /locus_tag="Cyan7425_5305"
FT   CDS_pept        8076..8852
FT                   /locus_tag="Cyan7425_5305"
FT                   /gene_family="HOG000088115" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_C6119"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_C6119 hypothetical protein"
FT                   /db_xref="GI:219883104"
FT                   /db_xref="GeneID:7280269"
FT                   /translation="MEFIGVALISSTLLCLGMAGSIEAGYRMGKRRLKKYPESKTEGAS
FT                   AVESSVFAILGLILAFTFTGTLSRYENRVKLILQEANAIGTAYLRLDLLPKDAQDKLRP
FT                   LYREYVQSRINVFKYYENRQLSNSYFRQSLNLQGQIWKIANTSVLIDKNPGIITLVLSS
FT                   TNDMIDIANERLQATRTHPPVIVYILLFALSLASAFLVGQDMSVNAKRPLFYMFIFCVT
FT                   ISGITYIILDLENPRLGLVRIDLGDKVLVETLKSIQ"
FT                   /protein_id="YP_002478266.1"
FT   sig_peptide     8076..8150
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.366 at
FT                   residue 25"
FT                   /locus_tag="Cyan7425_5305"
FT   gene            complement(8869..9132)
FT                   /db_xref="GeneID:7280270"
FT                   /locus_tag="Cyan7425_5306"
FT   CDS_pept        complement(8869..9132)
FT                   /locus_tag="Cyan7425_5306"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_B0348 phage integrase"
FT                   /db_xref="GI:219883105"
FT                   /db_xref="GeneID:7280270"
FT                   /translation="MKADARSPAPIDLREVRVTEFLQAGSLAANTEKAYRRELKKFLGW
FT                   TDRPWAEITPRHLAQYKLESLELHQLDIEQIQNLDAFNILLF"
FT                   /protein_id="YP_002478267.1"
FT   misc_feature    complement(<8950..9054)
FT                   /note="site-specific tyrosine recombinase XerD; Reviewed;
FT                   Region: xerD; PRK00283"
FT                   /db_xref="CDD:178959"
FT                   /locus_tag="Cyan7425_5306"
FT   gene            9351..9602
FT                   /db_xref="GeneID:7280271"
FT                   /locus_tag="Cyan7425_5307"
FT   CDS_pept        9351..9602
FT                   /locus_tag="Cyan7425_5307"
FT                   /gene_family="HOG000149637" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MAE_43230"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_43230 hypothetical protein"
FT                   /db_xref="GI:219883106"
FT                   /db_xref="GeneID:7280271"
FT                   /translation="MHTITLTISDETLQSLQTTSEQLSQEILLVVAVKLYELGRLSSGA
FT                   AAVLAGVPRTEFLVRLAEYGFNTFSLGAAELAEDLANA"
FT                   /protein_id="YP_002478268.1"
FT   misc_feature    <9429..9599
FT                   /note="Uncharacterized protein family (UPF0175); Region:
FT                   UPF0175; cl01085"
FT                   /db_xref="CDD:154188"
FT                   /locus_tag="Cyan7425_5307"
FT   gene            9638..10159
FT                   /db_xref="GeneID:7280272"
FT                   /locus_tag="Cyan7425_5308"
FT   CDS_pept        9638..10159
FT                   /locus_tag="Cyan7425_5308"
FT                   /gene_family="HOG000023019" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_BF174"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_BF174 hypothetical protein"
FT                   /db_xref="GI:219883107"
FT                   /db_xref="GeneID:7280272"
FT                   /translation="MARPDQEKCRLCAKLTAQEAQQRHGVQGDGCWTPQVCYNRRSYYR
FT                   HRGVRNQGRKLRRREARAGAIAGGTVVLELPAPAVPAAVVHWYRVTKDAPLHAIGAELW
FT                   LGNDRTARIEPVHCLGLTESQVKALLIQILALFSQQCGRKVERFRTSVELHPDYCPIRP
FT                   CPLHPEGLGP"
FT                   /protein_id="YP_002478269.1"
FT   gene            10156..10827
FT                   /db_xref="GeneID:7280273"
FT                   /locus_tag="Cyan7425_5309"
FT   CDS_pept        10156..10827
FT                   /locus_tag="Cyan7425_5309"
FT                   /gene_family="HOG000023018" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_B0183"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_B0183 hypothetical protein"
FT                   /db_xref="GI:219883108"
FT                   /db_xref="GeneID:7280273"
FT                   /translation="MMQQLELNLWGSLEAAAQVPQTADLRSLCQVLERTLEGQALTDQL
FT                   AIAGNAMVQLSEVYADRAAGMIEAWERRYQPQEPVIDLDDCADLLVQSLSLDVSDLFEA
FT                   PEPVAYPVNRKGAERTGSIVGEVAKADLLDWIEETCVEIPPDRATVEQGILNLAHDENV
FT                   QETIAAIAAYLAEKGGSYLIKLREELPMNLVDLWLGLLLGNFILMQRSRFYDVEGIWVK
FT                   V"
FT                   /protein_id="YP_002478270.1"
FT   gene            10977..11699
FT                   /db_xref="GeneID:7280274"
FT                   /locus_tag="Cyan7425_5310"
FT   CDS_pept        10977..11699
FT                   /locus_tag="Cyan7425_5310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Synpcc7942_1075"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syf:Synpcc7942_1075 hypothetical protein"
FT                   /db_xref="GI:219883109"
FT                   /db_xref="GeneID:7280274"
FT                   /translation="MATPLAALHGEVHRFTGVIDRFGSFPTAENVVRTVCVRDLRLADS
FT                   NRPVSPDHWWFPLRQVWEDLNLQPGDEVLFTTKIQRWTKGFQPAANNIVSLSKKNSPLR
FT                   TAYGPGREPRSVVILRRAEVTEREPAETHLQVYEQLEAEDRVKSQFIGVIDRLEGTIRE
FT                   LKSELGVRQQQLSSTQVEVIQLSQEKQRLYQTVQQLEQQVNSSISRQGAAALLSLSILL
FT                   ALFTGFGMGSQPVRSPAR"
FT                   /protein_id="YP_002478271.1"
FT   misc_feature    <11367..>11591
FT                   /note="Transmembrane protein; Region: Macoilin; pfam09726"
FT                   /db_xref="CDD:118258"
FT                   /locus_tag="Cyan7425_5310"
FT   gene            11746..12309
FT                   /db_xref="GeneID:7280275"
FT                   /locus_tag="Cyan7425_5311"
FT   CDS_pept        11746..12309
FT                   /locus_tag="Cyan7425_5311"
FT                   /gene_family="HOG000086960" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /codon_start="1"
FT                   /product="Appr-1-p processing domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   lbu:LBUL_1936 histone macroH2A1 family phosphatase"
FT                   /db_xref="GI:219883110"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="GeneID:7280275"
FT                   /translation="MGMNEMQHHRDPRFQVIQGDITTLEVEAIVNAANNELKPGGGVCG
FT                   AIFRAAGYKQLQQACEQIGYCPTGEALITPGFNLPAQWIVHTVGPVYGVTWASEELLAR
FT                   CYRNCLQFAGEESLSSIAFPLISTGIYGFPLEPAAEIAIREILTGLSCYSEIKQVYLVC
FT                   YTPESYAAVLQIYDRICQKGRVDP"
FT                   /protein_id="YP_002478272.1"
FT   misc_feature    11782..12273
FT                   /note="Macro domain, Appr-1'-pase_like family. The macro
FT                   domain is a high-affinity ADP-ribose binding module found
FT                   in a variety of proteins as a stand-alone domain or in
FT                   combination with other domains like in histone macroH2A and
FT                   some PARPs (poly ADP-ribose...; Region:
FT                   Macro_Appr_pase_like; cd02908"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_5311"
FT   misc_feature    order(11803..11808,11845..11847,11866..11868,11872..11877,
FT                   12124..12126,12130..12138)
FT                   /note="putative ADP-ribose binding site; other site"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_5311"
FT   misc_feature    order(11836..11838,11845..11847,11863..11865,11875..11877,
FT                   12001..12003)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_5311"
FT   gene            complement(12314..14398)
FT                   /db_xref="GeneID:7280276"
FT                   /locus_tag="Cyan7425_5312"
FT   CDS_pept        complement(12314..14398)
FT                   /locus_tag="Cyan7425_5312"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /codon_start="1"
FT                   /product="Appr-1-p processing domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   ana:all3180 similar to adenylate cyclase"
FT                   /db_xref="GI:219883111"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="GeneID:7280276"
FT                   /translation="MTKLAVLRLGQGDFDQGFAVTLAIAEEGFPPYTEVAGHLAASPDL
FT                   LDTYRHWKAAYWALGHVARLGAPQQQVTNVSTAHPWQTCSTLADQLKLQLRNWYSSEQS
FT                   GFKPIRETLLQELDRSEEVRLLIQTDDPQLRSLPWHLLFEPFLERYHRAELALSPQNYN
FT                   KIQPASTSREKVKILAIFGCSTGLELDSDRRQLSQLPNAEVQFLVEPPRHKLNDHLWEQ
FT                   GWDILFFAGHSSSQPEIGQGHLRINAKDTISLEQVKYALRKSIQNGLKLAIFNSCDGLE
FT                   LARALVNLHLPQLIVMREPVPDVVAQAFLKHFLRAFSSGDSLYLSVRQAREKLQSLEKD
FT                   FPCATWLPVICQHPAFVPLTWQSFQRPKAETFFRPPAKSIPIELPVDELVMVKRVGNTT
FT                   VRVQYCDITQLEADVIVSSDDIHLSMGGGVSEAILLAAGEVAWEEARRRVPLKLGEIAI
FT                   TTAGHLKARQLFHAAVLDYQQQTQTTVDLIRSVTRKCLEICHAQGFQSIALPALATGTA
FT                   GLSPEQSAIAMMLEILPHLNQETSLRRVTIALYSRQGLPHHILTRFYLQVSDFLDNYSR
FT                   IGIMKDLLIELEAIYQGQRLEAAAAIALNYREQLDVLQEQWIHELLQDQDVSEREAAQP
FT                   VQRVQQLFKVMQNLSTPSPELLKMMQNLPARPPELFKMIQNLPPEKITTILQWIQKERP
FT                   "
FT                   /protein_id="YP_002478273.1"
FT   misc_feature    complement(12803..13201)
FT                   /note="Macro domain, a high-affinity ADP-ribose binding
FT                   module found in a variety of proteins as a stand-alone
FT                   domain or in combination with other domains like in histone
FT                   macroH2A and some PARPs (poly ADP-ribose polymerases). Some
FT                   macro domains recognize poly...; Region: Macro; cl00019"
FT                   /db_xref="CDD:185779"
FT                   /locus_tag="Cyan7425_5312"
FT   misc_feature    complement(order(12848..12856,12860..12862,13109..13114,
FT                   13118..13120,13139..13141,13181..13183))
FT                   /note="ADP-ribose binding site; other site"
FT                   /db_xref="CDD:28840"
FT                   /locus_tag="Cyan7425_5312"
FT   gene            complement(14464..16695)
FT                   /db_xref="GeneID:7280277"
FT                   /locus_tag="Cyan7425_5313"
FT   CDS_pept        complement(14464..16695)
FT                   /locus_tag="Cyan7425_5313"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amt:Amet_3245 dynamin family protein"
FT                   /db_xref="GI:219883112"
FT                   /db_xref="GeneID:7280277"
FT                   /translation="MWIDSYIHKELNKLLEDISAIPNVNLTKENGEYLKFLKEFKFQVE
FT                   HKARTAVVLGVFKAGKSTLLNALIGEPCLPSRSNRATGVPTRIFYSSNPCAWVIQQHEL
FT                   TGEFREPISINRVPDYILLNLSTKEAEAPDGVIAVEIGLPIEILRDNNWTLVDTPGLLD
FT                   NANLTSVTQQELDKADLAIVVLLADKLLGEAERQVLRDINNLLNGNLIIVINRFDQIEE
FT                   LEDKTRVLEWAKSTLKTIGNRLVGYPALFTTVAKDWLKGNPPTDNELELRHGFLQILNQ
FT                   VFNSHLSDRVTLVSRLGTLNHEILKAKSYFFSLSLKTEELICKLELEAQDDFRRKQDDF
FT                   ESFVNNLLTDLLKIQGNIPSDLRSLEVVCIERASKLIKSNNPAWADLVRSFIEKEFNNY
FT                   ILELEGKIFHVMNELKMEIPNAQYDLVSYFERNKIDTDFATNIGGIIGSSKVFKMSRWL
FT                   ASNVGFDLEQHNRETVLQFVHNISDFLNAVIEKRFKVLNTFIAKYQECHQPKYCDPKKL
FT                   ELARIYYHDLNKLLQWFDHARNNTYLLAEKIMSFKSQFDHQWNIFCELVMSRFLEQLST
FT                   RKVNRSLSINQLINQVIDQTKSRWNNETAFEGVWLQKLIRENPITGKEFSDIVCAVTIQ
FT                   HEFPKETLFNHLERTIIIVATTAVLTILFWNQNYHNMNFSLNRVAYAFGIVCFAVYVIQ
FT                   QSKDIRHKKFIRTIQNQISHEFNIFKNKLDLILEQIDQSYGRDQSLTQE"
FT                   /protein_id="YP_002478274.1"
FT   misc_feature    complement(16105..16542)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Cyan7425_5313"
FT   gene            complement(16712..19570)
FT                   /db_xref="GeneID:7280278"
FT                   /locus_tag="Cyan7425_5314"
FT   CDS_pept        complement(16712..19570)
FT                   /locus_tag="Cyan7425_5314"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all4414 unknown protein"
FT                   /db_xref="GI:219883113"
FT                   /db_xref="GeneID:7280278"
FT                   /translation="MKHKASNFGFLQPHNQELAEIGEAAERMYALKQPQASISVIRTFA
FT                   ERLARLVACQESIDDESIDQKERLDKIGKKFKRTLDESIIDKFDKLRRLGNSATHEWRG
FT                   NLRDAGASLRDAYEISVWYYKKYISYNPPASYEFELPEVLPELDKEEIQTQAEQLNAAK
FT                   QNLLQLEKQLQQAQVSLDTNSGLIESLQQELNHAKLRALQAEQQFQEMGKRLIYGGDTK
FT                   FLSGLMTEIIADALIEQTCLPPSNWSETHEHTASLLSIAEESLQVISTLIGERSQKVLT
FT                   LSSGENIFPGLGMVNDAVDLLKRATDLHEGIFNLIVIGEFKHGKSTLLNAMLGGKILPA
FT                   NTLPTTAIITMLVRGETDKVEIFEAEPKQSKIISIDEFRKSYSLSSSDQETIEQRGFID
FT                   RFENIEYAKIECKHPLCSGGVRLIDSPGLAEQLSRTRIATNFFKQSQAALFILNACQPL
FT                   GENERDFIETYFKPGFVDHVFFVVNRMDAIDDEDEVEEVKNYFRNYLKNYFLDSDGKPD
FT                   LKRLDRHLFFTNARAALNARLKEPVNNQALEASGVLELEKALERFLSSPDKVRSALSST
FT                   FKRLINIVYDAHARIEHEKAALEQSIADLELRRAESEVRLQSLEAKQEEIRETIRVYSE
FT                   VIAAKLCSNLAGYLSEQKDLWKTKAPHFITTSLFNPLEIATSFVSSSKKENIKRTLERD
FT                   TQDYLQNIFKDWSNSAAFVADEELKKLSLRLETEITEFSRELVSVENFFSGGVNEGPSV
FT                   IEDLARNREEKILQLVLCLAMGDFSHMSSALLGRGDWLSFVQGAIFQAAIGTFVLSVFQ
FT                   GGPLGWALFIVLEIGQFIFNMNRHEDEIIRSIGDKIHQELRNRLPQMQESITWRTKEQF
FT                   WNLAHHLTESLQGQIDEVRQEQQRIIEQKKTENFSVDTEKKRMDLIGQELVLMFNRICE
FT                   ATYSKTYSLDQIKWLSRGEKLI"
FT                   /protein_id="YP_002478275.1"
FT   misc_feature    complement(<18941..19558)
FT                   /note="type I restriction enzyme EcoKI subunit R;
FT                   Provisional; Region: hsdR; PRK11448"
FT                   /db_xref="CDD:183141"
FT                   /locus_tag="Cyan7425_5314"
FT   misc_feature    complement(18113..18628)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Cyan7425_5314"
FT   gene            complement(19753..21192)
FT                   /db_xref="GeneID:7280279"
FT                   /locus_tag="Cyan7425_5315"
FT   CDS_pept        complement(19753..21192)
FT                   /locus_tag="Cyan7425_5315"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08852"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF1822"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF1822; KEGG:
FT                   tel:tll1979 unknown protein"
FT                   /db_xref="GI:219883114"
FT                   /db_xref="InterPro:IPR014951"
FT                   /db_xref="GeneID:7280279"
FT                   /translation="MSAESLMYPATDHLWFDLSSEELKLAQQQSQRCSNPAARWRAYLN
FT                   ALALGPVLSWLKSEWGDDLNVEPWLPADQHPQIWEFVNGMAIAVGNRRWVLLPQETDDL
FT                   QELVIPQEWVDIREWAGHYYVGIQVNPDQQWLQLWAYVTYEDIKERGDLDPLDQTYTLE
FT                   QEDLTEDIALLMISQEQALSTLSFIPAANSLNPTQTQALIQKLSDPEVLNPRLCLPFSQ
FT                   WSALISHPERRQQLYQQRQPVRLGEWLGQQWQGIKESGWQKWENLSSALGSLGQLGVVP
FT                   IVGANLGTAFSPAIAMRSLSPEFSASNPIEQYGVDSPQVRLLIQEWAKLSPQSPEAVKA
FT                   IPELEQILQTAQEEDTRWLAAETLWLLSPGNQAAGFWGMKQVDLGIDLAGQAIGLVLAV
FT                   LPKSSEQVSVFVRVYPLQPQASLPAKLELQILDQTGEVFQQLSAREQDRVLQYKFWGSP
FT                   GEEFGISLKLNQGHYRENFIL"
FT                   /protein_id="YP_002478276.1"
FT   misc_feature    complement(19759..21147)
FT                   /note="Protein of unknown function (DUF1822); Region:
FT                   DUF1822; pfam08852"
FT                   /db_xref="CDD:149798"
FT                   /locus_tag="Cyan7425_5315"
FT   gene            complement(21189..22568)
FT                   /db_xref="GeneID:7280280"
FT                   /locus_tag="Cyan7425_5316"
FT   CDS_pept        complement(21189..22568)
FT                   /locus_tag="Cyan7425_5316"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_1608 hypothetical protein"
FT                   /db_xref="GI:219883115"
FT                   /db_xref="GeneID:7280280"
FT                   /translation="MRARHTVQEQFSSFLSIEGEGPQIQYRWITQSNLARAVRAREISD
FT                   PEAFALTLLDKLRQSSCAQSNAHLIAYLQEICYWAARKVQRRLALQWSDLEERECFLMA
FT                   SEILAQPLKLLKTYDPSWGTKLKTYAQHRLELQLGQRLYTMRGWRQSTNWGLLRKVSNR
FT                   QLKEAVERHLGVSGQELVAHQLAVNSFKEVYAPIPGQSSRQLAEPTQGQWQMMVQQYNQ
FT                   SAARLEMASVNVSQFRALISASVQSIRAFSTLPIVEPPDNFDVEDHRDSGIETLIAQEQ
FT                   EQQQQELSEILNQSFGQLPLDQQALLLFISGLRIRQQDISQVRQEQFPGFPQQQYQVAR
FT                   KLTKCRKQLYQAFLQRLNPNGGPLTEAQLKQIKPVLDEWLKHYFIKEFNNCLDSLYQRH
FT                   MQNIDKNQKEDLVVNLFDELRRYIEAKFQVSLPRIQIVNDALQSIVEHWLENHLRGGEQ
FT                   L"
FT                   /protein_id="YP_002478277.1"
FT   gene            complement(22781..23773)
FT                   /db_xref="GeneID:7280281"
FT                   /locus_tag="Cyan7425_5317"
FT   CDS_pept        complement(22781..23773)
FT                   /locus_tag="Cyan7425_5317"
FT                   /gene_family="HOG000273714" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PTH_1997"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_1997 hypothetical protein"
FT                   /db_xref="GI:219883116"
FT                   /db_xref="GeneID:7280281"
FT                   /translation="MKILQDTLQSLSLGAPQHYRNLSMFPLVANASKKPDYLVLDEALE
FT                   RQVARITEVSQQGSVPELQFSNQADRAVLLLDGEELLGAKQNRVLNLTLLVPAQTSLKI
FT                   PVSCVEAGRWQHQSAEFKASPRAYYSSGRAKKLRQVTACMTETGCHYSDQQAVWADIAE
FT                   KASRLRTSSPTGAMAAMYENHQHSLEDYVLGLSLVNHQVAALFAINGQLIGLDLFDFPA
FT                   TMDKLFAKLVRSYALDALDNPNVVTEASTSEQAQGFLQTVVQSKSESFPALGEGTDLRL
FT                   EGSGLVGSALIARDRIVHLSAFRLQQSPSSSSSSFRSGNIFRRHHRRQP"
FT                   /protein_id="YP_002478278.1"
FT   gene            23960..25612
FT                   /db_xref="GeneID:7280282"
FT                   /locus_tag="Cyan7425_5318"
FT   CDS_pept        23960..25612
FT                   /locus_tag="Cyan7425_5318"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all3180 similar to adenylate cyclase"
FT                   /db_xref="GI:219883117"
FT                   /db_xref="GeneID:7280282"
FT                   /translation="MGKVAVLKLGTGSFEEGFPVTLRLSEDAPLHLLLEVDGQLPPCPG
FT                   VWDCYCQWQTGYNQIAKNLRLGAPTGQVVQVRYTEPAETYRLIALNLRKQLNQWLNSGY
FT                   SGFQSVRDRLLIHLNPQEEIRFIIQTQDLNLWRIPWHLWDLIEAYPHAEIAVSSPQYEK
FT                   PENIERPRKKYVKILAILGNAAGIDVSADRQVLQQLRHAKVTFLAEPQRSQLHLLRDES
FT                   WDILFFAGHSQKGKLKINQQDEITIDELKSTLVRAVSNGLQLAIFNSCDGLELARDIAD
FT                   LKIPQTIVMREPVPDQLAQEFLKYLLNFYSHGHSLYSSVRESRERLREFHDLEAYIPGV
FT                   SWLPIIYQNPSTVPVSWQQLHERLAEPSYKHSIKNKWKWLIYLPPIFLTSLIAYSLIRS
FT                   IYDENSNENYHEFMKLAYDGMKKAKSENNYHYYHNTFINFRKALELRPLDPYAWYGLLD
FT                   TGFDLFQKTPEKGSPVYPPSSPLPKSTPSPANRSFANKEIPKVFPVKHPISPQELKPRS
FT                   LSSTKASSNTKLSSGHLEKYLETVSLQDSLVQW"
FT                   /protein_id="YP_002478279.1"
FT   gene            25606..26667
FT                   /db_xref="GeneID:7280283"
FT                   /locus_tag="Cyan7425_5319"
FT   CDS_pept        25606..26667
FT                   /locus_tag="Cyan7425_5319"
FT                   /gene_family="HOG000267477" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dol:Dole_3091 transposase IS4 family protein"
FT                   /db_xref="GI:219883118"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7280283"
FT                   /translation="MVRWELAEVKSMGQQGFWDVEARQAKLAAKQNILERLNAVIPWEN
FT                   FRPILEQLYQKPRKSQAGRKPTDVILMLKLLVLQKLYNISDESLEYQVNDRLSFMTFLG
FT                   LGLEDVVPDATTVWLFRKQLRDAELIDVMFEQFEQYLCQQGYQAQGGQIIDATLIPVPK
FT                   RQDSEDDKQQLNAGETPQSWQENPHRAVQKDRDACWTKKGNVSHFGYKDHISIDVEHGF
FT                   IRRYAVTDASVHDSQAFTAVLDADNQDDGVWADSAYRAAGIETLLETLHFESHIHERAY
FT                   RNRPLSETQKQANRDRSQTRAKVEHVFGRWVMQMGGKLLRSIGLANANAHLGLKNLTYN
FT                   LLRYSFWQTQASV"
FT                   /protein_id="YP_002478280.1"
FT   misc_feature    25792..26016
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Cyan7425_5319"
FT   misc_feature    25849..26634
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Cyan7425_5319"
FT   gene            26829..27281
FT                   /db_xref="GeneID:7280284"
FT                   /locus_tag="Cyan7425_5320"
FT   CDS_pept        26829..27281
FT                   /locus_tag="Cyan7425_5320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05419"
FT                   /codon_start="1"
FT                   /product="GUN4 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: GUN4 domain protein; KEGG: mar:MAE_26080
FT                   serine/threonine protein kinase"
FT                   /db_xref="GI:219883119"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="GeneID:7280284"
FT                   /translation="MIDPKLTRLKSLLAAKKWGSAEIETNNTIKRLVGYKKQSNIPPEL
FT                   IKKMPCKDLHNINQLWVSSTPKPHFGYSVQLDIWESPPINKSFQRFGNATGWQKNGKWL
FT                   EVLQLSFSVNNPTGHLPWHGWQYNKNYEFKRIGFGLFMERLKQCKI"
FT                   /protein_id="YP_002478281.1"
FT   misc_feature    26853..27203
FT                   /note="GUN4-like; Region: GUN4; pfam05419"
FT                   /db_xref="CDD:147548"
FT                   /locus_tag="Cyan7425_5320"
FT   gene            27439..28950
FT                   /db_xref="GeneID:7280285"
FT                   /locus_tag="Cyan7425_5321"
FT   CDS_pept        27439..28950
FT                   /locus_tag="Cyan7425_5321"
FT                   /gene_family="HOG000058200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: npu:Npun_R3353
FT                   transposase IS66"
FT                   /db_xref="GI:219883120"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7280285"
FT                   /translation="MMEPLPVSIEQISDSEWVETPESVKRYLLGRIEQLERQYEELKAE
FT                   NAMLREQLRRNSQNSSKPPSQDQGNRFKPKAKQEKEKKKPRGGQLGHEGHEGKFYPLEA
FT                   CETVTEHYPERCINCGGRLQGKDPEPYRVQQVEIPPVVPVVREHRFHALKCACCGVRTR
FT                   AWDEVIINGCRYGERIVSTVGLLSGQYRQSHRMVQGLLDQLFGVELSTGSINQLRQESS
FT                   TSVASAVEEAHHYVQQQEQVNMDETSFAQGNNDGKNTEGRKGWLWVLVTPWVSYFAVCL
FT                   SRSSQVCQQLLGETFTGIVGSDRYSAYQHLSLEHRQVCWAHLKRDLTQIAERKGVAGEL
FT                   GQALLEQQHLLFEHWYRVRDGTLSRSEFSQTVQPIRERFKQLLTEGAGYEIAPKEKTPL
FT                   AKTVRTCQQLLKIEPALWTFVTTEGIEPTNNAAERALRPAVLWRKNSFGSQSEAGSLFV
FT                   SRMLTVTTSLRAQNRSVLEYLVQACRASRQGLPAPSLLPIQDRTL"
FT                   /protein_id="YP_002478282.1"
FT   misc_feature    27880..28371
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_5321"
FT   gene            complement(28924..29571)
FT                   /db_xref="GeneID:7280286"
FT                   /locus_tag="Cyan7425_5322"
FT   CDS_pept        complement(28924..29571)
FT                   /locus_tag="Cyan7425_5322"
FT                   /gene_family="HOG000224291" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mext_0063"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mex:Mext_0063 hypothetical protein"
FT                   /db_xref="GI:219883121"
FT                   /db_xref="GeneID:7280286"
FT                   /translation="MPSSFTNLDSTMNPKNPNHVVLLGDSIFDNAQYVPGEPPVIKQLQ
FT                   QQLPEGWKATLLAVDGDVTSDVVQQLQQLPADASHLVISVGGNDALTRSFILNQPVKSV
FT                   GEAMAYFATVIVDFQTSYRQMLKTALSYKKPTCVCTIYDAVPNLSSIEKTALSLFNDVI
FT                   LREAIAVGIPVIDLRAICTEAEDYSQVSPIEPSERGGQKISSNRSEGAILNW"
FT                   /protein_id="YP_002478283.1"
FT   misc_feature    complement(28954..29514)
FT                   /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
FT                   family of lipases and esterases. The tertiary fold of the
FT                   enzyme is substantially different from that of the
FT                   alpha/beta hydrolase family and unique among all known
FT                   hydrolases; its active site closely...; Region:
FT                   SGNH_hydrolase; cd00229"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Cyan7425_5322"
FT   misc_feature    complement(order(28990..28992,28999..29001,29308..29310,
FT                   29389..29391,29494..29496))
FT                   /note="active site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Cyan7425_5322"
FT   misc_feature    complement(order(28990..28992,28999..29001,29494..29496))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Cyan7425_5322"
FT   misc_feature    complement(order(29308..29310,29389..29391,29494..29496))
FT                   /note="oxyanion hole; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Cyan7425_5322"
FT   gene            complement(29628..29948)
FT                   /db_xref="GeneID:7280287"
FT                   /locus_tag="Cyan7425_5323"
FT   CDS_pept        complement(29628..29948)
FT                   /locus_tag="Cyan7425_5323"
FT                   /gene_family="HOG000088148" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CYA_2757"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cya:CYA_2757 hypothetical protein"
FT                   /db_xref="GI:219883122"
FT                   /db_xref="GeneID:7280287"
FT                   /translation="MSLAQRIRDNVARSRRTTAEILGVTAELMESHEQAIEHLAATRSL
FT                   PHQPWTVKTMQQTIGPFRQAQAHFLELYGIRAKGWVALVEKVNTVETALVHLGYRDRSP
FT                   KQ"
FT                   /protein_id="YP_002478284.1"
FT   gene            30188..31738
FT                   /db_xref="GeneID:7280288"
FT                   /locus_tag="Cyan7425_5324"
FT                   /pseudo
FT   gene            31770..32480
FT                   /db_xref="GeneID:7280422"
FT                   /locus_tag="Cyan7425_5325"
FT   CDS_pept        31770..32480
FT                   /locus_tag="Cyan7425_5325"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: amr:AM1_H0075
FT                   transposase-associated ATP-binding protein, putative"
FT                   /db_xref="GI:219883123"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:7280422"
FT                   /translation="MDHLDAIEHQATQQNWSYGQFLLHLCHLEAQRREHVRLQRSLSEA
FT                   QLPAAKSFTNFDFSHCPQFNPAPLMQLAQATDWLARAQNCILLGPSGVGKTHLAASLAR
FT                   RCIELGKRVKFFAATALVQQLQDAKLQLQLYPLLKKLDRYDLLVLDDLGYVKKNETETS
FT                   VLFELIAHRYERKSLLITANQPFSQWDSIFSDSMMTVAAIDRLVHHGVIIDVQAPSYRK
FT                   AAASQRLTQSAATA"
FT                   /protein_id="YP_002478285.1"
FT   misc_feature    31797..32453
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Cyan7425_5325"
FT   misc_feature    31974..>32108
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5325"
FT   misc_feature    32034..32057
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5325"
FT   misc_feature    32037..32060
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5325"
FT   gene            complement(32658..33311)
FT                   /db_xref="GeneID:7280289"
FT                   /locus_tag="Cyan7425_5326"
FT   CDS_pept        complement(32658..33311)
FT                   /locus_tag="Cyan7425_5326"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syf:Synpcc7942_1147 hypothetical protein"
FT                   /db_xref="GI:219883124"
FT                   /db_xref="GeneID:7280289"
FT                   /translation="MMAMQYPEPKKSLNELVRELARNITRKQLVAIAREHGWQIVQGGK
FT                   EPFKAIREGYPCVSIPGHYDNAIINRRTAARILKLLLAPTFDNNLYPGELEDKLAYLLQ
FT                   ELESQREKAEQAECQLQQALSTIFNLTADVEAGLALADETEQRNHTLCRELNRYSRWVA
FT                   GLKRKVAALIQQRAEQEQEMLAIAEVVERKEMNEHRSVEKLKQIKLSNVKHIAR"
FT                   /protein_id="YP_002478286.1"
FT   gene            complement(33370..33957)
FT                   /db_xref="GeneID:7280290"
FT                   /locus_tag="Cyan7425_5327"
FT   CDS_pept        complement(33370..33957)
FT                   /locus_tag="Cyan7425_5327"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GK14900 gene product from transcript
FT                   GK14900-RA ; K06026"
FT                   /db_xref="GI:219883125"
FT                   /db_xref="GeneID:7280290"
FT                   /translation="MNHEFIQTTLPMLVRGVATIGSAVFILAYAREYVLRFELKAPPSP
FT                   PSSEANRKLQQVEAQEQQLRARVEELQLALEQAKANQLTLNSELEQASAIQLTLNSELE
FT                   QVQLELQTVQQTLVHYQDLSNNLEVQLSVKQADLDKAVMELARTQRGFRGVINAVFDLL
FT                   EEAGATFLGLRGGEQAALPPTTASSQSEMPQI"
FT                   /protein_id="YP_002478287.1"
FT   gene            34412..36034
FT                   /db_xref="GeneID:7280291"
FT                   /locus_tag="Cyan7425_5328"
FT   CDS_pept        34412..36034
FT                   /locus_tag="Cyan7425_5328"
FT                   /gene_family="HOG000080925" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aae:aq_387 hypothetical protein"
FT                   /db_xref="GI:219883126"
FT                   /db_xref="GeneID:7280291"
FT                   /translation="MTISSDTLANNQTIYTAISFAPVQGFIEKSRKLRDLFGASLILSY
FT                   LSAKLVDLAKEQGLEVISPGSVDVKEGMPNRILVKGNTNLNRDKVKNTLIMEWGRILDK
FT                   CQAWVEQKVSEEEYHWSQKEEDQGKQKGEWERWKSYAWEVFWGYGSTVKDAMEDLETRK
FT                   LKRDWIGINWIGESSSLSGTDAIAWHGLGQESDRPWEWARHQDSVNRFYEQLATALEKS
FT                   PDGVLLGKFLDPNERLSIPELVKRLVTRYEDIGRHFGKDFRFDSLSEMVRLPQPDQPGH
FT                   WTGWFMGDGDSVGDMLKELAKNPDDIHPLKTFSNAMRDWGRDFKHGFPDELGRVIYAGG
FT                   DDFLGVIYSKDPKAPIPEQTALQWLMSLNGQWQAHGQPITLSVGFVWAGHSVPQRDVLQ
FT                   HCREAEKRAKALGKNRVTIRVLFNSGQYVQWTCPWNYLNILKKYRDRDGRTSSEANWNH
FT                   LYSDWATLKARHAIRLEEMEDFTVNKQIAVSVFDLYFDNSATEFETKRLWQELTGDNSA
FT                   KAIVNWMDDLIQVGWQLCRNSKL"
FT                   /protein_id="YP_002478288.1"
FT   misc_feature    34451..35638
FT                   /note="CRISPR-associated protein, Crm2 family; Region:
FT                   cas_TM1794_Crm2; TIGR02577"
FT                   /db_xref="CDD:162930"
FT                   /locus_tag="Cyan7425_5328"
FT   misc_feature    34454..34726
FT                   /note="CRISPR-associated protein; Region: DUF3692;
FT                   pfam12469"
FT                   /db_xref="CDD:152903"
FT                   /locus_tag="Cyan7425_5328"
FT   misc_feature    <35288..35659
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cyan7425_5328"
FT   misc_feature    order(35294..35296,35411..35413,35426..35437)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cyan7425_5328"
FT   misc_feature    order(35399..35401,35492..35494)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cyan7425_5328"
FT   misc_feature    35432..35434
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cyan7425_5328"
FT   gene            36013..37155
FT                   /db_xref="GeneID:7280292"
FT                   /locus_tag="Cyan7425_5329"
FT   CDS_pept        36013..37155
FT                   /locus_tag="Cyan7425_5329"
FT                   /gene_family="HOG000080926" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_F0047 hypothetical protein"
FT                   /db_xref="GI:219883127"
FT                   /db_xref="GeneID:7280292"
FT                   /translation="MSQFQALITVSPLGLMYGSAGGFLSPENLVGRSNTKFPPDAATIA
FT                   GLLLNANREKQWLDPQQLKQDLVIAGPFWANRDTPTRFYIPIPWNRVIGENDSDEWELA
FT                   KKPRANQESETTNEQWLLNQHQWQRHKKDVEPAYTWQLIDGWDLPTDELREREAIAEVP
FT                   WKYTPFLHPKIKPDERHVVDQDGLFLENAVQLREDACLVYLTNIAQSDLDPLVGWYRLG
FT                   GEGHLVEVESHELSAKHKINRLLAQKIDHAFALITPGVWGSNKLSYRYPQHSSFPNRDL
FT                   KLLTDKAVPYRYRVGHSQKDKPEGSDFYNPRTTGRLSRGRYAVPAGSVYVFREPLGMTW
FT                   WEFPDEWFPKEGFPLKHLGCGLCLPINLQGVPECTKKLTA"
FT                   /protein_id="YP_002478289.1"
FT   misc_feature    36034..37116
FT                   /note="CRISPR-associated protein (Cas_Cmr3); Region:
FT                   Cas_Cmr3; pfam09700"
FT                   /db_xref="CDD:150385"
FT                   /locus_tag="Cyan7425_5329"
FT   misc_feature    36034..37104
FT                   /note="CRISPR system related protein, RAMP superfamily
FT                   [Defense    mechanisms]; Region: COG1769; cl12075"
FT                   /db_xref="CDD:164327"
FT                   /locus_tag="Cyan7425_5329"
FT   gene            37131..37949
FT                   /db_xref="GeneID:7280293"
FT                   /locus_tag="Cyan7425_5330"
FT   CDS_pept        37131..37949
FT                   /locus_tag="Cyan7425_5330"
FT                   /gene_family="HOG000080927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03787"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF324"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF324; KEGG:
FT                   syp:SYNPCC7002_F0046 hypothetical protein"
FT                   /db_xref="GI:219883128"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="GeneID:7280293"
FT                   /translation="MYQKAYGVIEALAPVHVGATAGEETGNLNLIFRDQFTQTGVIPGS
FT                   SIRGRFRADMRDNEAGEEQRWYGHEAVTGRPDGGTSEALVKFEYASLVWFPVFCPGQPV
FT                   VWVSCPLLLKRYKRIAGIDANVPEPYTAQRGLQGRQMPDRGKILFFNLGFLEIEHEADL
FT                   SAWVPAGTELDANKLVIVSDNDISMLHDMALYRQSRVKLLDEMKKVDTERGAFFNTEAL
FT                   PEGSILVFPIALKQSGWKPFGDEASSELYFGGLESIGFGRCRVLLEGDYQ"
FT                   /protein_id="YP_002478290.1"
FT   misc_feature    37155..37940
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="Cyan7425_5330"
FT   gene            37949..38371
FT                   /db_xref="GeneID:7280294"
FT                   /locus_tag="Cyan7425_5331"
FT   CDS_pept        37949..38371
FT                   /locus_tag="Cyan7425_5331"
FT                   /gene_family="HOG000080928" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883129"
FT                   /db_xref="GeneID:7280294"
FT                   /translation="MAWKSYELDRIAQKLVLVARERDPKSLNQSHKMRMAVAYGLERFW
FT                   GEHLRLKGKEEAKSKYWKATWDAFCDVMAKVDIKLPKDTVGAEDTKKIQDISTHLWKLP
FT                   VEDQRVAIAVLTQLCDCIVWWTQRYKIGRLADESDS"
FT                   /protein_id="YP_002478291.1"
FT   gene            38355..40037
FT                   /db_xref="GeneID:7280295"
FT                   /locus_tag="Cyan7425_5332"
FT   CDS_pept        38355..40037
FT                   /locus_tag="Cyan7425_5332"
FT                   /gene_family="HOG000080929" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_0357 hypothetical protein"
FT                   /db_xref="GI:219883130"
FT                   /db_xref="GeneID:7280295"
FT                   /translation="MRAIPDAHKKVPMMFRAQVNERCQIQRLVKGEEPDAVRWADEWTS
FT                   RVETLPSPPSEEVQTRDCEIAWRLITNSGLDDGVIRPVIGAQGLPYFPGSSMKGMFRRA
FT                   CTPAQADRYCGRPLPGNDWQPGILRFHGGYPIEQNWTEHLVDIVHPQQSWQVKSNDKEG
FT                   GAFVQISLYKPILRFGISSTLPLEPSEWDDIWDVWQRALAKGIGSRVAAGYGQVRDSQP
FT                   TVLHKSRLKGQGQAPKLITQAGEFRPNMFRAALRGHALRIFGGLTDATTAERLVQNLFG
FT                   GIQGREGTVGLLGLKFVESKLTIGSFGGGSYAQPCYDVEGELTWYLARSLPDPAHEPLL
FT                   KKLVANLMQFAMVFGGFGKSWRRADHRKFFEEYYDDGYKALIGCHWQWLGDLSLRRNVK
FT                   VWNVNKIGGAIDQVRTAAEEWMRSQGVNPTPNRWAQPWREVWHPSNVQVWGREATDAES
FT                   SEAIRWFHSAYRQAIPKVCSEGSIYKSDFVGRVSQVGKLWHRMYPVVILIKNPDDPQKP
FT                   TVRKTAKYLELLTLFPDGSDTANAFLDFLETKPFGFEQLWGGE"
FT                   /protein_id="YP_002478292.1"
FT   misc_feature    38616..39002
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="Cyan7425_5332"
FT   gene            40040..41602
FT                   /db_xref="GeneID:7280296"
FT                   /locus_tag="Cyan7425_5333"
FT   CDS_pept        40040..41602
FT                   /locus_tag="Cyan7425_5333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_F0043 hypothetical protein"
FT                   /db_xref="GI:219883131"
FT                   /db_xref="GeneID:7280296"
FT                   /translation="MHLWIVTIGSSDVQLISDKANQAKGRTEKQRSDKVWSYWYTDDLR
FT                   ADCYDIPFEPKQLFKDKEESYRIAPRILGRVYQASDESRQHEILDYLSFPLLDNFVQAL
FT                   KDYPAPEAIAVLLTDQSTIFGSDRQRKLNSPYWQDTCELQPILQDYFAEKFPGAACEFI
FT                   SLIPNSEAESLDNWNAVLDLVRGKFRSLTIADQPIQVNPGKNVYVSHQAGTPAISSAVQ
FT                   FISLSRFRDNVQFLVSNEYDRQTCTIPRSNYLRELQRQEAIALLERRDYGGVRDVLGLT
FT                   AITPGNSSEKRAKYLLEAGNQWNFAEFQKFKKILVDRKLISGVKFPWWRLGYESAYLSV
FT                   IRLTKQENTVEALFHSFRAIEGSISRWAQDKYRSHIEVDPQYGPQIKLSIQRELPGYLN
FT                   ALSESMQDNFQRKGRIGLYGVQLYELLKEARSDWQIDHHIKVVWETTKNQRNELFHRIE
FT                   GLQTVEVYQAWGTNTVEEWKAKVLGCLNFIAKDDLPQKFESLEEASLMTEVHQELERAI
FT                   ADL"
FT                   /protein_id="YP_002478293.1"
FT   gene            41698..42285
FT                   /db_xref="GeneID:7280297"
FT                   /locus_tag="Cyan7425_5334"
FT   CDS_pept        41698..42285
FT                   /locus_tag="Cyan7425_5334"
FT                   /gene_family="HOG000228656" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF820"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   npu:Npun_R4598 hypothetical protein"
FT                   /db_xref="GI:219883132"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="GeneID:7280297"
FT                   /translation="MIASPQPSLSAEAYLQLEAQSQTKHEYINGEVYAMAGASDTHVTI
FT                   AGNLFVLLRSHLRDSGCRVYIADMKIRIAARNCFYYPDVMATCGPQDQQTPNYKRFPKL
FT                   IVEVLSDSTEAFDRGDKFADYQTLASLEEYVLLNTRHRRVECFRRNPQGLWVLQSYLPE
FT                   TDSFELQSVEFSGTLTALYEDVVLEPSHSPPV"
FT                   /protein_id="YP_002478294.1"
FT   misc_feature    41767..42192
FT                   /note="Domain of unknown function (DUF820). This family
FT                   consists of hypothetical proteins that are greatly expanded
FT                   in cyanobacteria. The proteins are found sporadically in
FT                   other bacteria. They have been predicted to belong to the
FT                   PD-(D/E)xK superfamily of...; Region: DUF820; cd06260"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Cyan7425_5334"
FT   misc_feature    order(41821..41823,41944..41946,42016..42018,42058..42060,
FT                   42070..42072)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Cyan7425_5334"
FT   gene            42551..43243
FT                   /db_xref="GeneID:7280298"
FT                   /locus_tag="Cyan7425_5335"
FT   CDS_pept        42551..43243
FT                   /locus_tag="Cyan7425_5335"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_F0917 hypothetical protein"
FT                   /db_xref="GI:219883133"
FT                   /db_xref="GeneID:7280298"
FT                   /translation="MNNQSLLQLPRYKCWPRYANGQQVFHLHDRNYVGVSTILKATEPL
FT                   EVQAQLAAWRSRVGAEEAERIIRASINRGKRLHRLVENHFLQSQGAEATPEFWGYWQSL
FT                   QPVLSEITDVYLVEGLVWHPHGFAGVTDALLAYQGQMCVCDWTTSPKPKQWTWIQNKCL
FT                   QVAAYTAAINRVYQSYGVRVNQAQIVIALPDTDAQVFRLEPSQLMDFWHQFQDRLAEYK
FT                   KLCAIPTH"
FT                   /protein_id="YP_002478295.1"
FT   gene            43335..44291
FT                   /db_xref="GeneID:7280299"
FT                   /locus_tag="Cyan7425_5336"
FT   CDS_pept        43335..44291
FT                   /locus_tag="Cyan7425_5336"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3415"
FT                   /codon_start="1"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_3804 transposase"
FT                   /db_xref="GI:219883134"
FT                   /db_xref="GeneID:7280299"
FT                   /translation="MKPYSLDLRQKIVDVFIEGQTSQRQIAIQFRVAYSFVRKLIKQYR
FT                   ETGDIAPKQRTEQTPTKLSADQLETLKTLVESNNDATLSELCDLLEQAVGVRIGVSTMF
FT                   RMLETLNLTLKKKTLHPDEKETERVQTERVEFWQRVGEFLAQDLVFIDESGVDLALTRL
FT                   HARALKGKRAHGKRPSKRGKRVSMLSAISLQEVMTHCSLIGATDGLTFEAFISQKLVSK
FT                   LWKEACVIMDRCSIHQGEEVRAMIERAGANLIFLPPYSPDFSPIENCLSKIKSILRSIG
FT                   ARSYPDLDKAIKEAFSQVSLNDLRNWFTHCCYCTSLD"
FT                   /protein_id="YP_002478296.1"
FT   misc_feature    43335..>43652
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="Cyan7425_5336"
FT   misc_feature    43338..>43496
FT                   /note="Paired Box domain; Region: PAX; cl09102"
FT                   /db_xref="CDD:142149"
FT                   /locus_tag="Cyan7425_5336"
FT   misc_feature    43884..44273
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_5336"
FT   gene            44746..46362
FT                   /db_xref="GeneID:7280300"
FT                   /locus_tag="Cyan7425_5337"
FT                   /pseudo
FT   gene            complement(45084..45961)
FT                   /db_xref="GeneID:7280423"
FT                   /locus_tag="Cyan7425_5338"
FT                   /pseudo
FT   gene            46476..46766
FT                   /db_xref="GeneID:7280424"
FT                   /locus_tag="Cyan7425_5339"
FT   CDS_pept        46476..46766
FT                   /locus_tag="Cyan7425_5339"
FT                   /gene_family="HOG000054741" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_F0055 hypothetical protein"
FT                   /db_xref="GI:219883135"
FT                   /db_xref="GeneID:7280424"
FT                   /translation="MYISPRFAQVRNLTVAIVNGTVTLVILLIAPLGLAAVIINTALVT
FT                   LSSYITAIAADRVVLFLQADGTPQAHLINHQRRRTTRDQLPPSAEDDIERW"
FT                   /protein_id="YP_002478297.1"
FT   gene            46774..47763
FT                   /db_xref="GeneID:7280301"
FT                   /locus_tag="Cyan7425_5340"
FT   CDS_pept        46774..47763
FT                   /locus_tag="Cyan7425_5340"
FT                   /gene_family="HOG000230559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: cyt:cce_0348
FT                   hypothetical protein"
FT                   /db_xref="GI:219883136"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="GeneID:7280301"
FT                   /translation="MRSLYISQQGCYVSLRQEMLLVKQGTTVLESVQLPLLDQILVFGT
FT                   AQLTTQAMRACLSRHIPIAFLSRMGYCYGRLLPLERGYRRLARFQQMLHTGERLVIARQ
FT                   MVWGKLKNSRVLLMRQQQRRDSPDLTTAIQALDHFADNVRLANSHEQLLGLEGAGAATY
FT                   FKALGSCILREGFTFAGRTRRPPTNPVNALLSFGYQVLWNHLLALIELQDLDPYESCLH
FT                   QSGDRHPALASDLLEEFRAPIVDSLTLYLVNRGIVDADKDFEYRDGGCLLNNSGRKKYL
FT                   SAFLQRMEEQLHTANGLQPRWELLTQQVRAYKAFVYAPAHGYQPYLTR"
FT                   /protein_id="YP_002478298.1"
FT   misc_feature    46780..47721
FT                   /note="CRISPR associated protein Cas1; Region: Cas_Cas1;
FT                   cl00656"
FT                   /db_xref="CDD:163892"
FT                   /locus_tag="Cyan7425_5340"
FT   gene            47767..48045
FT                   /db_xref="GeneID:7280302"
FT                   /locus_tag="Cyan7425_5341"
FT   CDS_pept        47767..48045
FT                   /locus_tag="Cyan7425_5341"
FT                   /gene_family="HOG000226099" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: cyb:CYB_0834
FT                   CRISPR-associated Cas2 family protein"
FT                   /db_xref="GI:219883137"
FT                   /db_xref="InterPro:IPR003799"
FT                   /db_xref="GeneID:7280302"
FT                   /translation="MLFYVIAYDISCNKRRKKVADLLCGYGQRVQYSVFECVLTPDKYN
FT                   ELQKRLKKRYKETEDSIRFYPLSGHTLPQVEVWGGPPVFEPPGSYVV"
FT                   /protein_id="YP_002478299.1"
FT   misc_feature    47773..48000
FT                   /note="CRISPR associated protein Cas2; Region: CRISPR_Cas2;
FT                   cl11442"
FT                   /db_xref="CDD:164225"
FT                   /locus_tag="Cyan7425_5341"
FT   gene            49431..49565
FT                   /db_xref="GeneID:7280303"
FT                   /locus_tag="Cyan7425_5342"
FT   CDS_pept        49431..49565
FT                   /locus_tag="Cyan7425_5342"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883138"
FT                   /db_xref="GeneID:7280303"
FT                   /translation="METTSIKLLQTAIYDSPYLLGKSIEWKRAEKVDKKALQRFVPTC"
FT                   /protein_id="YP_002478300.1"
FT   gene            50972..51250
FT                   /db_xref="GeneID:7280304"
FT                   /locus_tag="Cyan7425_5343"
FT   CDS_pept        50972..51250
FT                   /locus_tag="Cyan7425_5343"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883139"
FT                   /db_xref="GeneID:7280304"
FT                   /translation="METLDAAGQRRFYNLCPYLLGKSIEWKHPLTELLGAEPTPGPYLL
FT                   GKSIEWKHRSLRLIFYDRLSPYLLGKSIEWKRNLEYTGTKSHWVPTC"
FT                   /protein_id="YP_002478301.1"
FT   gene            51264..51413
FT                   /db_xref="GeneID:7280305"
FT                   /locus_tag="Cyan7425_5344"
FT   CDS_pept        51264..51413
FT                   /locus_tag="Cyan7425_5344"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883140"
FT                   /db_xref="GeneID:7280305"
FT                   /translation="METMWTRIVPSVLVACPYLLGKSIEWKHPLLATHQLALEESSLLV
FT                   REIN"
FT                   /protein_id="YP_002478302.1"
FT   gene            51634..51780
FT                   /db_xref="GeneID:7280306"
FT                   /locus_tag="Cyan7425_5345"
FT   CDS_pept        51634..51780
FT                   /locus_tag="Cyan7425_5345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883141"
FT                   /db_xref="GeneID:7280306"
FT                   /translation="METPHRWGLVISTQQSPYLLGKSIEWKLLTLPTSGLHFLKSLLVR
FT                   EIN"
FT                   /protein_id="YP_002478303.1"
FT   gene            51946..52095
FT                   /db_xref="GeneID:7280307"
FT                   /locus_tag="Cyan7425_5346"
FT   CDS_pept        51946..52095
FT                   /locus_tag="Cyan7425_5346"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883142"
FT                   /db_xref="GeneID:7280307"
FT                   /translation="MSEYLPWKSPYLLGKSIEWKLGVVRLICNQDICPYLLGKSIEWKP
FT                   ATGY"
FT                   /protein_id="YP_002478304.1"
FT   gene            52071..52208
FT                   /db_xref="GeneID:7280308"
FT                   /locus_tag="Cyan7425_5347"
FT   CDS_pept        52071..52208
FT                   /locus_tag="Cyan7425_5347"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883143"
FT                   /db_xref="GeneID:7280308"
FT                   /translation="METRNWVLIGNRRRSSGPYLLGKSIEWKLDVVITGLEETREVPTC
FT                   "
FT                   /protein_id="YP_002478305.1"
FT   gene            52370..52531
FT                   /db_xref="GeneID:7280309"
FT                   /locus_tag="Cyan7425_5348"
FT   CDS_pept        52370..52531
FT                   /locus_tag="Cyan7425_5348"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883144"
FT                   /db_xref="GeneID:7280309"
FT                   /translation="METLGQLGICVHSPMGPYLLGKSIEWKQIYLYRHQQRKCRPYLLG
FT                   KSIEWKLL"
FT                   /protein_id="YP_002478306.1"
FT   gene            complement(54648..56525)
FT                   /db_xref="GeneID:7280310"
FT                   /locus_tag="Cyan7425_5349"
FT   CDS_pept        complement(54648..56525)
FT                   /locus_tag="Cyan7425_5349"
FT                   /gene_family="HOG000018716" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BPSL0766"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSL0766 hypothetical protein"
FT                   /db_xref="GI:219883145"
FT                   /db_xref="GeneID:7280310"
FT                   /translation="MAVNNRCKVGELRPSQILFSAGIGSVVDLPNLSTMVMGLDDWDTN
FT                   YANELGEERLLAAVRHSLGQQVKSLRSAPMPTESNSVGGLQEDSHRIGVPASPFPTWML
FT                   CPGCRLLAPLQSGLFDLKTDRFRTENNRYVHTNCSKGKYPPTVIPARFLVACCHGHLDD
FT                   FPWRYFVHQGRECSVPLHKCTLRLFEYGVSGSAADIEVRCESCGVTRRMSDAFGEPGKR
FT                   NMPQCRGRHAHLRTFAEGGCDKQMVSISLGASNCWFPVTLSALSIPTGTNKLYRLVEKH
FT                   WVTLEKASSIQILNAFREIGQLKEFGAYSDADIWQEVCHKRTNTGGTEPPDIKDIKTPE
FT                   WQVFTAADTELNSADFWLTPVEPPQGYEDYFEKVVLLERLREVRALIGFTRIESPGDFT
FT                   DTGELEEEVRAPLSRKLTPWVPASEVRGEGVFLQFKEEAITSWLASNPSLKTYEQQTFD
FT                   AHCRWRIARSIRNPEANFPGIRYMLLHSFAHALMRQLAIACGYTAASLRERIYSKYPNE
FT                   DNGPMAGVLIYTAAADSEGTLGGLVSLGEPKLLGQHIDQALEQMRLCASDPLCAEHSPF
FT                   QNTTELHWAACHACLFSPETSCERGNKYLDRSLLVSTVKSIPASLAFFS"
FT                   /protein_id="YP_002478307.1"
FT   misc_feature    complement(54753..55070)
FT                   /note="Domain of unknown function (DUF1998); Region:
FT                   DUF1998; pfam09369"
FT                   /db_xref="CDD:150143"
FT                   /locus_tag="Cyan7425_5349"
FT   gene            complement(56543..60514)
FT                   /db_xref="GeneID:7280311"
FT                   /locus_tag="Cyan7425_5350"
FT   CDS_pept        complement(56543..60514)
FT                   /locus_tag="Cyan7425_5350"
FT                   /gene_family="HOG000018705" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /codon_start="1"
FT                   /product="helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; KEGG: bps:BPSL0765
FT                   putative helicase family protein"
FT                   /db_xref="GI:219883146"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="GeneID:7280311"
FT                   /translation="MKIIQLPPILPGELDLAALNQQLRERSVQLDWSAVISAPESALKV
FT                   LLEGLDLGSTDVLDNPDASTLSDTIGAEVVRILQTKSKRKKAKQPQESPQQQPAVWKPE
FT                   PEEPAVTGKVSEKKGQYAVTPSETIATSGKADTPPPEPLRVLERATPYQIRAKLEQAIL
FT                   NDLLGPAGGEYEELDEARVSDRYLVGLLAPLHRRKRLLEGDDLLEKSEELISAKTGTVD
FT                   EVPGQQDDLAVGGTGSSEDGSTETTNPASETMFPSSIGLSFCVRGTVTAIKVTAGWGQY
FT                   EKGFSEYQTTPTGSPKKVWKRYPICHQSPPIPLQAGSIERWQVNPDREVYVQGQIRAAG
FT                   DDWIISLFLVNGQQEPEKLPDQAWLFQPELSVESADPDQPDIFIRKAQPRSQGKLDPVQ
FT                   YAEAQAMEMLYRNHVEFAVGHGVGVHAELSATDCHRAVRLQTAVVPAYEVPKTDAPSAE
FT                   EIPGLGGLVLDMQVLAELPIDQLVSKLSPLADAYEQWIDAQAIQITNPASGLADYQEPA
FT                   QTAIDHCSRTLSRIRDGLELLQANPQAAAAFQFMNRAMALQRLHTLYAEHQRRGEETTL
FT                   EILDTPKNHSWRPFQLAFILLNLPSITDLHHPARSHATEAIADLLWFPTGGGKTEAYLG
FT                   LTAYTIGLRRLQGTVAGRSGEYGVAVLMRYTLRLLTLQQFQRATALICACEAIRREQPE
FT                   QWGKEPFRIGLWVGQKTTPNRTEQSEEFLKQKLGQSQSSSSGSPHQLTNCPWCGSKIEP
FT                   GKQHIKVEPFAKGQGRTLIYCGDALGRCLFSQKQSPTEGLPVMVVDEEIYRRLPTLLIA
FT                   TVDKFAQMPWNGAVQMLFGQVESYCPRHGFVSPEFDKECPSTHPAKYGLPTARTLPHNP
FT                   LRPPDLIIQDELHLISGPLGTLVGLYETAVDDLCSWTVDGQRVRPKVIASTATIRQARD
FT                   QVHRLFLRQVEVFPPQGLEVSDNFFSRQRPPSQEAPGRRYLGICATGRRLKAALIRVYT
FT                   AVLASSQALYKDYGEVVDPWMTLVGYFNSLRELGGTRRLVDDDIQSRLAKMDQRGLAKR
FT                   SRLEVEELTSRKTSTDIPIVLDWMETPFVPGLEKQTGKRKPLDVLLATNMISVGVDVRR
FT                   LGAMVVTGQPKTTAEYIQATSRVGRSFPGLVITVYNWARPRDLSHYEQFEHYHATFYQH
FT                   VEALSVTPFAPRALDRGLAALLVSLIRLKGIELNKNEKASRIDPDHPYVQEAIATIVAR
FT                   AAQVADQTTAEEVQQELLTKLEYWLDQVNNLQGGASLGYKTEKDGKTLALLEYPGNQDW
FT                   LPFTCLNSLRNVEPTISLVLDDRIPDDDFRPPQPMPKSP"
FT                   /protein_id="YP_002478308.1"
FT   misc_feature    complement(<56954..>57886)
FT                   /note="Distinct helicase family with a unique C-terminal
FT                   domain including a metal-binding cysteine cluster [General
FT                   function prediction only]; Region: COG1205"
FT                   /db_xref="CDD:31398"
FT                   /locus_tag="Cyan7425_5350"
FT   misc_feature    complement(57119..>57259)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Cyan7425_5350"
FT   gene            complement(60511..62598)
FT                   /db_xref="GeneID:7280312"
FT                   /locus_tag="Cyan7425_5351"
FT   CDS_pept        complement(60511..62598)
FT                   /locus_tag="Cyan7425_5351"
FT                   /gene_family="HOG000287298" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /codon_start="1"
FT                   /product="UvrD/REP helicase"
FT                   /transl_table="11"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: sth:STH1303 putative
FT                   DNA helicase"
FT                   /db_xref="GI:219883147"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="GeneID:7280312"
FT                   /translation="MPWLTTMKPTFQTEWLALPPKESHQILEKINLLTYDPTPDAKVKK
FT                   QLKYMGGKLHRLRSGNYRIFYTFDNTYVSLLALRRRDDDTYDEDLDAEFLGGLDPTLET
FT                   QTHQPNWDKLFGQPQAQETPLPEPITIELLTNLRIPEVCHARLLRVESREKLFDCPGIP
FT                   DQVILKLDEYLFERPLVEVLQQPDFLTGNLDNLLKFKEGDLLGFLLKLNPEQERFVTWG
FT                   MNATGPTLVKGGPGTGKSTVALYRVRTLIQTLKANGIAEPKVLFTTYTNALIAFSRQLL
FT                   TSLLGDDIQHVNVDTVDSIIYALVCREAGEPKLADANQLKILIQQARELAVLNLEGNLL
FT                   QQHAQKQILENLTPDYLLEEMGRVIEGRGLESLEDYQATPRAGRTVALNKVQRQAIWTL
FT                   RCSFYQLLEQAGLETWEQLRSRAVKLLQNLETPILFDAVVIDEAQDLDPNALRFLTLLC
FT                   RAPNRLFVTADANQSIYSSGFRWTDIHADLRFNGRTGVLRTNHRTTREVNEAALHYLAD
FT                   GSLDQEIPQHQYIHNGPQPAVRAISNRGDEADLLVRFCKVASREFRLGINACAILVPSE
FT                   RAGRKLAEQLNYRDLPSTYMTSKDLDLNCAGVKILTLQSAKGLEFPIVAIAGFLESTFP
FT                   TIAKGTPETELDEIFYRARRTLFVGMTRAMRALLLLVPDKNTSPVLQNFAPHLWNLGTT
FT                   A"
FT                   /protein_id="YP_002478309.1"
FT   misc_feature    complement(<62389..62598)
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Cyan7425_5351"
FT   misc_feature    complement(<61066..61968)
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:187234"
FT                   /locus_tag="Cyan7425_5351"
FT   misc_feature    complement(60589..>60813)
FT                   /note="ATP-dependent DNA helicase PcrA; Region: pcrA;
FT                   TIGR01073"
FT                   /db_xref="CDD:162191"
FT                   /locus_tag="Cyan7425_5351"
FT   gene            complement(62677..62931)
FT                   /db_xref="GeneID:7280313"
FT                   /locus_tag="Cyan7425_5352"
FT   CDS_pept        complement(62677..62931)
FT                   /locus_tag="Cyan7425_5352"
FT                   /gene_family="HOG000149637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03683"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0175"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0175; KEGG:
FT                   gvi:gsr2660 hypothetical protein"
FT                   /db_xref="GI:219883148"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="GeneID:7280313"
FT                   /translation="MQTIQIQLPETVFSALRKAPAEFVQEMRVAAAAKWYELGEVSQSK
FT                   AAEVAGLSRSDFISALSRYKVSALQYTPEDLTQELADAD"
FT                   /protein_id="YP_002478310.1"
FT   misc_feature    complement(62683..62910)
FT                   /note="Uncharacterized protein family (UPF0175); Region:
FT                   UPF0175; cl01085"
FT                   /db_xref="CDD:154188"
FT                   /locus_tag="Cyan7425_5352"
FT   gene            complement(63003..65687)
FT                   /db_xref="GeneID:7280314"
FT                   /locus_tag="Cyan7425_5353"
FT   CDS_pept        complement(63003..65687)
FT                   /locus_tag="Cyan7425_5353"
FT                   /gene_family="HOG000088149" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /codon_start="1"
FT                   /product="helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicases; KEGG: ava:Ava_C0233 type III restriction enzyme,
FT                   res subunit"
FT                   /db_xref="GI:219883149"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:7280314"
FT                   /translation="MTFQTGDFVNHMTLGSGEVILDRGATVIVRFEHGIEECEIISISS
FT                   LTTLAQVLEEGNWQAPLPVILRSLAATIDSLNDRWSVFSRSRVKLLPHQLWVCRKVLER
FT                   WPFRWLIADDVGLGKTIEAGLILWPLISRRIVHRVLILAPASLVEQWVLRLREMFDLRF
FT                   TPYTTEADTPRNGFWETHNQVVASLQTLRDDRRGRHDRLLASPPWDLIIIDEAHHLNAD
FT                   EVNGITLSFKLVQKLHEFQKLKSIVFFTGTPHRGKDYSFLSLLKLLRPDVYEDPKQPLE
FT                   KYLSSLRDVMIRNNKQNVTDLNGRLLFNGIETQAVTYYYSTEEACFYDTLTQFILEGYA
FT                   YASSLDGIEGRAVNLVLTALQKLASSSVAAVRSALQKRLKSLKSKQKELVQLKALRQQL
FT                   KTILNQIDTNDGSEDEVSALDERIIELSVALSLMENEEEYLAKLVNLSNAITSETRIRR
FT                   ILDLLKGDFAERSVLFFTEYKATQSLLINALIQHYGETAVTFINGDQEVHNVNGRTIRC
FT                   PRERAIQLFNEGEARFLVSTEAAGEGVDLQQNCHTLIHVDIPWNPMRLHQRVGRLYRYG
FT                   QTHKVEVVTLRNPDTIEATIWERLEEKMQRIQLALSGVMEESEDLFPIVLGMTSPSVWT
FT                   ELFSEAPTVPRETLNSWFDGKTARFGGQDALQTVRDLVGHCASFDYRELAGQLLEVDLP
FT                   ALRPFFTGMLMHNHRQARFTEDGLSFRTPEGWSGIGIKPNYSGLVFDRNFRGADAEQRI
FT                   LGIGHPLLDRALEQARSLEETAALLPSELLPYPLVLLSITDRVTENSGSIRSIIVGVEF
FT                   KHMPILRHDYEVLDLLNRLTKPILRRIESGGNIEIPSAKLTNWLLKAEQFVVDNSTDMD
FT                   LPFRVPNIKALALLCPDRNESLV"
FT                   /protein_id="YP_002478311.1"
FT   misc_feature    complement(64884..65444)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(64929..65360)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(65328..65342)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(65037..65048)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(<64299..>64505)
FT                   /note="ATP-dependent protease La; Region: lon; TIGR00763"
FT                   /db_xref="CDD:162028"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(63945..64337)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(order(64071..64079,64185..64190,64248..64259))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5353"
FT   misc_feature    complement(order(63966..63968,63975..63977,63987..63989,
FT                   64053..64055))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5353"
FT   gene            complement(65700..73481)
FT                   /db_xref="GeneID:7280315"
FT                   /locus_tag="Cyan7425_5354"
FT   CDS_pept        complement(65700..73481)
FT                   /locus_tag="Cyan7425_5354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_C0234 hypothetical protein"
FT                   /db_xref="GI:219883150"
FT                   /db_xref="GeneID:7280315"
FT                   /translation="MDHYGALHTARGDINNIRNILLEGQQSQTGLIFILKEIVQNADDC
FT                   KSTRLGIGWSDGLPKAAHPLLRGPAIVAVNNGPFSKRNAKSIRAIGLSSKENDSSAVGK
FT                   FGLGLKTVFLICEAFFYLTGPHAEPGVEPRSMLNLWWTADGDEDDIPASSWDRLAFTSD
FT                   DQQQIAKEGQRIGLEDGFTLWIPLRRHEHCQRGGYTAPIVENYPGDDPEQFCQEFQGEL
FT                   VKELAGLLPLLKHVQNIDLYDGQHLHGIAVQENSSQCLSVLNTAPTSQNLPLTGVINTV
FT                   DSESYTYYGYQQLLNEPKLQALKERNDWPKNIPLVGPPEKQKAEPHCAVLLNSYPSQTG
FT                   LTKLLIQWAVFLPTAEMPDGSPPEILTLDPEEDNYEDYVLTLHGFFFLQSDRRRIRSWL
FT                   NQQQENNIYQEWNQTLAERGTLRLILPMLESFAQERSPETVKALTHTLLKSRLWNSYRQ
FT                   HICAEGSWICKINFGHSSQLTWCFIQSQEQPFTIPESTVELLPEIFPNLSQVCLNRAVT
FT                   LEEWPRLTRSKIYAKWKTTDIIELLEGGFSSAPNTCASNSLIQVLNSFLDHAVPQWSSS
FT                   SREMSAVTDALKKFLKSAFSTPNFQAADTLDTLIGKLSAEQVLGIPNGLSKGLKQKLLQ
FT                   LETSCLIIPNSLRSEKSTTPKLSVFDVYLILIELESEVRDSQGARSFVSSVISMIASRQ
FT                   PEVWRKICQLDLFEVTRISGSRNIREFHSLDWLGKIKESYRLFRGTTTPEGTESLAEKL
FT                   AHTLKDSIYLSFCSFIDLPHCNANSTIALIKQKPALQTSPESRQKLVQEIAYSVNLFTD
FT                   RGALRYLLHADPNHFDDVDDLLYAGPNQKSNVNSFWSKVLKQIIKPNQHWRFIDSKLLE
FT                   VLSPQQCQALGIANVDAKGVEQELNRIATSGTPLNSLKWDDFSWEECEKLIYNLPSNIS
FT                   NKLRIHEPVDTNGSSSRVAIDEHTYLQGESNDIYIEPSLAQKLGIIQLRRSSRIEIAEK
FT                   QSALTPPISARTLIEHYLLKLDNPVDYWRVILNALKHAPEDCGKLNVLFKVKWLPLQPD
FT                   LRLRNTCALKEIIHLPVIQEEVQKICAEHEQLYIASQNLAQDLQNHNAFKDLRKLFPPQ
FT                   RAAFDMLGEMLLLSENDRYRIGTLTEILVKDKQVRQQWFDAFIELPDDVMPASRLLAKL
FT                   RNCTPTGTEQLFEILGKPVGADRLITILNSLADCHRNTKNNNDLRSALLETYRQYLKLA
FT                   SESDKWVDILQDIQLLSQSKQWKTAQKLCYGAINVAQSDVLHNSLAEIISEKIEQANAE
FT                   NGDSQLDADFKEIEDEDFSDEALRNSNETLRLYFKDWPRRTNNAIGLLLRLLGGKGEIE
FT                   ELARVYFPRVDYFLEEIYEENDNDKRNTINFLVEDIEKTKCFVCKHQSSVIRVKSLTGE
FT                   KLQVQLLDEGEAESLIVGDLQKKRQSDGYSYIQLSLRLCQFLDEIILSRLAKQSFHTIL
FT                   SKFYGYHVTDLENFWDKLQDQAPPDIRVTQNLLLDDAILSLRSQLSLDHDSKIKSLIHK
FT                   HFDLRKQHESLVSLQEKSPERRRYDSKLQENQRDLRENKKEIRNYLINDEETQRAFLLG
FT                   VRQRIKNANYDIYSVPFELFQNADDACWELREMGHPNVSRQFTISLANKSLCFIHWGRG
FT                   INQYQYNGQDWSNRGYSNDLQKMLLLNFSDKSEGVTGKFGLGFKSIFLLTSKPRVVSDR
FT                   IGFDVIGGVYPKELSDEDFKTTTGQLGDSKEGTIVKLNVNESDARPVVEKFVEYLPLLG
FT                   AFSRWLREFKVRIRDNRFTWTGSEKAIDGICSVYTGRSKEIKNNESLNALLLGEPGRRC
FT                   LIPLNSSGAIPLSSNYPTFWVTTPTRMLLKVGFAINGPFRLDIGRSQLDLCGGGKQFNE
FT                   ELAKEMGRMFSQALINLYQLNEVQLCQALNLTTGTTRLTFWTSIWNILSDQFANQNFSD
FT                   KGIDLLKHMFWVEKEGMPLLYTSCEALPTQLPKSAGQFNCLTRLGNIQWAVSGILNADE
FT                   AVLTQVLDWPVLVEGQHQIRPGQVVSYSVAEVLKKLTKLSVKCLDLLTVIKWQLARIVS
FT                   PEVSLIVEQLINQAFLANLPSMEAHSIQEFLKTVQFQSRGNNSAIAQNLLVVESSPKGS
FT                   EESRLALFAPASALLAEEYEYGSLGLFYACRSGDLSLVSLPVEVRGQWVLEASPEQHEF
FT                   CVQYLVKSEHRDKLIQWLKGKLRSSWLTELPSKRQILQQEYRIDPFSFDALLYNLGLLV
FT                   QSINSDINSKDTDIDEDNNSDEATRTAASPALSIKDVLINILEWWSEARSRLIAKYEKS
FT                   IYPCIDLQLNQNNYNDHHNPHCSKKRWLTLFTLGVFHTMGRTNLEQHRTFLQLCEDWGW
FT                   LDVMVTGEVDEAGWINLLDRYFTLPRVGDRLQYYQWVRYYPAFYAFSKWLDAYRDSLLA
FT                   TNDSNAYLSISPTQLRNPIDLVLNPKQNPALQGTGIGQGAPPIGSILGIGSTFIVRELV
FT                   RGGILSNPGMRPYAYVPVRRVRAMLFAIGCSAVRGDSRTTAVDNSMSIYEFLVKHLGEE
FT                   DATYLGDYDLPFLMLQEEPRDIQERLLGRFPVPHEPLESEEDVYRWVNFPQHGNSGEWR
FT                   TRWDGVRFPLR"
FT                   /protein_id="YP_002478312.1"
FT   gene            complement(73577..77806)
FT                   /db_xref="GeneID:7280316"
FT                   /locus_tag="Cyan7425_5355"
FT   CDS_pept        complement(73577..77806)
FT                   /locus_tag="Cyan7425_5355"
FT                   /gene_family="HOG000018694" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BPSL0764"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSL0764 hypothetical protein"
FT                   /db_xref="GI:219883151"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:7280316"
FT                   /translation="MSIARHHAEWLSLVEVSGPFLSLPVLLKTFPAGLDAHDPDLLKLL
FT                   RSAHEEWQDSQFGLKPESAIHRAWVEFVLKQTLELPEEVLWGGQQIPAGLSVTVAEHNE
FT                   TLRPDWVVVNPKGTADAGKPRLLVQVVPAEQGLEKPYKGSRWAASPATRMMELLHACQV
FT                   RLGLLTNGEHWMLVNAPKGETTGFISWYSTLWVEEHLTLRAFRSLLGVRRFFGVEDAET
FT                   LEALLTQSLTDQQDVTDQLGYQVRRAVEVLVQAIGRLDQDQNGTLLKDIPETQLYEAAL
FT                   TVMMRLVFLFCAEERGLLLLGDPIYDQHYAVSTLREQLRSHADQHGEEILERRSDAWCR
FT                   LLATFRAVYGGIFHDTLQLPAYGGSLFEPDRFPFLEGRGQGTEWRSTAADPLRINNRIV
FT                   LHLLEALQMLQIRLPGGVVEPRRLSFRALDIEQIGHVYEGLLDHTAVRAKTPVLGLVGS
FT                   RYEEPEIALSELERFQAEGEDKFLAFLKEKTGRSLNALKKELDKALEPREEQRLRTACN
FT                   NDLALFNRILPFAPLIRKDTVDYPVVIPAGAVYVTEGADRRQTGTHYTPRNLTEEIVQY
FT                   TLEPLVYEGVAEGKPKEEWRLRSAAELLQLKICDMAMGSGAFLVQTCRYMAERLVEAWQ
FT                   AEVPQQKPIPASGHEDKSSELKIHILPDGSLSLGEPGEHILPKDSEERLLVARRLVSDR
FT                   CLYGVDKNPLAVEMAKLSMWLVTLAKGRPFTFLDHALKCGDSLMGITRKEQIEFLHLNP
FT                   EKEAVQLRTVSDRWRPLIQRAIAKRQELENFIALDIRDIERKEQLHQEAEEALAKVRYV
FT                   GDFLVAEALAGSAKTTNLTDVELQVLAENVIEAIDEDDLDKRDRKINFILTKTERMLNL
FT                   GKPVNQPPRRPFHWLLEFPEVFLQEDAPKGFAAIVGNPPFQGGQKITGTLGTDYRNFLV
FT                   DYLANGQRGSADLCAYFFLRANQATNCFGGFGLIATNTIAQGDTREVGLDQLVANGCVI
FT                   HRAVPSRPWIGSATLEVAYIWIHKGNWQGGFFLDEKLVPGITSLLAPQGSVTGSPFQLL
FT                   SNSNTCFQGSILLGMGFVMSPDEAQKLIVKNFKNQDVLFPYITGQDLNSHPQQKPSRWA
FT                   INFFDWALDLEHDDPNKSKGKPYAADYPDCLEIVEAKVKLIRQSDNRRVYRDYWWHYAE
FT                   KRPALYPAIEKLRRVLVIALTSKTVSPTFVSPNVVLDQSIIVFASEQFSFFCFLASSLH
FT                   YWWVIKYGTPMRTDARYSVTRCFETFPFPTSDASALSIKFSILDTIGETYYTERQAVML
FT                   ERQEGLTKTYNRFHDPNESASDIEKLRLLHIEMDQAVAAAYGWQDLDLNHGFHQTKQGL
FT                   RFTISESARREILDRLLELNHQRYAEEVAQGLHDKGKKKAKGKGQKAKEKKTKATPTEN
FT                   IQQRELF"
FT                   /protein_id="YP_002478313.1"
FT   gene            complement(78056..78613)
FT                   /db_xref="GeneID:7280317"
FT                   /locus_tag="Cyan7425_5356"
FT   CDS_pept        complement(78056..78613)
FT                   /locus_tag="Cyan7425_5356"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883152"
FT                   /db_xref="GeneID:7280317"
FT                   /translation="MKIATYNLRCGGKPDKRVHWTQLFEVANPDIFLVQETCQPEQYVS
FT                   SQFWDVHRDRVHWARVEANAWGSAVWVRSGMVRKLDVPQFEGSVVGVEVEGFDCPPSCG
FT                   RKLRIFSLHAPAPYRGSVSRILDWIASLPPNVDLIIGGDFNLTVGVRHPGEEQQDADLW
FT                   LLERLRQEFGLISCWQAANPKP"
FT                   /protein_id="YP_002478314.1"
FT   misc_feature    complement(<78179..78613)
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:186031"
FT                   /locus_tag="Cyan7425_5356"
FT   gene            complement(78653..79144)
FT                   /db_xref="GeneID:7280318"
FT                   /locus_tag="Cyan7425_5357"
FT   CDS_pept        complement(78653..79144)
FT                   /locus_tag="Cyan7425_5357"
FT                   /gene_family="HOG000004408" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xaut_2989"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xau:Xaut_2989 hypothetical protein"
FT                   /db_xref="GI:219883153"
FT                   /db_xref="GeneID:7280318"
FT                   /translation="MQTTHAFAILAPVPEMHLVSGLEAIAAQLDSDVLQPGQFPKVAFG
FT                   SMDFEVFARANELRGDRAVEVFIYASHTQGNQPLHPEVTWRGLYAGVVGSRRGRYPGNS
FT                   IYRPKSTATDSPTWAVFWEVRELELLKTPIVIGSLRGMGKKTNYQARFIPEGPLLIDYP
FT                   "
FT                   /protein_id="YP_002478315.1"
FT   gene            complement(79165..79812)
FT                   /db_xref="GeneID:7280319"
FT                   /locus_tag="Cyan7425_5358"
FT   CDS_pept        complement(79165..79812)
FT                   /locus_tag="Cyan7425_5358"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: spe:Spro_4940 hypothetical protein"
FT                   /db_xref="GI:219883154"
FT                   /db_xref="GeneID:7280319"
FT                   /translation="MPPIEAQYPDTLRALSIAGPFAYEIATGEKDWEFRTWPTKFRGTF
FT                   LLHVSTGRDWGEPQSPEMISCIIGAAEVYECESDPEYDGFLHLLRNPVSFKRYIPKVSG
FT                   ARNYWSPKTEAHIKAFNEAWEQILEQAPILAKGSAPQATSQPEKPESQEPIARFKFSFD
FT                   GGIIRISSTRTDNTFTVTGSNFWQVLQAQAREGEVTLSKSEFGALYEQRLNS"
FT                   /protein_id="YP_002478316.1"
FT   misc_feature    complement(79561..79779)
FT                   /note="ASC-1 homology or ASCH domain, a small beta-barrel
FT                   domain found in all three kingdoms of life. ASCH resembles
FT                   the RNA-binding PUA domain and may also interact with RNA.
FT                   ASCH has been proposed to function as an RNA-binding domain
FT                   during coactivation...; Region: ASCH; cl01020"
FT                   /db_xref="CDD:186302"
FT                   /locus_tag="Cyan7425_5358"
FT   gene            complement(79830..82979)
FT                   /db_xref="GeneID:7280320"
FT                   /locus_tag="Cyan7425_5359"
FT   CDS_pept        complement(79830..82979)
FT                   /locus_tag="Cyan7425_5359"
FT                   /gene_family="HOG000018683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /codon_start="1"
FT                   /product="helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bps:BPSL0763 putative
FT                   helicase SNF2 family protein"
FT                   /db_xref="GI:219883155"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:7280320"
FT                   /translation="MSVPEQGQLVRVRQRQYVVTNLQRTNLPSSPLLTGIFKAQNLVSL
FT                   ASIEDDALGEELQVIWELEPGAYLHERVELPRPTGFDQPARLEAFLDAVRWGAASTADV
FT                   RNLQAPFRSGIDIEDYQLDPVVRAIQMPRVNLLIADDVGLGKTIEAGLVAQELIIRHRC
FT                   RRILIVCPSALQIQWRDQMRDKFGLEFRIVDSGLMKELRRQRGIHVNPWVHFPRLITSI
FT                   DFLKRDRPLRLFREVLPAEGESLYPRRFELLIVDEAHNVAPPGGGRYAIDSLRTAAIRL
FT                   LVPHFEHKLFLTATPHNGYPESFTALLELLDTQRFARGVPPDRNQLQVVMVRRLKQEME
FT                   NWDGSPMFPARKLAAIPVDYPDPERQAHQWLKEYTTLRAKGATDGVEKYATEFVLKLLK
FT                   KRLFSSPAAFLTTLTQHEESIRTARRRSTASLSARPTEGILRRQLDQVEEEFGNDELFE
FT                   VATEESITNSSRLFRSLSLEEQRLLQQMLDWAERASQQPDAKARELLNWIATYIRPQEQ
FT                   WSNERVIIFTEYRATQKWLFNLMAAEGLVQDNRLMMLYGGMNSDDREAVKAAFQTHPDL
FT                   SPVRILLATDAASEGLDLQNYCSRLIHYEIPWNPNRMEQRNGRVDRHGQRAAEVLIYHF
FT                   VGKGYQGQATPQTRPGDLEGDLEFLMRAALKVNNIREDLGKVGPVIAAQVEEAMLGYRT
FT                   TLDTSRAERDSEPVRRMLKFERKVREQIEKLRQQLNETRQNLRLTPDNIATVVRIGLEL
FT                   ADQPPLMETKVPGLGGPAYHLPPLKHSWAVCAEGLEHPHTKAIRPLVFDPALAHGRDDV
FT                   VLAHLNHRLVQMCLRLLRAEVWSTEGRKQLHRVTARVVADQSGLDTPAVIAYGRLVILG
FT                   KDQQRLHEEVISAGGILKEGRFSRLGVMQVQAALAATVPGSVPEVLQQRLADLWDRYAD
FT                   ALMQALEVRKSERATSLQRDLQNRAEKEVADITAILTELRQSILQELEEPQVEQLELFT
FT                   TPEKEQFERNMNSLKARAEQIPREIEQETVLIRERFNEPSARLFPLAVTYLVPRKLCGT
FT                   N"
FT                   /protein_id="YP_002478317.1"
FT   misc_feature    complement(82002..82625)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(82092..82577)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(82539..82553)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(82203..82214)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(81099..81437)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(order(81219..81227,81312..81317,81387..81398))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5359"
FT   misc_feature    complement(order(81114..81116,81123..81125,81135..81137,
FT                   81201..81203))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cyan7425_5359"
FT   gene            83082..84980
FT                   /db_xref="GeneID:7280321"
FT                   /locus_tag="Cyan7425_5360"
FT   CDS_pept        83082..84980
FT                   /locus_tag="Cyan7425_5360"
FT                   /gene_family="HOG000025745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /codon_start="1"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /transl_table="11"
FT                   /note="PFAM: inositol monophosphatase;
FT                   ADP-ribosylation/Crystallin J1; KEGG: ank:AnaeK_0460
FT                   inositol monophosphatase"
FT                   /db_xref="GI:219883156"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="GeneID:7280321"
FT                   /translation="MDDDFGLSSYLKTLRVSISAALEAGKLLRQEFHRPGGPRGGSSHA
FT                   LMDDEAEALIRDRLTEAFPTHGMRGEELKHLNRPPQDPEQHIWLIDPNDGTASYLKGYR
FT                   GAAVSIALLRSGIPVLGVVYAYCAPNGEGDLFSWAEGCGPLQRNGQPVQRIWADKLSTE
FT                   HTVLVSQAGDNNSLANAQLVAPARFRTIPSIAYRLALVAAGEAEAAVSLNGPQDWDYAA
FT                   GHALLHGVGGELFDRNGQPVTYSAQGESYCGGTCVGGSAQIAPKLAALNWQPVFQRSHP
FT                   TSEPYGLVKLEPGQSIENSGLLSRAQGCLLGQFAGDSLGSLVEFETVETIRVHYPDGVK
FT                   FLEDGGTWSTIAGQPTDDSELALMLARSLIKSGHFDLTAIAQSYAYWYNSHPFDMGNAI
FT                   GQALSGISHAIDFGTDPVEAARQHSNQDSQANGALMRISPLAIFGHATAEETLAEWARA
FT                   DARLSHPHPVCQDANAVFVIAIRYALRTGATPAEVYQYARTWAESTGIHADICQTLNDA
FT                   AQHPPLNYQRQMGWVRIALQNAFYQLLHTDSFSAGVINSVMQGGDTDTNGAIAGALLGA
FT                   VYGYSAVPLQWRDRILSCRPLQGLPNVYKPRPKPFWPVDALEIAEVLLNALKRKNT"
FT                   /protein_id="YP_002478318.1"
FT   misc_feature    83121..83813
FT                   /note="FIG, FBPase/IMPase/glpX-like domain. A superfamily
FT                   of metal-dependent phosphatases with various substrates.
FT                   Fructose-1,6-bisphospatase (both the major and the
FT                   glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
FT                   to fructose-6-phosphate in...; Region: FIG; cl00289"
FT                   /db_xref="CDD:185885"
FT                   /locus_tag="Cyan7425_5360"
FT   misc_feature    order(83223..83225,83292..83297,83352..83366,83736..83738)
FT                   /note="active site"
FT                   /db_xref="CDD:73280"
FT                   /locus_tag="Cyan7425_5360"
FT   misc_feature    84003..84842
FT                   /note="ADP-ribosylglycohydrolase; Region: ADP_ribosyl_GH;
FT                   cl00614"
FT                   /db_xref="CDD:153890"
FT                   /locus_tag="Cyan7425_5360"
FT   gene            85028..85675
FT                   /db_xref="GeneID:7280322"
FT                   /locus_tag="Cyan7425_5361"
FT   CDS_pept        85028..85675
FT                   /locus_tag="Cyan7425_5361"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: SSN2; similar to S. cerevisiae SSN2 (YDR443C)
FT                   RNA   polymerase II transcription factor"
FT                   /db_xref="GI:219883157"
FT                   /db_xref="GeneID:7280322"
FT                   /translation="MSGLIVLVPYSGGQDFYGEPNTYLYDSDEDEIDENGQDGDEEEFD
FT                   KNDEDGDENKIAYLPIYVATEDEDLALMAVAYNACVSCNYVAQPSTRETEEAWQWRNYP
FT                   GTLESPGVELPFTEEAYIIPEPGDCFCCGSLDDYLVLSLDAMAEDLQESPGDFVLKSSP
FT                   FFDSKSIQEEFNYWIEKYIVSLPKFLSKEEDKPEDLIICKNRIVALPAGWQG"
FT                   /protein_id="YP_002478319.1"
FT   gene            85768..86244
FT                   /db_xref="GeneID:7280323"
FT                   /locus_tag="Cyan7425_5362"
FT   CDS_pept        85768..86244
FT                   /locus_tag="Cyan7425_5362"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883158"
FT                   /db_xref="GeneID:7280323"
FT                   /translation="MSNQLPEMSRKHNKVVPDNVKVNDLMAFTYYGTIKSIQKDGKQLI
FT                   VSGLDSGMSDFSIEGEELITNAHSADQYTEEEKVSKTKAAEILITSVNRPFTVCFKKKD
FT                   GSERILRGRLVEPEPLLGRSHVEDLDIKDGDRLRQVDHRTLIYLIVDGVKYIVK"
FT                   /protein_id="YP_002478320.1"
FT   gene            86300..88738
FT                   /db_xref="GeneID:7280324"
FT                   /locus_tag="Cyan7425_5363"
FT   CDS_pept        86300..88738
FT                   /locus_tag="Cyan7425_5363"
FT                   /gene_family="HOG000069548" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /codon_start="1"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /transl_table="11"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: cyb:CYB_1530 exonuclease family
FT                   protein"
FT                   /db_xref="GI:219883159"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="GeneID:7280324"
FT                   /translation="MTDRSDFIVVDTEGSSELSEISILDSQGTLIYEAFSEGHPSNQTI
FT                   RLNLKPLPDIIHDFIEIARNRPIVCHHANHDNEVLKYSFARAGYTWRDFSFVCTWELSK
FT                   QFFPNAAGYSLEFLCKHLSLKVRGQRFNPAQAHTARYDAEFTHQLYLKILEQQQSQVMQ
FT                   SQLSQTPNPFGSSRVDTPFQEHLDLQEVYHSEFESLKSIIGDIKNDPNHQSKGAVVIGE
FT                   AGSGKTHLMMRLARELLRSNRLLFIRHPNHADSVLYHTYARILESFAEKVPGSDRTQLE
FT                   LLIARSFIKILSSQANVTTTQKGQEILAALENDQLSLYNRLGIEGTDKHRNTWQYIDRQ
FT                   INLWWTGQYTAAGYGAAILKGIIKFCSYNSPRYKELVRRWLAGNELEAEETQLIGLPNW
FT                   QEDLSREEFALAAIAVFGRLSTLDEPLLIIFDQLESLGLAHNEPILASFGSAVKELLTH
FT                   VPNSLFILNLFPDRWQQFQGYFDGSVIDRVSQYTIYLNRPPADKLQRILSFKAASVGLN
FT                   LEQLFSPAELNDILSQPSIRAILNRASAYFRAKATGHPLSPSPQPAGPSLEERVQQLET
FT                   VLQQIASLIVPILNSSPSSALTLEPPSTQQPPGTSLEPLQPGSPFIALPLHSELESYLQ
FT                   QQQAALAEAYNRPTVLSDADDIGKLATIAEAFKTITALEIDQLRLGRTKLPEHLWLKTS
FT                   RQGLAIAFLQIHGSTFTARIKNFNQLVLANPTIEFQLLRDAREPQVTGPVGKQEIQKLN
FT                   HTPNGKFVILEADDRIKFELIYKLITDIEEKDLDIDLKQALLYLRSYLKNYWLISFFSE
FT                   "
FT                   /protein_id="YP_002478321.1"
FT   misc_feature    <86450..86752
FT                   /note="DEDDh 3'-5' exonuclease domain family; Region:
FT                   DEDDh; cd06127"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    order(86510..86515,86519..86527,86708..86710,86723..86725)
FT                   /note="active site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    order(86510..86515,86519..86524,86708..86710,86723..86725)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    order(86525..86527,86708..86710,86723..86725)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    86927..>87025
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    86960..86983
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5363"
FT   misc_feature    86963..86986
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5363"
FT   gene            88825..89760
FT                   /db_xref="GeneID:7280325"
FT                   /locus_tag="Cyan7425_5364"
FT   CDS_pept        88825..89760
FT                   /locus_tag="Cyan7425_5364"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SYNPCC7002_E0029"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_E0029 hypothetical protein"
FT                   /db_xref="GI:219883160"
FT                   /db_xref="GeneID:7280325"
FT                   /translation="MTFTADTRGIHTPVAIGQILHRHVGQPFHDRANSHRLNHAWVQQV
FT                   KNQHSSYHRKTLLEQGTADFTRTTYGLTPDDKALLYSYYYLQRHLASGIFVLQSWERQM
FT                   DQSLPWFNRHSAIIDLGCGPMTFGLALRAHQLLKGRGLQGMQYIGIDRAESMIRKASAI
FT                   ATDLQQCSSAPTFLFEQNFQEIHSHLRRLDGVVQSRGTGWLVFSSSYLFASPTLDVSSL
FT                   FEEIHNVLQRHPDHNWCFIQQNPPVSYLNHKWHQFCNLLDQHYPDFRTQASEISIPYAE
FT                   YSLEPETIGQLVPKTSIKLSYEILTREVTP"
FT                   /protein_id="YP_002478322.1"
FT   gene            89757..90371
FT                   /db_xref="GeneID:7280326"
FT                   /locus_tag="Cyan7425_5365"
FT   CDS_pept        89757..90371
FT                   /locus_tag="Cyan7425_5365"
FT                   /gene_family="HOG000265301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /codon_start="1"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG:
FT                   syp:SYNPCC7002_F0040 2OG-Fe(II) oxygenase family
FT                   oxidoreductase"
FT                   /db_xref="GI:219883161"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="GeneID:7280326"
FT                   /translation="MTAYTQLNLLDLPPLPEGKPLSSVPGLRYIPNFINPAVEKTLLEE
FT                   IDQQPWITDLKRRVQHYGYRYDYKARAISPEAYLGTLPEWLKPLTNRLWQEGYIPDLPD
FT                   QVIVNEYIPGQGITAHIDCIDCFSDTILSLSLGSDCIMRFTAPSHTTEDLVLERRSLVV
FT                   LQGDARYQWQHSIPARKSDLIKGQKQARSRRISLTFRKVMV"
FT                   /protein_id="YP_002478323.1"
FT   misc_feature    89781..90305
FT                   /note="2OG-Fe(II) oxygenase superfamily; Region:
FT                   2OG-FeII_Oxy; cl01206"
FT                   /db_xref="CDD:186384"
FT                   /locus_tag="Cyan7425_5365"
FT   gene            90584..92725
FT                   /db_xref="GeneID:7280327"
FT                   /locus_tag="Cyan7425_5366"
FT   CDS_pept        90584..92725
FT                   /locus_tag="Cyan7425_5366"
FT                   /gene_family="HOG000054997" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Synpcc7942_2278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syf:Synpcc7942_2278 hypothetical protein"
FT                   /db_xref="GI:219883162"
FT                   /db_xref="GeneID:7280327"
FT                   /translation="MTICHLLVGPPSSGKTTFARHFQEILPGAVIINTDRIRAELFGDE
FT                   EIQGPWPAVEAIVVERIRSAVQAGKPVIYDATNVRRCWRMGLLKKLALPEAQWVAWVLK
FT                   TPLETSLQWNQQRDRKVPEKIIQDYYQNLKQFAVEPAEGFLTTIEVDPSKTTDLAATLQ
FT                   QELKKIESSHRNHKNRYKHFELHRYSRLLDFDRLMHLISLLGRYPGLGELHEQEPLELL
FT                   KLLNAEHLPTFLEPIDEIAAIMQAQHGWIYADPEALARDLMWLEDNGFLGKEVSAQELH
FT                   IPPLEGEPDFLCHTYSDRDAFQRLMGTIHYIINNPLSQKLENDDPKNDEDETGPNSEKG
FT                   KQHRTTLKQVNQLAEQLQNAKIVLVDPLPMLRKDIEWVLNPYRILPDYKLRKGYFLGTG
FT                   ILNRTDLLCIYDIARKHVQGLDDVQAKKTVAEFEQRLRWAQIDPGKHYPVRSISSSSIV
FT                   DPQLLGNEAFITEHQSNELETDIRQGNLVQICRRKGVASYGDRPPSENVWPLQILFHNI
FT                   GWYLGYEVADGERQGLFCFERLDRLYRGDGPTKKRKVQAQWQALAQLETLCKHSFGIFF
FT                   GHDVTQQKCFLAATSRERQKLMEPLQLRFTETLFSFVSEGTQKFPRTQVQMTPPKNRDI
FT                   HHLDKNTREGLYGLKLDQNFPSHPYCMKIKLPIWSFEDVTLKAWILGMGPGVRVVGPER
FT                   FKTWVSHELTAAAELYRST"
FT                   /protein_id="YP_002478324.1"
FT   misc_feature    90584..91087
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_5366"
FT   gene            92829..93965
FT                   /db_xref="GeneID:7280328"
FT                   /locus_tag="Cyan7425_5367"
FT   CDS_pept        92829..93965
FT                   /locus_tag="Cyan7425_5367"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sma:SAV_5243 secreted protein"
FT                   /db_xref="GI:219883163"
FT                   /db_xref="GeneID:7280328"
FT                   /translation="MTNAAPAQVLDQLRGNLPPQSLNVRSLAQFSEISNCNVAGLGMAA
FT                   GVNFSTLLKGTPFTRTYTQSPFAFMRGNQFEKRLTDNNCQSLLSLCQQHLNFLPQDNQV
FT                   IDLRAQFPSSYQSLWPRAQRTRQLVQQILQGQSQAPNLIIGAVFAYSLGGQNVYFEADL
FT                   LGANHQQILRPIEVKSFPILDERAIDPRSLGAAFDQAAVYILMVRELVSSLGGNLSLVP
FT                   GEAVLINPFNATSQPHLSCQSITQRINQAQQRLNQVQNLSPILSNLPANLSFATIADRQ
FT                   RPIQDRLQTLDTLTQQVGTCYTPSCQRACGLANYCRHHAHNQGLTTVSGQVVQHQLPGV
FT                   TTLNRAAALAGGALPNTQEQAIASQLQRAEQLYNQLSA"
FT                   /protein_id="YP_002478325.1"
FT   gene            93977..95326
FT                   /db_xref="GeneID:7280329"
FT                   /locus_tag="Cyan7425_5368"
FT   CDS_pept        93977..95326
FT                   /locus_tag="Cyan7425_5368"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sgr:SGR_4722 hypothetical protein"
FT                   /db_xref="GI:219883164"
FT                   /db_xref="GeneID:7280329"
FT                   /translation="MTLLGYFAARSHSLGQAVPTAKYRHRHLCPKPLMLVGWTLGSDPF
FT                   SVSALAWGHHPDDFRFAVAGDPRDFDLEVDLLRTLAQDFNPWFESFKERGEAPQVIVAN
FT                   RATIEVLWRLGRRFAYLEGRIDDAVVRLARYLQLLTHHADFPGQQLIVSLTDLINEHWA
FT                   IELSGEESQSLPVLDAYLNPPPGSTGFAVVESLEQSQLHTIGPHPTSLEDDPLQTLLEQ
FT                   FKQVRQQAPTSLALAPIAAHYRPLLERTWELNWRCFHREHQRPPARYVDRRWQEDLRYY
FT                   RQQAQHLMDGGRMRTRPTVKAAASDLNKRESALQQLVTEQALSDPLRMLPHLLKHEAVL
FT                   GLVESLDLTYIPAGQNKRQPRLVLISPEPCLIPIGTALWWTEAPTGLPWLLDEILTTAP
FT                   GLPHRLVLLHQNNQSTFRRPTPGQTACFSVLTHRSPYQMQLPPQTPWTHC"
FT                   /protein_id="YP_002478326.1"
FT   gene            95349..96713
FT                   /db_xref="GeneID:7280330"
FT                   /locus_tag="Cyan7425_5369"
FT   CDS_pept        95349..96713
FT                   /locus_tag="Cyan7425_5369"
FT                   /gene_family="HOG000053727" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SCO2810"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO2810 hypothetical protein"
FT                   /db_xref="GI:219883165"
FT                   /db_xref="GeneID:7280330"
FT                   /translation="MTNLTAYNQTAYNQIACQQADQVIHSVCGALLGSLSHQQADVLKA
FT                   PAGAGKSYAVCTVVQQIMQMDARVAVVTPTNEQAFSLVANLADRLPGQNIGYLPASSVQ
FT                   LPAWAHRPNVRVLDANHANSVNILVGTLNKLGDAHCRGKLQRFDLLVMDEAYQADSIRY
FT                   FAVADLADRHLLVGDPGQLDPFTTLPDPDRWRGWQEDPLQTAVGALLRYHPQTPVYQLP
FT                   ITRRLDPRAISLVQSFYPGHPFQAAVQTGIRSLQLQPALHSTIVDMALDHGCQHGWAYL
FT                   ELPAANVLPADPETIQLISTLADRLLQRQPTVFCEQVPHGRPLRATDIAIAVSHNDQKN
FT                   HLRYQLQSLGLADVIVDTANKLQGRTFEVVIAWHPLAGLVEADNFHLEAGRLCVMLTRH
FT                   RQACFVVGRSGDRHLLSGPPPAAPAYLNYDQEPLLDGWQLHQAIFNHLIPHQIIV"
FT                   /protein_id="YP_002478327.1"
FT   misc_feature    95472..>95813
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5369"
FT   misc_feature    95490..95504
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5369"
FT   misc_feature    <95574..96581
FT                   /note="Superfamily I DNA and RNA helicases and helicase
FT                   subunits [DNA replication, recombination, and repair];
FT                   Region: COG1112"
FT                   /db_xref="CDD:31309"
FT                   /locus_tag="Cyan7425_5369"
FT   misc_feature    95805..95813
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cyan7425_5369"
FT   gene            96903..97121
FT                   /db_xref="GeneID:7280331"
FT                   /locus_tag="Cyan7425_5370"
FT   CDS_pept        96903..97121
FT                   /locus_tag="Cyan7425_5370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883166"
FT                   /db_xref="GeneID:7280331"
FT                   /translation="MEMCQPQMFPNQYRSFPYLIGTPIEWKLVNQTIIVVREFGLYLLG
FT                   KPIEWKLKMPAAIAPEHIKSLLVRETN"
FT                   /protein_id="YP_002478328.1"
FT   gene            complement(97284..98084)
FT                   /db_xref="GeneID:7280332"
FT                   /locus_tag="Cyan7425_5371"
FT   CDS_pept        complement(97284..98084)
FT                   /locus_tag="Cyan7425_5371"
FT                   /gene_family="HOG000254171" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   amr:AM1_1358 IS4 family transposase"
FT                   /db_xref="GI:219883167"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7280332"
FT                   /translation="MIRQSYDTDLTDEQWELLKPLIPPPRPGGRPRCLDIREVLNGIFY
FT                   LLSNGIKWRSMPHDFPNWHSIYTYFRAWEADGTWKRLNQTLRTEVRVAAGRKAQPSAGS
FT                   VDSQSVKTARGGEDIGFDGGKKVKGRKRTILVDTMGLLLGVCVHSAKRSDHQGMVLLAT
FT                   FWAAFWSCLKVIWVDSTFAGKNFIATIAQHFGWSLEHLKPTKTEPGFQVIPKRWVVERT
FT                   YAWFGHYRRLSKDYEFLTTTSEMMLFAAMVHLMVRRLKPKNQAR"
FT                   /protein_id="YP_002478329.1"
FT   misc_feature    complement(97704..98072)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Cyan7425_5371"
FT   misc_feature    complement(97317..97796)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Cyan7425_5371"
FT   gene            99305..100363
FT                   /db_xref="GeneID:7280333"
FT                   /locus_tag="Cyan7425_5372"
FT   CDS_pept        99305..100363
FT                   /locus_tag="Cyan7425_5372"
FT                   /gene_family="HOG000254527" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /codon_start="1"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   har:HEAR0422 hypothetical protein"
FT                   /db_xref="GI:219883168"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="GeneID:7280333"
FT                   /translation="MAKSFRIATFNVENLLHPGVFFAGRPNDRPYQPELYKEKIDWIVR
FT                   ILKEGNVDLVGLQELFSETALKDIAEQAGFPHSYAPDLLNGANIATREDGKQEARGPFV
FT                   GLLSKFPIVDRKSIVDFPGETKGIEIEAGESTTEVKKLPIIRFLRPVIQANVQLNSDVI
FT                   ATVFVAHLKSKNPQFLDSEDGRRNDPIVKAAGKTRSLIIRAAESVALRKMVVDATQNNN
FT                   QPVLLFGDLNDDLPAVTTEIIVGDEPYRFAKPEDKKIEWDRLLYSVHDLEEQESYRNVS
FT                   YTHIFNGRYELLDHIFVSQEFFHRNPESIAVVRSTRIFNDHLQDERRVVNPDRGLSSRS
FT                   DHGIPVTEIEWR"
FT                   /protein_id="YP_002478330.1"
FT   misc_feature    99317..100270
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:186031"
FT                   /locus_tag="Cyan7425_5372"
FT   gene            100700..100939
FT                   /db_xref="GeneID:7280334"
FT                   /locus_tag="Cyan7425_5373"
FT   CDS_pept        100700..100939
FT                   /locus_tag="Cyan7425_5373"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_1109"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_1109 hypothetical protein"
FT                   /db_xref="GI:219883169"
FT                   /db_xref="GeneID:7280334"
FT                   /translation="MSMICCLYSIAASTANELLNDPEQMEVLLDQMEEDNSDLILSLEK
FT                   SWHGLHYVLTGSAEDGEAPLNFILHGREVGEDLG"
FT                   /protein_id="YP_002478331.1"
FT   misc_feature    100700..>100936
FT                   /note="Domain of unknown function (DUF1877); Region:
FT                   DUF1877; pfam08974"
FT                   /db_xref="CDD:149898"
FT                   /locus_tag="Cyan7425_5373"
FT   gene            100958..101188
FT                   /db_xref="GeneID:7280335"
FT                   /locus_tag="Cyan7425_5374"
FT   CDS_pept        100958..101188
FT                   /locus_tag="Cyan7425_5374"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_1109"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_1109 hypothetical protein"
FT                   /db_xref="GI:219883170"
FT                   /db_xref="GeneID:7280335"
FT                   /translation="MPEEVQQIDNILTAWTETDFLQRFDPVTMDRAELYPGIWDEPVDE
FT                   LQEEYLAYFKEMKDFIQQAAKQQQAIVVTIV"
FT                   /protein_id="YP_002478332.1"
FT   misc_feature    <100961..101137
FT                   /note="Domain of unknown function (DUF1877); Region:
FT                   DUF1877; pfam08974"
FT                   /db_xref="CDD:149898"
FT                   /locus_tag="Cyan7425_5374"
FT   gene            complement(101192..101587)
FT                   /db_xref="GeneID:7280336"
FT                   /locus_tag="Cyan7425_5375"
FT   CDS_pept        complement(101192..101587)
FT                   /locus_tag="Cyan7425_5375"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:219883171"
FT                   /db_xref="GeneID:7280336"
FT                   /translation="MKLDELKSKAYALSGTSNVRQLKDKYEDIRALDMRRKSSWEAAIV
FT                   IIEKHQQEFQDWLANPPDEYKELFAEIDGVTKAYSEKVSEIEEISSELLAIGDELEAMA
FT                   EDYEDQADQLIENLQLTRQVARQAELN"
FT                   /protein_id="YP_002478333.1"
FT   gene            complement(101599..102330)
FT                   /db_xref="GeneID:7280337"
FT                   /locus_tag="Cyan7425_5376"
FT   CDS_pept        complement(101599..102330)
FT                   /locus_tag="Cyan7425_5376"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: viral A-type inclusion protein, putative"
FT                   /db_xref="GI:219883172"
FT                   /db_xref="GeneID:7280337"
FT                   /translation="MGNNKDLFDYWFNKVEIFNIELVKSAEHLPTQQLRHECTNYDQLR
FT                   FSQEVQALEAEEKDKVIVIIKYQCTARVLQVRAGYFREKASYLKEKSNQYKTEKEEINQ
FT                   QRSKLLKLIKELQEKLFGNGKVIKELETRIALVEAENEALRADADKANAYTELLKEFGE
FT                   LEKKYADLQKHREKLAKKNQSLGGRVAHTMRFQEQRDLARATVKEQSKQIATLEKENVK
FT                   LKAENEKLRQQVEKLKQKSIK"
FT                   /protein_id="YP_002478334.1"
FT   misc_feature    complement(<101614..>101718)
FT                   /note="Septum formation initiator; Region: DivIC; cl11433"
FT                   /db_xref="CDD:187037"
FT                   /locus_tag="Cyan7425_5376"
FT   gene            102630..103694
FT                   /db_xref="GeneID:7280338"
FT                   /locus_tag="Cyan7425_5377"
FT   CDS_pept        102630..103694
FT                   /locus_tag="Cyan7425_5377"
FT                   /gene_family="HOG000023001" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   amr:AM1_A0076 transposase, putative"
FT                   /db_xref="GI:219883173"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7280338"
FT                   /translation="MNQHKRLVALLKPHLGWHGARLNFLALFLLALVRVKTVNLSALAV
FT                   GLSGQVEKDSNYKRLQRFFRLFEMDYTVVAHAVVALMRIPQPWVLSLDRTEWEFGSHHY
FT                   NILMLGIVHEGVAFPVVWTMLDKQGNSNTEERIDLLERLTRIFPHAEITYLTGDREFIG
FT                   QVWVSYLRLSPAVPFRLRLRCSDRIAREAESLKASVLFAHLPVGESQVLKGRCRVWGYE
FT                   VGVAALRLQDGELLVVIGPQAQEESLIADYAARWGIETLFGILKTRGFCLESTHFTEAQ
FT                   RLSKLLALLALALCWTMLTGLWLHQHKPLSIKKHDRRAKSLFRYGFDHLRHIILHLDSQ
FT                   TSQFFEVLQLLSCT"
FT                   /protein_id="YP_002478335.1"
FT   gene            complement(103971..104480)
FT                   /db_xref="GeneID:7280339"
FT                   /locus_tag="Cyan7425_5378"
FT   CDS_pept        complement(103971..104480)
FT                   /locus_tag="Cyan7425_5378"
FT                   /gene_family="HOG000088150" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG:."
FT                   /db_xref="GI:219883174"
FT                   /db_xref="GeneID:7280339"
FT                   /translation="MTLNKANRLLQQLKNRRTLRHIDYLATQTTFKLEVRLSDCNNNLK
FT                   ATLEDQQQRRQQSLDQRIQICEDYYLLKEALFAANQRSGVSQRLSEVEKCRELLNLYQS
FT                   IRGSFSSGSTVPLRVEDIDPEQLREDLKHMDGITELAIQVVGIEEIGQQMQDLTARIDR
FT                   RMRLPT"
FT                   /protein_id="YP_002478336.1"
FT   gene            complement(104483..105070)
FT                   /db_xref="GeneID:7280340"
FT                   /locus_tag="Cyan7425_5379"
FT   CDS_pept        complement(104483..105070)
FT                   /locus_tag="Cyan7425_5379"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883175"
FT                   /db_xref="GeneID:7280340"
FT                   /translation="MPVFLICREQNTNRVLQEAVALITITCDRHPTQVPLPIEHWQRWS
FT                   CDRWFGIEYCPFSWYWQTVAPKERVCECLQFIENRINRYGYDSGFAIYSCDQGICAATL
FT                   ALVLYAYWLRSPEAAIQGVLQQWPDLPLSFEPDWLLLRSLPKGRFKPRWVYAIESYFEQ
FT                   RYRDNERLETRKSNLRLTKIEDFDLDDWDGDL"
FT                   /protein_id="YP_002478337.1"
FT   gene            complement(105106..106176)
FT                   /db_xref="GeneID:7280341"
FT                   /locus_tag="Cyan7425_5380"
FT   CDS_pept        complement(105106..106176)
FT                   /locus_tag="Cyan7425_5380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF88"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   cyb:CYB_1055 hypothetical protein"
FT                   /db_xref="GI:219883176"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="GeneID:7280341"
FT                   /translation="MAGQQDNLTLKSKSKGLQVQQGWVVATAIVGVVAGSVFQQALYSS
FT                   VPLGLSVLMAEANRRRSEERIERTLGAHQQVAGQMGEEMQDLQESIVALQEEIAKPAQI
FT                   QASPLTRQHLLPVTQQIHKLQKKYKQLELVELEGQRQELAQMKLRLQAMAETVAGLKQH
FT                   SNEGKGGGGSVKTMRVDQTRQNNHLAILVDAANIYHCGNELGVKVNYDQLIPGLQAGFE
FT                   SSQVWFYTGLKSGDFRQQRFLASLRQQGYQVVTKRVVRHEDGKEKANLDVELALEMVKL
FT                   AERYSDILLLSGDGDLACAVRAARQKGARVEVISFRSRTSQDLIRAADDFRDLTDMVDR
FT                   RVVKVDSQTRCIKLVS"
FT                   /protein_id="YP_002478338.1"
FT   misc_feature    complement(105175..105615)
FT                   /note="LabA_like proteins. A well conserved group of
FT                   bacterial proteins with no defined function. LabA, a member
FT                   from Synechococcus elongatus PCC 7942, has been shown to
FT                   play a role in cyanobacterial circadian timing. It is
FT                   required for negative feedback...; Region: LabA_like;
FT                   cd06167"
FT                   /db_xref="CDD:100118"
FT                   /locus_tag="Cyan7425_5380"
FT   misc_feature    complement(order(105289..105291,105295..105297,
FT                   105301..105303,105364..105366,105589..105591,
FT                   105598..105600))
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:100118"
FT                   /locus_tag="Cyan7425_5380"
FT   gene            complement(106267..106422)
FT                   /db_xref="GeneID:7280342"
FT                   /locus_tag="Cyan7425_5381"
FT   CDS_pept        complement(106267..106422)
FT                   /locus_tag="Cyan7425_5381"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MCA2959"
FT                   /codon_start="1"
FT                   /product="prophage MuMc02, S24 family peptidase"
FT                   /transl_table="11"
FT                   /note="KEGG: mca:MCA2959 prophage MuMc02, S24 family
FT                   peptidase"
FT                   /db_xref="GI:219883177"
FT                   /db_xref="GeneID:7280342"
FT                   /translation="MVKRLQRQPKGIIRVTSDDPAYDPFLVNLADESTDFAVLGRVVWI
FT                   GHKLGA"
FT                   /protein_id="YP_002478339.1"
FT   misc_feature    complement(106303..>106422)
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Cyan7425_5381"
FT   misc_feature    complement(106414..106416)
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Cyan7425_5381"
FT   gene            complement(106559..106780)
FT                   /db_xref="GeneID:7280343"
FT                   /locus_tag="Cyan7425_5382"
FT   CDS_pept        complement(106559..106780)
FT                   /locus_tag="Cyan7425_5382"
FT                   /gene_family="HOG000023327" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_A0012"
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_A0012 hypothetical protein"
FT                   /db_xref="GI:219883178"
FT                   /db_xref="GeneID:7280343"
FT                   /translation="MQNRVKELVTSRGITPYRFWKDVGCSRDVAYRLVKDPSYIPRENV
FT                   LEGICRAYGVQPGDVLIYIPDSDNVTAS"
FT                   /protein_id="YP_002478340.1"
FT   misc_feature    complement(106574..>106645)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Cyan7425_5382"
FT   gene            106981..107202
FT                   /db_xref="GeneID:7280344"
FT                   /locus_tag="Cyan7425_5383"
FT   CDS_pept        106981..107202
FT                   /locus_tag="Cyan7425_5383"
FT                   /gene_family="HOG000087996" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883179"
FT                   /db_xref="GeneID:7280344"
FT                   /translation="MSTPINLDNCAADLENLAYEICQYLQMKDICDEQEQVNRQFAIVL
FT                   RNLKNTSIIYTDVVAQAMAAKPVLPIVA"
FT                   /protein_id="YP_002478341.1"
FT   gene            107303..107464
FT                   /db_xref="GeneID:7280345"
FT                   /locus_tag="Cyan7425_5384"
FT   CDS_pept        107303..107464
FT                   /locus_tag="Cyan7425_5384"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_A0346"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_A0346 hypothetical protein"
FT                   /db_xref="GI:219883180"
FT                   /db_xref="GeneID:7280345"
FT                   /translation="MQFSLPCAYGLLNAITRTAQDVSSYDRATELEAIGSKVLSLPQSV
FT                   WHEIALAR"
FT                   /protein_id="YP_002478342.1"
FT   gene            107545..107703
FT                   /db_xref="GeneID:7280346"
FT                   /locus_tag="Cyan7425_5385"
FT   CDS_pept        107545..107703
FT                   /locus_tag="Cyan7425_5385"
FT                   /gene_family="HOG000087998" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883181"
FT                   /db_xref="GeneID:7280346"
FT                   /translation="MDNEVYDLHLPNCWNAVQSALYQLQQGNPDRAKVFLEAAQRSLIK
FT                   VRERAPR"
FT                   /protein_id="YP_002478343.1"
FT   gene            complement(107897..108217)
FT                   /db_xref="GeneID:7280347"
FT                   /locus_tag="Cyan7425_5386"
FT   CDS_pept        complement(107897..108217)
FT                   /locus_tag="Cyan7425_5386"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:cce_5006"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_5006 hypothetical protein"
FT                   /db_xref="GI:219883182"
FT                   /db_xref="GeneID:7280347"
FT                   /translation="MLLVKEEKRLQEFRQQQQKTYQETLAQARREQESRQQVFEEQLRQ
FT                   RRLLRLEALLILGSIAVVASVFFIGLGLGLIAGANIPEGAVCHHSNFLCQGMRFRQPKS
FT                   FF"
FT                   /protein_id="YP_002478344.1"
FT   gene            complement(108244..108825)
FT                   /db_xref="GeneID:7280348"
FT                   /locus_tag="Cyan7425_5387"
FT   CDS_pept        complement(108244..108825)
FT                   /locus_tag="Cyan7425_5387"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_5007 hypothetical protein"
FT                   /db_xref="GI:219883183"
FT                   /db_xref="GeneID:7280348"
FT                   /translation="MSTTNIHQSFKDIAHRFSVSEEQIGPILERIKIKTAEVPSEEQLK
FT                   GFEKVCTMLKSGMPLDQAVQSLHEEAKTHKTQGTKAAPSPSPTEAALAQTNQAAIATLG
FT                   QDVPQGVKAGLDSISAEAAQLTLKQLPQLIAQTTNTNEQHLTEGVVGFVTASYQDHIAK
FT                   GLQDPQFLEAVRQAMAAGKSRNTSATKSPS"
FT                   /protein_id="YP_002478345.1"
FT   gene            complement(108828..109235)
FT                   /db_xref="GeneID:7280349"
FT                   /locus_tag="Cyan7425_5388"
FT   CDS_pept        complement(108828..109235)
FT                   /locus_tag="Cyan7425_5388"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_5008 hypothetical protein"
FT                   /db_xref="GI:219883184"
FT                   /db_xref="GeneID:7280349"
FT                   /translation="MAKPRKIPKSFRVVQHHPPHPHHTIAAAESYLFSGEVSPLTACQT
FT                   AYSCLFGPLGIALTGGSAAEVESAIAISRSQFEIFMALAQGRCQVNTVDDPQFGRSPAA
FT                   PPENHLKPVPSLAKGNWIEEDEMLDLENERL"
FT                   /protein_id="YP_002478346.1"
FT   gene            complement(109228..110451)
FT                   /db_xref="GeneID:7280350"
FT                   /locus_tag="Cyan7425_5389"
FT   CDS_pept        complement(109228..110451)
FT                   /locus_tag="Cyan7425_5389"
FT                   /gene_family="HOG000054808" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:cce_5009"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_5009 hypothetical protein"
FT                   /db_xref="GI:219883185"
FT                   /db_xref="GeneID:7280350"
FT                   /translation="MSDANGLLIEEPVERLDRGRGHGVTANVLTWTGAVDVGTSGTKSC
FT                   FFGESPEYPFRTLERFFLVAPHVRALTASSYNEALEEMDDRQGGLAATFISFAHPESGE
FT                   RVFWELGETAARPGLLPVECRKFESCLAKVLGLLGYLVTQELQTTDRIALHLGVLLPLN
FT                   ELDDRHLLSRWLRQTIGDFQFNGVSLRNLSLSSFDCKPEGYGLFRAYGAERVLLVGHRD
FT                   STWLCFNGGKLNTKLSRTLPETGMHDFIRSIRFPMTHELLAAQALSLSGRKLKPKPLLE
FT                   LTQTRTAAELEQLQQAIRQAQAQYWMERRSQFNTLSWQEGQVVPVSGGAAHYFSEELNQ
FT                   LFHKTFRVQLHWCEDLHQEFRNRFNVDEENEALLYRFADPYAYARSLPGVERYAVKAVD
FT                   VIEGGTHG"
FT                   /protein_id="YP_002478347.1"
FT   gene            110909..115906
FT                   /db_xref="GeneID:7280351"
FT                   /locus_tag="Cyan7425_5390"
FT   CDS_pept        110909..115906
FT                   /locus_tag="Cyan7425_5390"
FT                   /gene_family="HOG000023080" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02686"
FT                   /codon_start="1"
FT                   /product="conjugative relaxase domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_F0157 hypothetical protein; TIGRFAM:
FT                   conjugative relaxase domain protein; PFAM: TrwC relaxase;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:219883186"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="GeneID:7280351"
FT                   /translation="MRSLHTITSGHQEKEDYYTQDESLCDGQADYYGQSAQSTTESSVQ
FT                   SLTQALWYGKGAARLGLVGIVQRQDFQSVFYGDQPGGQERIRGERPNPDTKERLAHDLT
FT                   LSAPKSVSMTLHLGGDERLFQAHLEAVQETLDLVESRYAQTRVQIDGERRVMRTGHLIA
FT                   AILPHHTSREGDLQLHCHCVLMNGTFCPDGNWRSLWHEGMVNAEWLGSYYRLRLAQKVQ
FT                   DLGYAIDETRLEQGGAFEIQGYSREAIEAFSKRSRQIVAYLEQHRQCVNSATRDGAVLT
FT                   TRKAKQMEGTLEDYQARWRLEANVLGINAVLPQAQPVTLYGYGTAREELASAIRHLSER
FT                   SVSFSREDLYSSVFDRIQAFDIAQLDAVIAEQKDLIPVQGGRFTTVTALEREITTLRDW
FT                   MQGQGKTTPLMDETTAQALLERSALNSGQATAIAGIVSAGDQHLILHGLSGVGKTTALR
FT                   ELKRLIQESDSKPDIRGYSPTIAAAATLAQSLQISTSTVESLVLKPPEPLADQLWIIDE
FT                   AGMISARQMAIILKKANAVGARLLLVGDPRQNPAIEAGSPMRSLIQHGATTFSLREIIR
FT                   QQNAVQRRAVELMATGHPVHALSLLTEHGYVQEISDPQARSQAIAHQWLTLSDSERQNT
FT                   LIVTGTNAERRAIHQQLRRGLRDEEGLGEDQLFRQLINRQLTTEQKLRWENYRVGDYIR
FT                   LHRNYESTLLGKGRLYQVVGIRDRQLLVESEGGRLLWFDPARYRDKEVFKTGEIAIAPG
FT                   EQLRWTLTDRKTGQINGSQVSVREINDDHLTVVDDQGQEWRINGRLPLTLDYAHVTTAY
FT                   SAQGLTAERVIVSATNNPTSAQEPFYVKISRQVRELQIYVEDLEGLREWVGRSVAQMNP
FT                   LELIGGHDVKRERQFGATGAHDEPEAGQPDRPEQNLSGGEHSLKVDAGLEPQYRPPHHA
FT                   TGTSDVSRPVPRGSGEAEAFGDVRCDSSTGFGSEGIEGPDRPFSIDRYPDQLVPQPDPS
FT                   RNQCVNPLLIQQRFDQIAQQMGAVFPGNPETSLNATFGQSHYRGLAEFAQELEYLGEED
FT                   LCQTLQDITHALVEVERCLERSLQQVKLDTITDALQSWRSEQALSEAIAQIATVQAQAE
FT                   EPDSLILGTVLQEVRKLPYRREEVDHLVERVEEWQAEQDLSAVLEQLGRTINELKPSFF
FT                   SPGYQAMAELAEAVGDRPAEAVIREHLQALQDATLQIQQRLLQNPGLEQLAVAVRSLRE
FT                   NPVIAEGAAAEPLQQVAEHLTAYGLNPTPPPQKLQPFWQPQYLEEPPAGFDPVHWQEFQ
FT                   RSAIHPDLIVANAESIDGWRVYERLLSEKLAEMGSGQYVTAAMAREMRRYEQVAEGGWW
FT                   GKAGIDPQSLPGLQPGEQPTLSTWGCFKPDHPRMDVSKSDRTGQPKTIKYEHPVGVQRG
FT                   LYLPIVPDSLAKRIYQKYQIQPTSTEQQSGFWFVVLHYNLPITITEGVKKTWASLSQGE
FT                   VTIGVSGVNGLYRTTDVGGHRLPQRQLHPDIAIFVTPGREFRFAYDHDTKPATVYNVQR
FT                   DRVRGIELLEARGCLCKIVQWSGDKGLDDLIAHQGANAYTRAQLQAISAEPEKQNYYRS
FT                   QYRVIARQVQQELGSLTAEQLDREVYRRAITRGDLLDGERFLRFREDEQAEISAQPVRQ
FT                   KPEIGVKTPKESTQFHQHQVQENDFEL"
FT                   /protein_id="YP_002478348.1"
FT   misc_feature    110954..111832
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="Cyan7425_5390"
FT   misc_feature    110984..>113494
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="Cyan7425_5390"
FT   misc_feature    112235..>112567
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:187234"
FT                   /locus_tag="Cyan7425_5390"
FT   gene            complement(116075..116287)
FT                   /db_xref="GeneID:7280352"
FT                   /locus_tag="Cyan7425_5391"
FT   CDS_pept        complement(116075..116287)
FT                   /locus_tag="Cyan7425_5391"
FT                   /gene_family="HOG000286909" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_3564"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_3564 hypothetical protein"
FT                   /db_xref="GI:219883187"
FT                   /db_xref="GeneID:7280352"
FT                   /translation="MQIVTSWMRDGMLQEARTLVLRQLNRKLGSLPDPERLQIEALTTP
FT                   QLETLAEDLLDFNSLSDLQAWLTQQ"
FT                   /protein_id="YP_002478349.1"
FT   gene            complement(116309..122680)
FT                   /db_xref="GeneID:7280353"
FT                   /locus_tag="Cyan7425_5392"
FT   CDS_pept        complement(116309..122680)
FT                   /locus_tag="Cyan7425_5392"
FT                   /gene_family="HOG000055015" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /codon_start="1"
FT                   /product="helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; KEGG:
FT                   syp:SYNPCC7002_F0086 putative helicase"
FT                   /db_xref="GI:219883188"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:7280353"
FT                   /translation="MMLGQEELAQFFAAQFIQGHRYRAIVEARQQVQVRLNQPVPPGSA
FT                   LAKRVDEAVEAGLVRAAREIVAQGFPPSQTYELLVDLHDRQPNLSVRSSTSVRQQAYST
FT                   VLPIAYLAATLAGIDANTTVYEPTAGHGALLLCTDPAKTTVNELNPERAADLRAQGFSV
FT                   TQYDAAEYFPQESHDVVIANPPFGRVKGEAGRARQFTLEGNRRGTAQIDQAIALQALRA
FT                   MKPDGRAVLILGGKPEKEEPDRSESYNTLESRRFFYILYQQYNVTAHFTVAGELYRKQG
FT                   AAWPIDLIVIQGRGRSSRPLPAVQPPLIYTSFITLKELLSDGQSHKPSGLSEVPAGLVT
FT                   PDGGESKPVSGQNPPGSNADDVDVLPGTDGGTGAMADRSVDDDGNRGSESDPSAIGGNA
FT                   LPAQFQRNSPGLNGGPSLGVGNGLGGSPDSEQRNLGDSLPGQHRAGISRDLTRGDILPS
FT                   HPDGVTRRSEAGSIPGRPRLRTLTNLSQQPIASTPQVPMADTSAEAQPPTPLNTAYVPR
FT                   SQGPSPGTLIPTNMAVSAQIALDRLEKERGNIDEFVMSRLGLDTKEQLWAVLYAEQIDS
FT                   LALAFDQRSKGQIFLNGDQTGNGKGRFGAANLIDARRQGYIPVFVTQKPNLYNSMLNDL
FT                   ADLGYQNIRPFLTNNDVSLVLDDGRKLKSGHQADQNEEMTRIARTGLGGYDAIFTTYSQ
FT                   MQTVRGKETLRREFLKAIAPQAIFIFDESHEAGGSTGQQGWKSGSEAGDRAAFVRELVD
FT                   SSAGAVFMSATATKDPAVMDLYARRTDAVHAVSSMNNLEQTLKAGGIPLQQMMATKFVA
FT                   SGNLLRRERSFESIAFNAKVVAVDRQIADGISAIMRAVDRFDRAKAEALKDLKEQVKAE
FT                   AKQAGEDNAIGQAGAKSANFTSLMHNAIDQGLLCQKAEATVQEAIVALQRGEKPLIAVA
FT                   STMDAFIQDYAEAQGIEPGEPIAITFADLLDRYLERSRDVVLKDYEGNQTRRPMTDAEL
FT                   GPRGMAAFLEAQAILAATDLSGIPLSSIDYIKWRLDRAGYRVDEITGRSNVIDYQPDGS
FT                   MRLGIRSARETSPQAKINIVNRFNAGDLDVVILNRSGSTGINLHASEKFVDQRPRHMIV
FT                   VQAERDINQVMQMLGRVNRFGQVVEPTFTLLMADVPAEKRLGALLSQKMASLNANTTAA
FT                   RDSNLSVSNVVDFMNAAGEEVVSELLSDNPELDALLSFPARNIQGNSGTELISRVTGRI
FT                   PLLSIEDQEALYTLIETETQSLIEQKAAMGENVLEADKLDLQARTIARMEILPDTGQVR
FT                   SEFTGPAYLEVVDARAIDKPMTQLQVINIVRETLELTPVRTVEEHDAATTTAIAQSFAE
FT                   RRLSELKQAVEVYRSDVLSRLVEPESRSKLNLHLERQTEQLTTLLNQFPEGTPVQVATQ
FT                   EGSLVYGVIGRVWQKPKVIGSPAAATNWRIQILTDNRAKQITVPLSKVNTGRESSLIMI
FT                   HQEARWDGTPIYATFDLKQADRRLEMQIITGNLLKAYEKYPRGKFVNFTDRRGQVRQGL
FT                   MMPDGFDIQEELRKEPVAFKAPHQVQAFLTEVTRNQGVVHDLDKILAIKTAGQAKYTGE
FT                   TATAFLVQTPVATRVGGRYFLNEDLLRAADAEFFSVSDRMEMTIPAEKLEAVLQVLMVE
FT                   QQITLVTFDHKDLARSYLGEMLPQMELIAANQFEAQGDYVPFVPEPTQSSIQQLELLYL
FT                   ANGIEPAVTPSVNGKEATEPPSENSAFHAIAEPALQSGIAEQNVARLLHQGRLTEAILQ
FT                   GEDFHLRVDNPPYLPLVIERHDTQLYLTHYREQQGDLCIDAEMVFAIDSTGQLKLTETA
FT                   VQDPIRGGELRSLSASFANLFSKNLLEQGFAAGITHTLNQKSITTEAETVVLHQNQDRS
FT                   FSEPPITPPAPQAGGKMMAETTRDIVNPVPSGSTAQLPGQSEGNLAPKPEGQLINKLEG
FT                   WATISRSLSKPEGYVARINTVVEMYRQTQTLSDKAVTALESDWQGHTAQLNQVREWYRT
FT                   AIRLGKSQPYLSRIQSVGEGFKNGEPLSEQAIAAMNTDFRYADWLTYSQGVQEEDPSHY
FT                   LKGVAANTLRAGKTQVQALEILETSPQFKQLQEQMGYSKAQSHFKLLITDTTNSLKTQK
FT                   IAHFHVTQCENEL"
FT                   /protein_id="YP_002478350.1"
FT   misc_feature    complement(<122114..>122329)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Cyan7425_5392"
FT   misc_feature    complement(119297..119533)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Cyan7425_5392"
FT   gene            complement(122677..123348)
FT                   /db_xref="GeneID:7280354"
FT                   /locus_tag="Cyan7425_5393"
FT   CDS_pept        complement(122677..123348)
FT                   /locus_tag="Cyan7425_5393"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_H0093 hypothetical protein"
FT                   /db_xref="GI:219883189"
FT                   /db_xref="GeneID:7280354"
FT                   /translation="MDQVKRCHGTRFPCFPALLALTFTISIVAPAVPSSAASDQQAPLT
FT                   QNIEAGLQQALQEGRIKEQSALHLAVKALLSQLAQGASLETAAQASGLFVEVASQLAQQ
FT                   GKALLPMSAGKSQPVNSKIQQKNKPFQQAVLTQLPAQKGQVMGKPSANAHTLANALVRG
FT                   LAVANRTGEIGYRDDLSFQVQNVVRYLRRGNTLERAVQSTRISRQTVDRLLVLGGYRAG
FT                   Q"
FT                   /protein_id="YP_002478351.1"
FT   sig_peptide     complement(123238..123348)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.763 at
FT                   residue 37"
FT                   /locus_tag="Cyan7425_5393"
FT   gene            complement(123351..124766)
FT                   /db_xref="GeneID:7280355"
FT                   /locus_tag="Cyan7425_5394"
FT   CDS_pept        complement(123351..124766)
FT                   /locus_tag="Cyan7425_5394"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /codon_start="1"
FT                   /product="AAA ATPase central domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: ava:Ava_C0030 ATPase"
FT                   /db_xref="GI:219883190"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="GeneID:7280355"
FT                   /translation="MTQIILYQIPTSEIEFLLRQLQSPYYWNPAHPYLMRWEGHWTQTD
FT                   LRVEADPLDRIAALTGEIVLEGLLEQGLSTRLCHQLINTFRANRSQTLYLVGERIHCPE
FT                   NLFPFVQVQDWPRPDSVALSQFLQARGLHSEALYRAVLGLYCGELANLLSRHAGLNEDR
FT                   LAEAITHYKISKLQGRGITLVPQPDCRAVGMDILDSLLSEISDLLKPEAFAAGLPFPRG
FT                   VILIGPPGTGKSLFAKNTAARLGLPLLCADWTGLISPLPGESEANLRALLHAAEVSAPC
FT                   VLFWDDYDKAFASADLSRDTGIEKKLAGMLLTWLQERTASVYTIVTLNRINQIPPELRR
FT                   RFDRTIFVDLPHEGARYEIFCTHLEKYCELPDWSDRDWKILISEYGECTPDEIGKAVYL
FT                   AAVRSYRQGRPRHITVEDLLYQRKQFTPANIANPGQIQSIRNHSKFALKASSEDRSRWR
FT                   VEPDPLFKTMLGR"
FT                   /protein_id="YP_002478352.1"
FT   misc_feature    complement(123717..124133)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5394"
FT   misc_feature    complement(123711..124109)
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Cyan7425_5394"
FT   misc_feature    complement(124065..124088)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5394"
FT   misc_feature    complement(order(123780..123782,123909..123911,
FT                   124062..124085))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5394"
FT   misc_feature    complement(123906..123923)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5394"
FT   misc_feature    complement(123744..123746)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5394"
FT   gene            complement(124763..126085)
FT                   /db_xref="GeneID:7280356"
FT                   /locus_tag="Cyan7425_5395"
FT   CDS_pept        complement(124763..126085)
FT                   /locus_tag="Cyan7425_5395"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all8035 unknown protein"
FT                   /db_xref="GI:219883191"
FT                   /db_xref="GeneID:7280356"
FT                   /translation="MAEIQQRLEQIATQFGDKDKISIFLGRDKLYSGKAISEATLERLE
FT                   VALRSPASESLVLRVMEGKELIYRSAKGEVTLDAKGMGSHWQAQPAPELEASSESEKTG
FT                   LNAEPAASHLTDRIPSLSPSLYPQQVVNASHLPESIAWAVIEPQLIERLHSQSESEPTQ
FT                   ISSSLSSPPGAIVLVDSRKDLVPFPLQPTEPQLDQQMWQILNPPEATNYASLEQALVAA
FT                   NARIDALQAQLEQTQVKLSTLAKEVQEQGLQHWAQSKVQDISHTSKLIAEQAKTRLMQW
FT                   MQVKTEQVKEVMTEKVTELKTVTQEKIDGAKVAAAETVEGLKTAAQLGAIALKEGIRTG
FT                   VNEFLSPVNAQDVERVGRHIVQTYGDGRTYERAATHAFHLSSGGEFSVTRRSDGRIIFA
FT                   NGELTQAADARDILKLNSLPGLLDQIQARQPQRGQQMEVGA"
FT                   /protein_id="YP_002478353.1"
FT   gene            complement(126087..126440)
FT                   /db_xref="GeneID:7280357"
FT                   /locus_tag="Cyan7425_5396"
FT   CDS_pept        complement(126087..126440)
FT                   /locus_tag="Cyan7425_5396"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_CR014"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_CR014 hypothetical protein"
FT                   /db_xref="GI:219883192"
FT                   /db_xref="GeneID:7280357"
FT                   /translation="MLTLDQQAQLAKLPREVVLTLKDYPSVAENYLDNKDLPPLPQNHE
FT                   CRLLEFYYDCAELPILTIENGVLSSHPAAAVIPTIIEVMDETSFVFIQVKGTVILNRLG
FT                   GHLPQVTSILVEL"
FT                   /protein_id="YP_002478354.1"
FT   gene            complement(126500..128188)
FT                   /db_xref="GeneID:7280358"
FT                   /locus_tag="Cyan7425_5397"
FT   CDS_pept        complement(126500..128188)
FT                   /locus_tag="Cyan7425_5397"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:glr2040"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr2040 hypothetical protein"
FT                   /db_xref="GI:219883193"
FT                   /db_xref="GeneID:7280358"
FT                   /translation="MVKPVLQIDPNDPHNWGAALDGLMQSKYAKPLVLVAVLGIVWLVL
FT                   AYRGKPKLKDSAAWATRDHVRRCRYLVAKQNIIGGKDNVGLELGSNLPLYDAVTSLISI
FT                   GAPKTGKSFSAVLSALYAHLKLNYPAILVDVQYPVQTEQMVCLARQLGYAAEDIHIFAP
FT                   GCPESGIWNICEYAQGSHAANLAKMLNDNFATSGSQGGDRFFDPAGEALISAVLQLART
FT                   IPGLNDVVGAQAILGLSELPKRVRLNEDRIDPWVYRAFMQLLSTEKSEKTAASIAGIAS
FT                   NLFKRFTEQDIAPALVGQTSFPLFLDGAKLLILGVRSDLREVIMPIQMALLSLLVDINS
FT                   VPTRKKPLQICFDELAAATYRSLPSRINENRKYGVYFNLAFQNLSQLEEKYGKNLTTAI
FT                   LGACGTQILFNPREQQTAELISKIVGTQKYRESQRSRSVSGGKVSNSTSSQVKERPLIP
FT                   PHQVRMMGQGWAIILNAGFRARDGSSEYIPYRCKIRVFEEYKQLTRWSASQWTHARKVF
FT                   IQRSPQRPVDPAYLKAGVKLAEAVLSLPSTADLERQIADEALSGY"
FT                   /protein_id="YP_002478355.1"
FT   misc_feature    complement(126758..128014)
FT                   /note="TraG/TraD family; Region: TraG; pfam02534"
FT                   /db_xref="CDD:111435"
FT                   /locus_tag="Cyan7425_5397"
FT   misc_feature    complement(126794..127879)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_5397"
FT   misc_feature    complement(order(127853..127861,127871..127876))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Cyan7425_5397"
FT   misc_feature    complement(order(127127..127132,127778..127783,
FT                   127787..127789,127853..127861,127871..127873))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Cyan7425_5397"
FT   misc_feature    complement(order(127130..127132,127133..127138))
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Cyan7425_5397"
FT   gene            complement(128182..129111)
FT                   /db_xref="GeneID:7280359"
FT                   /locus_tag="Cyan7425_5398"
FT   CDS_pept        complement(128182..129111)
FT                   /locus_tag="Cyan7425_5398"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cko:CKO_01916 hypothetical protein"
FT                   /db_xref="GI:219883194"
FT                   /db_xref="GeneID:7280359"
FT                   /translation="MSAAERANLRQAEQIMVLLVQSLRKNANLYPKKLQTALSDPRADT
FT                   RVEITIGGETVYGANLRADGSIKNTQVDAITEPEAHYFKNALAKQKGEQVDIPQFRNMR
FT                   VLVNGEVLFEMRDGKVLQNDLPLEFTRAIVPKIQSQPVDLSVSSKLPEHPSSLTQQLES
FT                   PNSSSPSPPSLDLQSSREEFSSVPTEDEPSPQRSTQSISSGETATANPQQESLNRELMV
FT                   QAGKALDILRPGQPQGNRSWVHPKYSIAENEGVRTVYIAETGSTIRQEGETITGIAREK
FT                   DVEAMKSLSHAYAQQAQRSASPESEVEW"
FT                   /protein_id="YP_002478356.1"
FT   gene            complement(129200..129823)
FT                   /db_xref="GeneID:7280360"
FT                   /locus_tag="Cyan7425_5399"
FT   CDS_pept        complement(129200..129823)
FT                   /locus_tag="Cyan7425_5399"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883195"
FT                   /db_xref="GeneID:7280360"
FT                   /translation="MTVEDIPIAIQNRFPNFCRLVRENQNRPRLPEGYQIDVIYTCLDD
FT                   VPCDTYKQDYRFSTNLPPEAKFTTAMIYFNQEVVWAWCAGKIHVNRIPENFDVNFETEL
FT                   GNNYQYASQAEDAQKLEVDWCPFKTEELEDAVIETQDSSSKVANTLLTDEEIYQIIGKV
FT                   IHNTYFSKKLKPDFNQLPPLPKNILERIYQKINEAIADKALSDF"
FT                   /protein_id="YP_002478357.1"
FT   gene            complement(129820..130446)
FT                   /db_xref="GeneID:7280361"
FT                   /locus_tag="Cyan7425_5400"
FT   CDS_pept        complement(129820..130446)
FT                   /locus_tag="Cyan7425_5400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883196"
FT                   /db_xref="GeneID:7280361"
FT                   /translation="MSKIFFLAGTGIGTIIVLSGTYSILANVRKAEVSYALSPSPLQGE
FT                   AMNSCYPTTFYSPQQVRYVDAGNGYRYYEAIAQPRFETSGPYATLYIRTSGQTCKWLNR
FT                   NDLASGRLTFMPEPVAIALAKLQYSELLDQCRASLTQGSGFGSCTEQLESEINQPPDWT
FT                   AAQINYLFPDDALALKELGIKTDRVLVVRSVQELENLRPKISTAR"
FT                   /protein_id="YP_002478358.1"
FT   gene            130852..130947
FT                   /db_xref="GeneID:7280362"
FT                   /locus_tag="Cyan7425_5401"
FT   CDS_pept        130852..130947
FT                   /locus_tag="Cyan7425_5401"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883197"
FT                   /db_xref="GeneID:7280362"
FT                   /translation="MAGLTRRKVLHAETVHPRTLKRYTLIYTFSF"
FT                   /protein_id="YP_002478359.1"
FT   gene            complement(131599..132675)
FT                   /db_xref="GeneID:7280363"
FT                   /locus_tag="Cyan7425_5402"
FT   CDS_pept        complement(131599..132675)
FT                   /locus_tag="Cyan7425_5402"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1016"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   amr:AM1_E0220 hypothetical protein"
FT                   /db_xref="GI:219883198"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="GeneID:7280363"
FT                   /translation="MSAPLSGFDGYDVFLTDIKNRIRTAQVKAALAVNQELILLYWHIG
FT                   REILTRQQQQGWGAKVIDQLSRDLRREFPQVKGFSRTNLLYMRAFAEAYPDLQIVQQLA
FT                   GQIPWFHNCVLLDKVKDPQHRRWYIEKTIQNGWSRAVLEHQIESRLLERTGTAITNFER
FT                   TLPKPQSDLAQQLVKDPYNFEFLGIGEEAKERDLEQALLRHMRDFLLELGVGFSFMGNQ
FT                   YHLEVGGEDFYIDLLFYHVRLRCYIVIELKMTEFKPEYSGKMNFYVAVVDDQLRHPQDQ
FT                   PTIGIILCKSRNKTVIEYALRDMNQAIGVSTYHLGEPLPEQLQACLPTAEQLQQELETV
FT                   TVPREEETDSDESVLESP"
FT                   /protein_id="YP_002478360.1"
FT   misc_feature    complement(131686..132636)
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="Cyan7425_5402"
FT   gene            complement(133205..133699)
FT                   /db_xref="GeneID:7280364"
FT                   /locus_tag="Cyan7425_5403"
FT   CDS_pept        complement(133205..133699)
FT                   /locus_tag="Cyan7425_5403"
FT                   /gene_family="HOG000272376" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   amr:AM1_4993 acetyltransferase"
FT                   /db_xref="GI:219883199"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:7280364"
FT                   /translation="MIRPSTSDDTIAIIALAEAIGFQLNELEVLRKLLVDYFGDNSNSN
FT                   SLRDGQAERFWLADDEDKDGVVGVAYCEPERMTDQTWNLQLIAIRPDYQGQGRGGKLLH
FT                   YVEETLKGRGGRMLLVETLASFDLARAFYTKCGYEEEARIRDFYAAGDDKVVFRKVLKA
FT                   E"
FT                   /protein_id="YP_002478361.1"
FT   misc_feature    complement(133337..133537)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Cyan7425_5403"
FT   misc_feature    complement(order(133400..133405,133433..133441))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Cyan7425_5403"
FT   gene            133937..134515
FT                   /db_xref="GeneID:7280365"
FT                   /locus_tag="Cyan7425_5404"
FT   CDS_pept        133937..134515
FT                   /locus_tag="Cyan7425_5404"
FT                   /gene_family="HOG000248228" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: amr:AM1_3018
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:219883200"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:7280365"
FT                   /translation="MSSDDRRIEVTQAAWRVIIREGLDRTSMRAIAQELGSSTGVITHY
FT                   FRDKEELILFALEQVFENALEHMQEVAKGRQGIDRLEQMIFTALPLEEIDKADWKVWIA
FT                   FLGYSIGRKYLIQKHRRRYERLRQILHQEFTDLQAAKLIRVDLDLNLEVNALIALVDGI
FT                   ATGAVICPEQFSAEQQQYLVHRHINALLA"
FT                   /protein_id="YP_002478362.1"
FT   misc_feature    133943..134509
FT                   /note="transcriptional repressor BetI; Region:
FT                   betaine_BetI; TIGR03384"
FT                   /db_xref="CDD:132427"
FT                   /locus_tag="Cyan7425_5404"
FT   misc_feature    133973..134098
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cyan7425_5404"
FT   gene            134839..136317
FT                   /db_xref="GeneID:7280366"
FT                   /locus_tag="Cyan7425_5405"
FT   CDS_pept        134839..136317
FT                   /locus_tag="Cyan7425_5405"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_C0187"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_C0187 transposase IS66"
FT                   /db_xref="GI:219883201"
FT                   /db_xref="GeneID:7280366"
FT                   /translation="MEPSDAHLAAMMVAPEFDPEEMGVRFWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEQLKETLRQLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   HGFETVDHRLVLPLAECLVCGSALERDETTPAQRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSATLPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYRIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVASLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYQAGNLTVEQLQTQRLILEAALTDVLNHPPKAGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGKNAVSELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002478363.1"
FT   misc_feature    <134905..>135030
FT                   /note="rod shape-determining protein MreC; Provisional;
FT                   Region: PRK13922"
FT                   /db_xref="CDD:184397"
FT                   /locus_tag="Cyan7425_5405"
FT   misc_feature    135250..135759
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_5405"
FT   gene            complement(136401..136637)
FT                   /db_xref="GeneID:7280367"
FT                   /locus_tag="Cyan7425_5406"
FT   CDS_pept        complement(136401..136637)
FT                   /locus_tag="Cyan7425_5406"
FT                   /gene_family="HOG000087985" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883202"
FT                   /db_xref="GeneID:7280367"
FT                   /translation="MNKKLVAGMLFFSTLVLPTLVPLQASAGTRDDYYIVFCRASYKKP
FT                   YYKVGTFGNRFEAKITEQRHEWDGESCYIKRYV"
FT                   /protein_id="YP_002478364.1"
FT   sig_peptide     complement(136554..136637)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 28"
FT                   /locus_tag="Cyan7425_5406"
FT   gene            complement(137442..138026)
FT                   /db_xref="GeneID:7280368"
FT                   /locus_tag="Cyan7425_5407"
FT   CDS_pept        complement(137442..138026)
FT                   /locus_tag="Cyan7425_5407"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883203"
FT                   /db_xref="GeneID:7280368"
FT                   /translation="MLSIAIYLFLEGATQQPAAHTLLAGQKSELPCYPNTFAKARIINQ
FT                   FTFKGSTYYEVYAPPKNDPNSTYLSILYFRTSIKGCELLNPNTVIGSRLLYMPEPVALH
FT                   FARLRFQTLLDQCLQERVGQINAGEHCQRKLESLINVPGDVKAEGIEFLYPEDVEALRQ
FT                   MGIKADQVFVIKTEKDLQELWLKKIRRNKKP"
FT                   /protein_id="YP_002478365.1"
FT   gene            complement(138081..139697)
FT                   /db_xref="GeneID:7280369"
FT                   /locus_tag="Cyan7425_5408"
FT   CDS_pept        complement(138081..139697)
FT                   /locus_tag="Cyan7425_5408"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /codon_start="1"
FT                   /product="Peptidase M23"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase M23; KEGG: cya:CYA_1627 M23B family
FT                   peptidase"
FT                   /db_xref="GI:219883204"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="GeneID:7280369"
FT                   /translation="MRRCYLRIFAALIGLAITITWAIFPLSTDAEDAPSADRSPTFTWN
FT                   DIPPIQSSGSLSAPEGGTVSWVPGIRPENLFTLGMLRSSFGYQNLSIANIEQLIGQPVM
FT                   NTPLADFSLVHHLSVLQLVEAIPGLGELPVNAVPPIARLAEVQGMNTDGGWVTIANLAP
FT                   VMGGVLGQIGPELVNFDISQIPGLSTLPLGELPDWAQAQIAQIPGLSQIPLINPLSLKD
FT                   YFVPFDIPFGMSPCKLGGECREFNIDNTASGNWKNMSIPCTGGPCSHIEVTRWAGDTNR
FT                   IRWVSKEQQVPGGNGFLCDEEPTGRFPFGKNPKVVVEQMKEDPGEVDFALYFSVGGPFG
FT                   LESAHCFGPFPLPFWETRREGELILFGPDKLSATSPLSSFIQPPPLSGGTGKPPGHGSP
FT                   PPQPVDCGGKKLPYIRPTPGPVTSEFGMRVNPVTGVYRLHAGIDLGDGSGTPIAAANCG
FT                   VVTYASWVSGYGNYTCISHGSGVETCYAHQNSISARVGASVKRGQVIGTVGSTGNSTGP
FT                   HLHFEYRINGSPVDPRRYVPI"
FT                   /protein_id="YP_002478366.1"
FT   sig_peptide     complement(139605..139697)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 31"
FT                   /locus_tag="Cyan7425_5408"
FT   misc_feature    complement(138102..138389)
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="Cyan7425_5408"
FT   gene            complement(139698..140651)
FT                   /db_xref="GeneID:7280370"
FT                   /locus_tag="Cyan7425_5409"
FT   CDS_pept        complement(139698..140651)
FT                   /locus_tag="Cyan7425_5409"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0021 hypothetical protein"
FT                   /db_xref="GI:219883205"
FT                   /db_xref="GeneID:7280370"
FT                   /translation="MLGPAWAGRVLRVTTEAAQEGKVPITVYVDGGGVLLDFSPTGERI
FT                   QKIAIDDPSRIVVDHCLATRSCPPNPSPIIRLFRSTGITFQDIPTASMTMLSVETTDAQ
FT                   GDYHSYIFPISIGKGRGTVSKVLIGAVDPVPQHRIAGPPPRPAAVTAAQGAKEAEARSL
FT                   LVDPVLKGRVRQYLQLLNSGMNRSKAAQKAGISMALVNRLEQLGQFRDSASAKTQPPSA
FT                   PAPPPLPDPPAAPTSPATTATLSPNTKPVGDNPQVQALERGLAIAQKRESLKRNTVEQV
FT                   QDLIRRVRQGGSLAESMHRSGVSTLVIEQLLFLAGG"
FT                   /protein_id="YP_002478367.1"
FT   gene            complement(140692..142230)
FT                   /db_xref="GeneID:7280371"
FT                   /locus_tag="Cyan7425_5410"
FT   CDS_pept        complement(140692..142230)
FT                   /locus_tag="Cyan7425_5410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cau:Caur_0201 beta strand repeat-containing
FT                   protein"
FT                   /db_xref="GI:219883206"
FT                   /db_xref="GeneID:7280371"
FT                   /translation="MSKQELLQKFAAQTGAEVPGVEPQPPDQIEIQLDSELPGTEAAGE
FT                   LFKDSYTDRTKVKPWEQPGLKMAMVSLCVLPFTLGAIWIFKDGIPRPKLTTKAPQPLGT
FT                   NLAENDQPRPATDGEWASYAATNGMRQQFAAAARDTPDPLLNPQPVPPVQKKISASRQA
FT                   NSAPSIVGRDNSPSPYPPVVRSYSPPAPAIVPYRPVVPPGIAPAPRIYRAYPHPEPGMV
FT                   AQTERSPQERIAAILAVTATPTNTTSGSVTAATSPSDQSQNSAYLPAEDAILDNQPQTL
FT                   IRRTQSAKGKLVNGIAFTANDYAALVGQPVEIQLLQPLGQLPTGARIITVVEGNNRDST
FT                   GISAVVRLKPTAIVLGDAESPIDPGVLLVSRANGSPLIAQRGGSAFLRLMGGLAGSLIS
FT                   GAALTNLGASQNVQFGNASYLTAIGTNAATNLVGNAAQQLQQSGQSEVWVLKAGTEIRV
FT                   SVLKPFALPDLSKANPIPTGNEQSWLQDPQQTDARWTAIAAQEEQGGPAGATQP"
FT                   /protein_id="YP_002478368.1"
FT   gene            complement(142251..143165)
FT                   /db_xref="GeneID:7280372"
FT                   /locus_tag="Cyan7425_5411"
FT   CDS_pept        complement(142251..143165)
FT                   /locus_tag="Cyan7425_5411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr2036 unknown protein"
FT                   /db_xref="GI:219883207"
FT                   /db_xref="GeneID:7280372"
FT                   /translation="MFFTHLNQRKSTEANRAVLPEELSPIHLEGDDSPASERVPVLPPQ
FT                   LSSYLLRFGLAVAAMLLLQTVGVIALVFLATKPAPDLVQQDNGVMARVRPLDSHIDAVP
FT                   DQVVDFLEDRLPRLYTWSGLLVNSDDPTGLSYLRDPGITVPDSTGESVQIPTPLYNEQF
FT                   IFDEPLRENMLRNLAQMIKDGDVGRRIFANDPSRPALASVYRFILRGKIQYPQEVSRDR
FT                   WKVRVAADIVLFSSTETLGTRQQPIAEFVQDVYVRKASPIPRLFLHDQQRQDLVWYGRK
FT                   DGFVIDAMLPVGPAQEVPGVPRN"
FT                   /protein_id="YP_002478369.1"
FT   gene            complement(143227..144483)
FT                   /db_xref="GeneID:7280373"
FT                   /locus_tag="Cyan7425_5412"
FT   CDS_pept        complement(143227..144483)
FT                   /locus_tag="Cyan7425_5412"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_4988 hypothetical protein"
FT                   /db_xref="GI:219883208"
FT                   /db_xref="GeneID:7280373"
FT                   /translation="MLLWSKTAGWIRHRPRRQKRLVFYLFVVLLFFAFISIPQPAEAIV
FT                   FNDLAQWGREAAEKIAQNQQKIVERYFGSYNPAFAYLCYCAQGFAVFPAASGFLRWLKD
FT                   DDDLNIWLGLVAPVLVLVALFNGGYLIGQIILALYKIFDGIINTFDSYTNFYALIKEGK
FT                   ARTLIGPSISPLFKQCEALIGAEQAVCFQNISQQALNLANEYKQDFYNASWLQDWITRL
FT                   SDLAGQWLDPSANVGDKLRTTFWTFTSPIWEGILVLILLKVMEAWQALYGIAFVFAGIA
FT                   APMAVTASLFTGSQFLASAFALWLTSLFTIFLARLLLYVGYGLASDLVVSADASTDTIW
FT                   FGVLMAIVIPFCVFAIARGSAAGIWASFVETSVATVSAGAMLAGGAIAGPAGAAATGAA
FT                   TRVTASGSRSNEVQVETRY"
FT                   /protein_id="YP_002478370.1"
FT   sig_peptide     complement(144352..144483)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.797 at
FT                   residue 44"
FT                   /locus_tag="Cyan7425_5412"
FT   gene            complement(144538..145659)
FT                   /db_xref="GeneID:7280374"
FT                   /locus_tag="Cyan7425_5413"
FT   CDS_pept        complement(144538..145659)
FT                   /locus_tag="Cyan7425_5413"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_3322 hypothetical protein"
FT                   /db_xref="GI:219883209"
FT                   /db_xref="GeneID:7280374"
FT                   /translation="MAGQLIRRTGLSVALGLQLLTLPASAMPVVQPLPMAQLGGLGGVL
FT                   GELFTIAAPFFQSYSAHLLGGLNIGGIDLSNLVMSAVFNSGGVLGSSGLSFGWLLNTVG
FT                   GALDPLLSQIPGGSQILSILTGLLNGSFNPQTLLNSGLLQKILDHLLAHLPPGGGNGNG
FT                   GTLPGATVGGGGVLGTGSTTCLYASTCRPNPNPYQSVFKQATGVGGYPNPNEVRGKVYE
FT                   AATSNKLLADVYASNPYMGAYYAGNQSDRDINRATTETVLSKAGQALQRQIRNNAQQTV
FT                   QSLGDLVKNCAQKARSSQELIRCNLLVNGIAPSFDAAQLSVLMQMQVDDQFQKIQLGNI
FT                   SASMDAARRQRDIENAGLSISTLKAIWTTPTRW"
FT                   /protein_id="YP_002478371.1"
FT   sig_peptide     complement(145579..145659)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.986 at
FT                   residue 27"
FT                   /locus_tag="Cyan7425_5413"
FT   gene            complement(145659..145967)
FT                   /db_xref="GeneID:7280375"
FT                   /locus_tag="Cyan7425_5414"
FT   CDS_pept        complement(145659..145967)
FT                   /locus_tag="Cyan7425_5414"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883210"
FT                   /db_xref="GeneID:7280375"
FT                   /translation="MFRLIVLSALWTTGLTPIVISLLLVIAIAGKPIPCDRTACTGKTY
FT                   GWQLLILPGATTLPFLAGLAIAYLSSRKNRKRSNNLGSLASMGPPPQGKKSQAAGRL"
FT                   /protein_id="YP_002478372.1"
FT   gene            complement(145955..148858)
FT                   /db_xref="GeneID:7280376"
FT                   /locus_tag="Cyan7425_5415"
FT   CDS_pept        complement(145955..148858)
FT                   /locus_tag="Cyan7425_5415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_2885"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_2885 hypothetical protein"
FT                   /db_xref="GI:219883211"
FT                   /db_xref="GeneID:7280376"
FT                   /translation="MLHPDDQRYKSDHPLDLKITGHSAHASIAAYLPLKATCEFDVFGE
FT                   KVGALILQRGTAARTFVWGWEIQGTHVYDLAQNLISLYDALQEGLLNIPYYQVWSLHIG
FT                   GEATSEDRTRQLLELIERNDNPEIDQLLVSEIGRVQHLARSGLREPKFARLYVTYKPQA
FT                   DQQGRKRADRVEAFGKEVYEIWSTLRDWISGQKTQKQLAAVEEQFRTAFLRGYRSAATL
FT                   LSGTFGLAVRPMSEAALWTNLRHRFSGEPAGHSPNRVSCRMDERGVRLRSELTGELHIT
FT                   GHLIKDYPVKCDPEWVYTRRFDPESGDIRDRYTGILRATGQYKSLAHEYHQCRVFWDLL
FT                   ANESCKDTEFFIQLTPSDTRIARAAASELYRQSIKQFEATASKRYYDAASDESARQARD
FT                   ALRSLYLGDSPLRVGFCVLIHRRSLADLDLACRDFISRCRWLELVREYVVTHRLWLQTL
FT                   PCNDDALLQYKIFGYDYARVKRTGAQFDRRIYYGSKEVIAFFPIARTLANDEQGIEFIA
FT                   PDKQPVRVDFFHPGMEKHWCIVAAHRSSKSVLANNMADHALAMGQPVTWLDYPPADGSS
FT                   TLRDRCQYMGGTHIDIQLESFNLLQIPDFSGLAAEIQQDRLRSLTGYWIQQLMILAGPT
FT                   GQDLQLEQLARTILELSIATYLEDPLIQTRYGTAIREGFGSQAWQSTPTLKDFARFVSR
FT                   EKLESRLANLGDRVQEALELLQFNLGRITDTRTTIGRAISLPSTVRLDNLLTVFSLRNM
FT                   NEGQESLAYSLAAYSSAIQKSLSHPISHVLIDEAQNLATHAGVLKLASNLATTGGKAGI
FT                   RMGLITNSFTKVAQSVAGADLLANLNTKFVGRIEAGSVDPLAESLGIPVQLLNQCASEQ
FT                   FYMNRKEGYSNWLIQDYKKHTFGRWYAPWESVVLSASNANERLVKQWFFDHFTDKHEAL
FT                   SACTRYFRYHWQSEQDLVIPLSLDHLQTFMPQSPCSV"
FT                   /protein_id="YP_002478373.1"
FT   misc_feature    complement(146120..>147538)
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="Cyan7425_5415"
FT   gene            complement(148865..149170)
FT                   /db_xref="GeneID:7280377"
FT                   /locus_tag="Cyan7425_5416"
FT   CDS_pept        complement(148865..149170)
FT                   /locus_tag="Cyan7425_5416"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883212"
FT                   /db_xref="GeneID:7280377"
FT                   /translation="MPIHNQPILPNRALGRQKKMLGFFPTYLLPGLLAGLTVMAVASEL
FT                   SKDKLRSAFLGSSVIAAYWLYAGRGEESAWTNFGRFLSVPVFHLPPDPNQETLPPK"
FT                   /protein_id="YP_002478374.1"
FT   sig_peptide     complement(149042..149170)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.847 at
FT                   residue 43"
FT                   /locus_tag="Cyan7425_5416"
FT   gene            complement(149189..149707)
FT                   /db_xref="GeneID:7280378"
FT                   /locus_tag="Cyan7425_5417"
FT   CDS_pept        complement(149189..149707)
FT                   /locus_tag="Cyan7425_5417"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883213"
FT                   /db_xref="GeneID:7280378"
FT                   /translation="MKTYCRSLIHSPACTILSWGTLVALVLYRVVMGEWFVLLVCASAT
FT                   LIGFTLQQNWQRVPSPLRPNLLLGSGALLAWVLMTLHAPAQALFFDTLENGLKTLFGRF
FT                   GVAGVDQIPGWVGAVFRIIAVVFLAVLALRFGRAQEEDSEGVRQIVGKIVQILAGMLIL
FT                   DALIGLFTT"
FT                   /protein_id="YP_002478375.1"
FT   gene            complement(149704..150501)
FT                   /db_xref="GeneID:7280379"
FT                   /locus_tag="Cyan7425_5418"
FT   CDS_pept        complement(149704..150501)
FT                   /locus_tag="Cyan7425_5418"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: cyt:cce_5029 putative group 3/4
FT                   sigma-70 RNA polymerase sigma factor"
FT                   /db_xref="GI:219883214"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:7280379"
FT                   /translation="MLTCTSFSLQSDHRLIQICQSFFGVTTTSVSAIDRRTADRAFAEL
FT                   LSRYHQWLWKQIHKLPGLDESEAYSAALEGFRRAIITFDLSSGYALVTWASHCVRSALT
FT                   AVFAREQRQAAKVERVAAIAPLVHEDELIDPFEMEQLHRDLQHLQIAITQLSTATQAII
FT                   TMRTTGMSFVQISQELGKSASAVRMSYNRALKSLQRLLSLPSSAQFGFGVDTDSSCRDF
FT                   SSRRLSEGVRLENEPAIWSRSLATGTEPCIYDPPEGSIALCTG"
FT                   /protein_id="YP_002478376.1"
FT   misc_feature    complement(149899..150384)
FT                   /note="RNA polymerase sigma factor, sigma-70 family;
FT                   Region: sigma70-ECF; TIGR02937"
FT                   /db_xref="CDD:163078"
FT                   /locus_tag="Cyan7425_5418"
FT   misc_feature    complement(149911..150051)
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:186312"
FT                   /locus_tag="Cyan7425_5418"
FT   gene            151563..153104
FT                   /db_xref="GeneID:7280380"
FT                   /locus_tag="Cyan7425_5419"
FT   CDS_pept        151563..153104
FT                   /locus_tag="Cyan7425_5419"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_A0036 hypothetical protein"
FT                   /db_xref="GI:219883215"
FT                   /db_xref="GeneID:7280380"
FT                   /translation="MPSTNRKPKVANTDQPNSLVDPTEMFTSPGKGGRKRVSRSRALSH
FT                   TKLPLFSHKQVEMTATGAPVISATQAFLRHPDWSEYEKNRLYFHRSFGKGRHIEFYILN
FT                   KQKHQPGFITSFAESEILRLYGIHAARLHAVFATYAAQQKEPWKETFILLGSDLIKTLR
FT                   IHTGNRLKKADKLKAIADLAWVLGTLGAKIQWQEGYLDLTIVERSLIWIVNVKEQYQND
FT                   LNGNPGELIEVEIEVQAGQWTRNFLNREGEKQRTALYQYGFINQDILSIDPYKKELAAA
FT                   LALYLIQNRRSHPSGKYRIQTLLEAVMSVQEINLIRKDKLKRSRFVKRFYILLEELTEV
FT                   NFTIQFDENFPKDLLPSWAVILKEADNDLILADNGFQEQRMPDGFFDTWLQGVVIIIPP
FT                   APVEGELASFEASKAEVVKQIARPCSNQLLPSGSARGSITPELLDDAISSNQSLTGAMV
FT                   KKLRLQAGLSQMDLAIAMGMSQSWVRNIENKLQDKPLKPLYAEQFRKVLKLSLQI"
FT                   /protein_id="YP_002478377.1"
FT   misc_feature    152931..>153026
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Cyan7425_5419"
FT   gene            153907..157419
FT                   /db_xref="GeneID:7280381"
FT                   /locus_tag="Cyan7425_5420"
FT   CDS_pept        153907..157419
FT                   /locus_tag="Cyan7425_5420"
FT                   /gene_family="HOG000037237" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_R4929"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_R4929 hypothetical protein"
FT                   /db_xref="GI:219883216"
FT                   /db_xref="GeneID:7280381"
FT                   /translation="MSVYHLVSEHGNAVRPPLGNPFHPSICKSLPIGSDWSVRVAADHV
FT                   QEWRDCGVDPGIIELNVETLDDTAINDYSDSLFPIAERLNWKITRFGRKTRSNLRGWWV
FT                   SGIDPLNNWKRMEWGRFKPDASTPVIDQEKGKPAKYLSPSLGPGSSRLILLDVPQSIWE
FT                   KVAGRYGVSIVPTDLTNGFWHWVWKSNLPIIVTEGEKKAGCLLTQGYAAISLPGIFNGY
FT                   RKDSKKLIPELAHFATAKRSVFICFDHETKPKTLKNLNLAITKLGKLLERGGCSVKVIS
FT                   LPGPQKGVDDFIVAQGNQPFDAFYESALPLQFWVASKLWSLTYQPTLTLNTPYLGKLPY
FT                   PSSGLACIKSPKGTGKTTALQDLIQEAINSGRKVLVITHRIQLGRAICSSIGIDWIEEV
FT                   KESETGGLFGYGLCIDSLHSTSQARFNPQLWKGAIVILDEVEQILWHALNSTTCYEHRV
FT                   KILEALRELVEVVLSSNGLIVAQDADLSDVSIDYLKGLVEAPMEPWIVVNQWKPESAWN
FT                   VSFYDTKNPASMISRMEKFIAQGAIFVAVDSQKVSGKWSSKNLETYLQTRYPDKRILRI
FT                   DSESVADPQHPAYGIVEQLNQIITNYDIVLATPTIGTGVSIDVRGHFKAVFGIFQGVTP
FT                   DVESRQALARVREPVPRLVWSARFGPGKVGNGSCSYQDVIHSTTKNVKYNITLLKEVDF
FT                   DIDAQTDPITLRTWAKMATRVNVSLWNYRNEFRNGLLLEGHQVTTITDDLLKLLPSEFQ
FT                   LQCSELLETLEAKTIAEVLKEKLLTGVLSFPGVEYLHCQHDERLADSIMQEIKGIQEYS
FT                   RLTEAQAVASAPLISSAEYDRLKDQRAKTSDERYVQQKHELQRRYPIPVTPELKIKDDG
FT                   GWYSQLRLHYYLTHDPVFVRLRDLKEWQGHLDRGNGKVSLQDIKLLTAQVETFKVLGIL
FT                   NLLNPQRLIRATDPDIEQLRLNSIQYRHDIKALLNLTISEKMKPIEVVQALLRKLGLKL
FT                   ACIGRDLKDDGRRCGSRIYQFQTPKDERERIFAQWQQRDAINPVDHVEEGKGDSLLSRN
FT                   IIDIIPVDPPPDIYDLSQGLGGFSEVPLKQQQKQVASDTGEEKCFMAERIYAQMGCTTK
FT                   FLFPSIQVGSLVKYIEQSCCWVVQQLQGATAVIKQIHSTVERTVPLSNLTLIVAKEDLA
FT                   DSTS"
FT                   /protein_id="YP_002478378.1"
FT   misc_feature    <154786..>155043
FT                   /note="putative bifunctional molybdopterin-guanine
FT                   dinucleotide biosynthesis protein MobA/MobB; Provisional;
FT                   Region: PRK14489"
FT                   /db_xref="CDD:172962"
FT                   /locus_tag="Cyan7425_5420"
FT   misc_feature    154942..>155055
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Cyan7425_5420"
FT   gene            157621..157959
FT                   /db_xref="GeneID:7280382"
FT                   /locus_tag="Cyan7425_5421"
FT   CDS_pept        157621..157959
FT                   /locus_tag="Cyan7425_5421"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883217"
FT                   /db_xref="GeneID:7280382"
FT                   /translation="MLPSDLLTALTNLTLEQTQELLQWLKEQIKLQKRAECLQKKEHQQ
FT                   RVALEKHKLSDGITYQLELVNCGKQRCQKCAIGPSHGPYWYGYYWDSKRKKMVSRYLGK
FT                   KAPLDGKD"
FT                   /protein_id="YP_002478379.1"
FT   gene            158287..159129
FT                   /db_xref="GeneID:7280383"
FT                   /locus_tag="Cyan7425_5422"
FT   CDS_pept        158287..159129
FT                   /locus_tag="Cyan7425_5422"
FT                   /gene_family="HOG000058717" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ana:alr7082 chromosome partitioning protein, ParA family
FT                   ATPase"
FT                   /db_xref="GI:219883218"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7280383"
FT                   /translation="MRVLEQEVKPINSSLKQIVLWIGANAGGVSKTTLAIHLAYEMANR
FT                   GMSIAIFDLDTNVSMSQFTGLGKNPSWQETLAYVLSEDFKGDWPLATPSWGLNQGKVQI
FT                   CRGGPVMAEATIDLTLRKRREYLLRDRLIDYPLPHDLIILDCPATLSNLSDVALVAATH
FT                   LLIPLEATPKSFSGCDALLTWYRVTCRQLRLQPTPPILGIVPVRYDSSEAIQRDYYAML
FT                   PQMLQPQGIKCYSSIRYSREFINASEHGVPLQIYRPNHKACSDFLSICNDLSQLLESE"
FT                   /protein_id="YP_002478380.1"
FT   misc_feature    158332..159126
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Cyan7425_5422"
FT   misc_feature    158350..>158451
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5422"
FT   misc_feature    158362..158382
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5422"
FT   misc_feature    158380..158382
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5422"
FT   misc_feature    <158680..158901
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5422"
FT   misc_feature    158719..158721
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5422"
FT   gene            159129..160103
FT                   /db_xref="GeneID:7280384"
FT                   /locus_tag="Cyan7425_5423"
FT   CDS_pept        159129..160103
FT                   /locus_tag="Cyan7425_5423"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /codon_start="1"
FT                   /product="parB-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: amr:AM1_A0252 ParB family
FT                   chromosome partitioning protein"
FT                   /db_xref="GI:219883219"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:7280384"
FT                   /translation="MMARARTADYFSMSNQSIELEAAQERIAQLETLNAQLQSMLTEGT
FT                   PPTEQQTLNVPIDQIDRYPEQVRQWFDPTEQEKLTQLIQQVGFIGRIWVRRLSSDRYQL
FT                   IAGERRLRSAISAGLTHIPVEVLDVDDETALMLSLLENLNRVDLNPVEETEGMLRLLAS
FT                   RLNYEVSEVKSLLYRMKNHYERGEEATPSEAEAFAMITKIFDMVGRVNWQSFITMRLRL
FT                   LNLPSEILAALQQGKLEYTKATVIARIKDEDSRIQLLNDSIAFNLSLSEIKDRVRALRP
FT                   EKPISLRDELKQIVKVFPKQLNDPRKARRIQKLVEELRVAIAE"
FT                   /protein_id="YP_002478381.1"
FT   misc_feature    159291..159557
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Cyan7425_5423"
FT   misc_feature    159330..>159965
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Cyan7425_5423"
FT   gene            160452..162743
FT                   /db_xref="GeneID:7280385"
FT                   /locus_tag="Cyan7425_5424"
FT   CDS_pept        160452..162743
FT                   /locus_tag="Cyan7425_5424"
FT                   /gene_family="HOG000270497" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /codon_start="1"
FT                   /product="RNA binding S1 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: ana:alr5249
FT                   probable transcription accessory protein"
FT                   /db_xref="GI:219883220"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="GeneID:7280385"
FT                   /translation="MLNLPQLLAAELKLKPFQVANALELLAEGATVPFIARYRKERTGE
FT                   MNETQLRDLFDRYTYLTELEERKTAILAAIAQQDKLTPDLEAKIAACQQKNTLEDLYLP
FT                   FRPKRRTRATIAREKGLEPLANFLKTLNHPTAVPTDLALAAAKYIAEAKGVRTATDALQ
FT                   GASDILSEEIADKANLRAYLRDYLLTTGVLNAKVKGGHPEGTTRFEMYRHYQAPIKTIP
FT                   AHNLLALYRGEAEGVLVVELTFDEAAVLADLESQELRAKQQEVRDFYRQMLNDAFQRLL
FT                   KNSLITEVRSAKKVEADLESIRTFEANLRELLLAAPAGMKSTLAIDPGFRTGCKVVVLD
FT                   PTGKFLEYQTIFPHQSVEQRQKAGQTLLKLIDRYQVELIAVGNGTAGRETDEFVAELLQ
FT                   TLEPKPVKVMVNESGASIYSASPVAIAEFPEQDITVRGAISIGRRLQDPLAELVKIDPK
FT                   SIGVGQYQHDVDQKLLKKKLDETVESCVNYVGVDLNLASKELLTFVSGVTPTIAGNIIT
FT                   YRNQNGAFSNRRQLLQVAKLGPKAFEQAAGFLRIRNGQNPLDNTAVHPERYNLVETIAR
FT                   DLGVPLAQITQVAERLNNTDLKKYVTDTIGEPTLRDILAELEKPGRDPRAEFTFARFRA
FT                   DVKAISDLSVGMQLEGMVTNVANFGAFVDIGVHQDGLVHVSQLADRFVSDPKQIVKVGQ
FT                   VVNVRVLEVDEKLKRISLSMRSDTPERQGQSPVSSPAPKSQRSQPKPSAGKPPTLEDLK
FT                   AKFGKHRSRG"
FT                   /protein_id="YP_002478382.1"
FT   misc_feature    160452..162722
FT                   /note="Transcriptional accessory protein [Transcription];
FT                   Region: Tex; COG2183"
FT                   /db_xref="CDD:32366"
FT                   /locus_tag="Cyan7425_5424"
FT   misc_feature    160473..161051
FT                   /note="Tex-like protein N-terminal domain; Region: Tex_N;
FT                   pfam09371"
FT                   /db_xref="CDD:150144"
FT                   /locus_tag="Cyan7425_5424"
FT   misc_feature    161412..161708
FT                   /note="Uncharacterized protein family (UPF0081); Region:
FT                   UPF0081; cl00525"
FT                   /db_xref="CDD:186059"
FT                   /locus_tag="Cyan7425_5424"
FT   misc_feature    <161922..162104
FT                   /note="endonuclease III; includes endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
FT                   glycosidases (Alka-family) and other DNA glycosidases;
FT                   Region: ENDO3c; cl11430"
FT                   /db_xref="CDD:187036"
FT                   /locus_tag="Cyan7425_5424"
FT   misc_feature    162387..162590
FT                   /note="S1_Tex: The C-terminal S1 domain of a transcription
FT                   accessory factor called Tex, which has been characterized
FT                   in Bordetella pertussis and Pseudomonas aeruginosa. The tex
FT                   gene is essential in Bortella pertusis and is named for its
FT                   role in toxin...; Region: S1_Tex; cd05685"
FT                   /db_xref="CDD:88440"
FT                   /locus_tag="Cyan7425_5424"
FT   misc_feature    order(162411..162413,162435..162437,162465..162467,
FT                   162471..162473)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88440"
FT                   /locus_tag="Cyan7425_5424"
FT   gene            162780..163121
FT                   /db_xref="GeneID:7280386"
FT                   /locus_tag="Cyan7425_5425"
FT                   /pseudo
FT   gene            163188..163607
FT                   /db_xref="GeneID:7280425"
FT                   /locus_tag="Cyan7425_5426"
FT                   /pseudo
FT   gene            163633..163926
FT                   /db_xref="GeneID:7280426"
FT                   /locus_tag="Cyan7425_5427"
FT   CDS_pept        163633..163926
FT                   /locus_tag="Cyan7425_5427"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_6113"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_6113 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:219883221"
FT                   /db_xref="GeneID:7280426"
FT                   /translation="MLTYSGLEQIIFAALPLEDSDRADWKVWIAFLGYSIGREHLIQQH
FT                   QKHYECIRQILYQKLAGLQAAKLIRANLDLTLEANALIALVDGISTGSRDLP"
FT                   /protein_id="YP_002478383.1"
FT   gene            complement(164023..165015)
FT                   /db_xref="GeneID:7280387"
FT                   /locus_tag="Cyan7425_5428"
FT   CDS_pept        complement(164023..165015)
FT                   /locus_tag="Cyan7425_5428"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcz:BCZK3087 quinone oxidoreductase (NADPH:quinone
FT                   reductase)"
FT                   /db_xref="GI:219883222"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:7280387"
FT                   /translation="MQAQIITQFGSPAVFETADISIPPVQPNHVLIRVMATSVNPVDYK
FT                   IRQGAVPDIAPDFPAVLHGDVAGVVEAIGAGVTMFKPGDEVYACAGGVKGLGGAIAEYM
FT                   LADADLVAHKPKSLTMTEAAALPLVSITAWEGLIERAKVQPGQRVLVYGATGGVGHIGV
FT                   QLAKWAGATVYALVSSQEKGAIARTLGADFTINYRQQPVEEFVAEHTNGQGFDVVFDTV
FT                   GNDNLQNAFKAAKLNGTVVSIVSLSQQDLTLLHVKGLTLHLVYMLIPLLYRVGRSRHGE
FT                   ILTQLAQLADAGQVQPLLDDKRFKFSEVAAAHQRAEAGETIGKVVLQQE"
FT                   /protein_id="YP_002478384.1"
FT   misc_feature    complement(164032..165015)
FT                   /note="Medium chain dehydrogenases/reductase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR6; cd08272"
FT                   /db_xref="CDD:176233"
FT                   /locus_tag="Cyan7425_5428"
FT   misc_feature    complement(164035..165015)
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="Cyan7425_5428"
FT   misc_feature    complement(order(164218..164226,164284..164289,
FT                   164344..164346,164350..164355,164428..164430,
FT                   164470..164472,164482..164487,164539..164544,
FT                   164548..164559,164620..164622,164632..164634,
FT                   164881..164883,164890..164898))
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176233"
FT                   /locus_tag="Cyan7425_5428"
FT   gene            165113..165562
FT                   /db_xref="GeneID:7280388"
FT                   /locus_tag="Cyan7425_5429"
FT   CDS_pept        165113..165562
FT                   /locus_tag="Cyan7425_5429"
FT                   /gene_family="HOG000293549" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_2865 HxlR family transcriptional regulator"
FT                   /db_xref="GI:219883223"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:7280388"
FT                   /translation="MVSKLNSDAPQLNYLPQPALDRIANMNLFDTSCAGHQMLEHIANK
FT                   WTMLIVYALTQGKKRYSELKQQIVGVSPKMLIQNLRNLERCGLIEREIYPTVPPRVDYS
FT                   LTPLGESLVEPLAILGEWAYRHIPEVKAAMEQYDDNTKENYWKPK"
FT                   /protein_id="YP_002478385.1"
FT   misc_feature    165188..165535
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Cyan7425_5429"
FT   gene            165738..165902
FT                   /db_xref="GeneID:7280389"
FT                   /locus_tag="Cyan7425_5430"
FT   CDS_pept        165738..165902
FT                   /locus_tag="Cyan7425_5430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883224"
FT                   /db_xref="GeneID:7280389"
FT                   /translation="MNVIQSLIATGTITVAFSTLSANVSLSYLPIALAETVNPALVTVG
FT                   SSQLMAKLG"
FT                   /protein_id="YP_002478386.1"
FT   sig_peptide     165738..165803
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.388 at
FT                   residue 22"
FT                   /locus_tag="Cyan7425_5430"
FT   gene            complement(165929..166486)
FT                   /db_xref="GeneID:7280390"
FT                   /locus_tag="Cyan7425_5431"
FT   CDS_pept        complement(165929..166486)
FT                   /locus_tag="Cyan7425_5431"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: pna:Pnap_4123 resolvase, N-terminal
FT                   domain"
FT                   /db_xref="GI:219883225"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:7280390"
FT                   /translation="MLIGYARVSTHDQNLDLQIEALTQAGCHKVFTDKSSGSRAERPGL
FT                   AKALEMLRQGDSLVVWKLDRLGRSVKHLVDLVGELRQQDIQFKSLTDAIDTATPSGRFF
FT                   FHVMASLAEMERELTVERTRAGLEAARQLGRKGGRKRRMTDSKIESAKKLLANGVPPRD
FT                   VAKNLDISVPTLYRWIPASANP"
FT                   /protein_id="YP_002478387.1"
FT   misc_feature    complement(165932..166486)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(166109..166483)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166283..166285,166292..166297,
FT                   166460..166462,166466..166468))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(166460..166462)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166142..166144,166154..166159,
FT                   166163..166168,166298..166300))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166136..166138,166145..166147,
FT                   166154..166159,166166..166171,166178..166180,
FT                   166262..166267,166280..166282))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166121..166123,166133..166135,
FT                   166142..166144,166154..166156,166163..166168,
FT                   166175..166180,166205..166213))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166121..166123,166133..166135,
FT                   166142..166144,166154..166156,166163..166165,
FT                   166211..166213))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(166118..166123,166139..166141))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(165950..166060)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Cyan7425_5431"
FT   misc_feature    complement(order(165953..165961,165965..165970))
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Cyan7425_5431"
FT   gene            166640..169597
FT                   /db_xref="GeneID:7280391"
FT                   /locus_tag="Cyan7425_5432"
FT   CDS_pept        166640..169597
FT                   /locus_tag="Cyan7425_5432"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   bvi:Bcep1808_7218 transposase Tn3 family protein"
FT                   /db_xref="GI:219883226"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7280391"
FT                   /translation="MPRRSILSAMERDSLLTLPDAQDELIRHYTFNESDLSIIRQHRGA
FT                   ANRLGFAIQLCYMRYPGIILGVGQSPFPPLLSFVAEQIQVPVGAWDEYGRRDQTRREHL
FT                   AELQTVFGFQLFNLSHYRQAIETLTKLALQTDKGIVLASALIEHLRRQRIILPAMNTIE
FT                   RASAEAVTQANRQIDAALTDSLSAIHRQRLDHLLTLRDNSKMTWLAWLRQSPTRPNSRY
FT                   MLEHIERLKVWQQLDLPAGINQQVHQNRLLKIARESGQMTPADLAKFGAQHRYAALVAQ
FT                   ALEGTATVTDEIIDLHDHIFGKLLNAAKNKHQQQFQASGKAINDKVRLYGCIGQALLEA
FT                   KENGADPFAAIESVLPWDLFAVSVNEAKQLAQPEEFDFLYRLGEGYPTLRRYAPEFLDI
FT                   LNLRAAPTAKGLLDAVNVLRRMNAENTRKVPPDAPIEFIKKRWRKLVLTHDGIDRRYYE
FT                   LCVFSELKNALRSGDIWVQGSRQFKDFDTYLIPSEKFTALKLTHQLPLAVADNCEEYLH
FT                   ERLSRLEQQLETVNRMADANDLPEAIITEAGLKITPLDTAVPDAAQALIKQTAAWLPHV
FT                   KITELLLEVDEWTDFTRHFTHLKTGDTAKDKTLLLTTILADAINLGLTKMAESCPGMTY
FT                   AKLSWLQAWHIRDETYSMALAELVNAQYHHPFAQHWGDGKSSSSDGQRFPTGGKAESTG
FT                   HINPKYGSDPGRMFYTHISDQYTPFSAKVVNVGVRDSTYILDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFAMMHLLSFRFAPRIRDLKDTKLYVPKNGQDYSALKPMMGGTLNIKHIREH
FT                   WDDILRLAASIKQGTVTASLMMRKLSSYPRQNGLSIALRELGRIERTLFMLDWLQSVEL
FT                   RRRVNAGLNKGEARNALARAVSFNRLGEIRDRSFDQQRYRASGLTLVTAAIVLWNTVYL
FT                   EQATHVLQDRQPLDDTLFQYLSPLGWEHINLTGDYVWRRNTKVSAEKKFRSLRNP"
FT                   /protein_id="YP_002478388.1"
FT   misc_feature    166640..169534
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Cyan7425_5432"
FT   misc_feature    166640..>167275
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Cyan7425_5432"
FT   misc_feature    168512..169480
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Cyan7425_5432"
FT   gene            169694..170092
FT                   /db_xref="GeneID:7280392"
FT                   /locus_tag="Cyan7425_5433"
FT   CDS_pept        169694..170092
FT                   /locus_tag="Cyan7425_5433"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_5843"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_5843 hypothetical protein"
FT                   /db_xref="GI:219883227"
FT                   /db_xref="GeneID:7280392"
FT                   /translation="MVGNLYLPTSYQPGDKLPVIIVTGAWTTVKEQMPAVYAQRLADRG
FT                   FAAFTFDFRYWGESGGTPRQYESPTAKVQDIKNAVAFLQTLPVIDGDRIGGLGICASAD
FT                   YMAQAVVEVTFSCDGFPLCIAESLSPFV"
FT                   /protein_id="YP_002478389.1"
FT   misc_feature    169709..>169993
FT                   /note="Dienelactone hydrolase family; Region: DLH;
FT                   pfam01738"
FT                   /db_xref="CDD:145081"
FT                   /locus_tag="Cyan7425_5433"
FT   gene            170660..171061
FT                   /db_xref="GeneID:7280393"
FT                   /locus_tag="Cyan7425_5434"
FT   CDS_pept        170660..171061
FT                   /locus_tag="Cyan7425_5434"
FT                   /gene_family="HOG000087957" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_4975 response regulator"
FT                   /db_xref="GI:219883228"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:7280393"
FT                   /translation="MRVLIVDSYPVAGAALAWELEGYGVETRIVDTIARAEAEIAALKP
FT                   DVLVTELFLQDGDYLALTLYRRLFPIILLTHDLAAYDADVKSTVDAYLCKPSQAIDLIA
FT                   VAGNFISERPYCILRERESCLRFCPVPNR"
FT                   /protein_id="YP_002478390.1"
FT   misc_feature    170669..170974
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5434"
FT   misc_feature    order(170678..170683,170810..170812,170882..170884,
FT                   170933..170935,170942..170947)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5434"
FT   misc_feature    170810..170812
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5434"
FT   misc_feature    order(170819..170824,170828..170833)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5434"
FT   misc_feature    170942..170950
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_5434"
FT   gene            complement(171521..171970)
FT                   /db_xref="GeneID:7280394"
FT                   /locus_tag="Cyan7425_5435"
FT   CDS_pept        complement(171521..171970)
FT                   /locus_tag="Cyan7425_5435"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin domain protein; Cupin 2 conserved barrel
FT                   domain protein; KEGG: npu:Npun_F1433 cupin 2
FT                   domain-containing protein"
FT                   /db_xref="GI:219883229"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:7280394"
FT                   /translation="MKVLRSQAGQNLQVLSDRVCIKLKSAASPNRMAVMTIEVPPEGFV
FT                   PPHTHDKEEESYFVLEGTMMMQLGDQELAIEPGDFVYIPAGTVHGYKNGSNQCVRFLAW
FT                   SIGGAIDEFFAEMAEKVIELPEDLPKMPTILNKYGIRMVEPSITG"
FT                   /protein_id="YP_002478391.1"
FT   misc_feature    complement(171659..171868)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Cyan7425_5435"
FT   gene            complement(172063..173025)
FT                   /db_xref="GeneID:7280395"
FT                   /locus_tag="Cyan7425_5436"
FT   CDS_pept        complement(172063..173025)
FT                   /locus_tag="Cyan7425_5436"
FT                   /gene_family="HOG000025244" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce7792"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce7792 hypothetical protein"
FT                   /db_xref="GI:219883230"
FT                   /db_xref="GeneID:7280395"
FT                   /translation="MDIAIFSSQELPLVLRSLVTVAANPEALTPREQQFLEIVAALHQG
FT                   KRDLAATAVTPFQVAQSILQEHHCRRLLQLAIIMAMVDGETTPQQQQALKELARALSVH
FT                   EQGLQVLQEAMSGHQRLAQFKMMRRMMSQIVVPALHEEGIAGVKKIIASLFFKSSEDPA
FT                   IAQKYHQLGQLPRGTLGHTFWQHYSQNGFPFPGEAGGIPERLVFHDLGHILSGYDTTPQ
FT                   GEIQQGAFQAGFIRKDGFAFLLFVILHFHWNIKITPIADPAQGLFNIPLVIHALQRGAA
FT                   CSVDLSDHWNFWEVMDLPLDMVRDHYHIPPLQPALLVAT"
FT                   /protein_id="YP_002478392.1"
FT   misc_feature    complement(172723..>172983)
FT                   /note="tellurium resistance terB-like protein; Region:
FT                   terB_like; cl11965"
FT                   /db_xref="CDD:159653"
FT                   /locus_tag="Cyan7425_5436"
FT   misc_feature    complement(order(172756..172758,172777..172779,
FT                   172786..172788))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143581"
FT                   /locus_tag="Cyan7425_5436"
FT   misc_feature    complement(<172336..>172518)
FT                   /note="Coenzyme Q (ubiquinone) biosynthesis protein Coq4;
FT                   Region: Coq4; cl02093"
FT                   /db_xref="CDD:154740"
FT                   /locus_tag="Cyan7425_5436"
FT   gene            complement(173054..173251)
FT                   /db_xref="GeneID:7280396"
FT                   /locus_tag="Cyan7425_5437"
FT   CDS_pept        complement(173054..173251)
FT                   /locus_tag="Cyan7425_5437"
FT                   /gene_family="HOG000242985" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_1597"
FT                   /codon_start="1"
FT                   /product="PGR5 protein involved in cyclic electron flow"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_1597 PGR5 protein involved in cyclic
FT                   electron flow"
FT                   /db_xref="GI:219883231"
FT                   /db_xref="GeneID:7280396"
FT                   /translation="MFAPIVIWIRNWMGQPKFNHLRSKLIARHLQVITQVCDRCGVAIH
FT                   IRQRLIHIAHDNGKKLGFLA"
FT                   /protein_id="YP_002478393.1"
FT   gene            173419..174420
FT                   /db_xref="GeneID:7280397"
FT                   /locus_tag="Cyan7425_5438"
FT   CDS_pept        173419..174420
FT                   /locus_tag="Cyan7425_5438"
FT                   /gene_family="HOG000225898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: scl:sce8943 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="GI:219883232"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:7280397"
FT                   /translation="MQNSVSVKLVQAILEAAAHCGLDVNDLLTALRLAPGCLEDVDGRI
FT                   PHEQFCALWQLITQRSKSGCIGLQMATAAKPKTWDVLGYAMHSSANLGEAFERLVRYSR
FT                   LRHTGAEFTFEVRRDIARITMAIPNTLLPPNDAMGEWVGANFVLLSRRLTGLDIVPLQM
FT                   GFQHPKPEDVSAYHRLFRSPLAFDHPVNEMRLDAALIQNPLAQADPGLSSILDRHAEEL
FT                   LARLPQSESLLDSVNRLLSQALRGGDPSLVAIAQQLGYTPRTLQRKLQEAGTSYHSLLD
FT                   EMRRELSIYYLREAQIAISEIAFLLGFSETSAFHRAFRRWMGVSPGDFRRSA"
FT                   /protein_id="YP_002478394.1"
FT   misc_feature    174160..174408
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Cyan7425_5438"
FT   misc_feature    <174313..174411
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Cyan7425_5438"
FT   gene            complement(174563..175461)
FT                   /db_xref="GeneID:7280398"
FT                   /locus_tag="Cyan7425_5439"
FT   CDS_pept        complement(join(174563..174982,174985..175461))
FT                   /locus_tag="Cyan7425_5439"
FT                   /gene_family="HOG000057827" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_BF211"
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_BF211 transposase, IS4 family
FT                   protein"
FT                   /db_xref="GI:219883233"
FT                   /db_xref="GeneID:7280398"
FT                   /translation="MLSLDRILNNDRLLRAMTGLNRQAFEALLPSFAQAYEQRQTQPAA
FT                   ERQRAPGGGRKATLRTTRDKLFYILLYCKCYPTFDLMSVLFGFDRSCAWDWVHGLLPIL
FT                   EQALGHKQALPERKLRSLEEFVERFAGVEEVIVDGMERPIQRPQDAQRQKEHYSGKKRH
FT                   TRKHITGSTRQKRVIILTKARAGTVHDKRQLDEEELVENIPDEVRVEGDLGFQGLQHEF
FT                   VNIRIPHKKPKGKELSEQQKQENREFSRQRVKCEHAHAGIKRYQSVATVYRNRVPDFDD
FT                   RLMLNATGLWNFYLDAA"
FT                   /protein_id="YP_002478395.1"
FT   gene            175676..175822
FT                   /db_xref="GeneID:7280399"
FT                   /locus_tag="Cyan7425_5441"
FT   CDS_pept        175676..175822
FT                   /locus_tag="Cyan7425_5441"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883234"
FT                   /db_xref="GeneID:7280399"
FT                   /translation="MDIMHTSVQPYRFTLSLKSFASLIFLYRIRQRYRDTGKKVQDELK
FT                   SLI"
FT                   /protein_id="YP_002478396.1"
FT   gene            176360..176626
FT                   /db_xref="GeneID:7280400"
FT                   /locus_tag="Cyan7425_5442"
FT   CDS_pept        176360..176626
FT                   /locus_tag="Cyan7425_5442"
FT                   /gene_family="HOG000022594" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gsl3522"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gsl3522 hypothetical protein"
FT                   /db_xref="GI:219883235"
FT                   /db_xref="GeneID:7280400"
FT                   /translation="MDIDKLQQIQTHARAIAALLYDETAPEQLTTLEGIEQAVRGHILE
FT                   HVSPEIGNFLLQRQVEQTVGEVGNSKASSEPSASVNSKRKSFK"
FT                   /protein_id="YP_002478397.1"
FT   gene            176641..177420
FT                   /db_xref="GeneID:7280401"
FT                   /locus_tag="Cyan7425_5443"
FT   CDS_pept        176641..177420
FT                   /locus_tag="Cyan7425_5443"
FT                   /gene_family="HOG000036700" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MAE_08640"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_08640 hypothetical protein"
FT                   /db_xref="GI:219883236"
FT                   /db_xref="GeneID:7280401"
FT                   /translation="MSPYLEKCCLLVSANVSYERAVEDVTVLTGMAVSRGTQQRLVQRH
FT                   PFKLPRAEDSVEEISVDGGKVRIRTPKGEICRWQDYKAVNLHGHYCEAFLQDNEQLIEW
FT                   VNGQPLATPVVCLGDGHDGIWNLFREIASPSQRQEILDWFHLVENLHKVGGSLQRLATV
FT                   ETRLWKGEVDAAIEQFKDWQHEQVDTFIAYLNKHRHRIVNYAYYQAEGISIGSGRIEST
FT                   VKQIGARMKLSGAQWKAENVPQALLHRCAYLNGQFSS"
FT                   /protein_id="YP_002478398.1"
FT   gene            178110..178604
FT                   /db_xref="GeneID:7280402"
FT                   /locus_tag="Cyan7425_5444"
FT   CDS_pept        178110..178604
FT                   /locus_tag="Cyan7425_5444"
FT                   /gene_family="HOG000251237" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03364"
FT                   /codon_start="1"
FT                   /product="cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: npu:Npun_R6238
FT                   cyclase/dehydrase"
FT                   /db_xref="GI:219883237"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="GeneID:7280402"
FT                   /translation="MAQPIKVERTVTIEKSAEDLYRFWHNLENLPRFTRHLKSVNVYED
FT                   GRSHWVTSAPLGNSVEWDARITEDRPNEMIAWTSLEGADIANSGSVHFQPAPGDRGTEV
FT                   KVVTAYNPPAGAIGDAIATLFGENPKQQIGDDLARFKMLMEAGEIATNDGQPSGRRNSK
FT                   D"
FT                   /protein_id="YP_002478399.1"
FT   misc_feature    178125..178547
FT                   /note="Ligand-binding SRPBCC domain of an uncharacterized
FT                   subfamily of proteins; Region: SRPBCC_8; cd07817"
FT                   /db_xref="CDD:176859"
FT                   /locus_tag="Cyan7425_5444"
FT   misc_feature    order(178128..178130,178134..178136,178140..178142,
FT                   178167..178175,178179..178184,178227..178229,
FT                   178245..178247,178251..178253,178257..178259,
FT                   178263..178265,178299..178301,178305..178307,
FT                   178314..178316,178332..178334,178338..178340,
FT                   178371..178376,178380..178382,178386..178388,
FT                   178419..178421,178425..178427,178431..178433,
FT                   178437..178439,178482..178496,178500..178508,
FT                   178512..178520,178527..178529)
FT                   /note="putative hydrophobic ligand binding site; other
FT                   site"
FT                   /db_xref="CDD:176859"
FT                   /locus_tag="Cyan7425_5444"
FT   gene            178610..179782
FT                   /db_xref="GeneID:7280403"
FT                   /locus_tag="Cyan7425_5445"
FT   CDS_pept        178610..179782
FT                   /locus_tag="Cyan7425_5445"
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ana:alr0895 alcohol dehydrogenase"
FT                   /db_xref="GI:219883238"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:7280403"
FT                   /translation="MKAACWYGTEDVRVETVPDPKILNPRDATVKVTSTTICGSDLHIY
FT                   DGYIPTMQPGDIIGHEFMGEIVEVGSEVKRLKKGDRTVVSSAIGCGHCWYCKQQQWSLC
FT                   DNSNPNGWMQEAVYGYGTGAIFGYSHAFGGYAGSFADYIRVPFADFTAIPVPKDIPDEK
FT                   LLPVSDAFPTGYMGADLCNIQPGDVVAVWGCGPVGQFAMRSAYLLGAERVIGIDRFPER
FT                   LQLARDFAKAETINYEEVDAGEALKEMTGGMGPDACIDAVGMEAHGTGLEGVYDKAKQA
FT                   VRLETDRPHVLRQMMVACRKGGTLSIMGVYGGFVDKLPMGAAMNKALTFRSGQMFGPKY
FT                   IPKLVEHVLNGDVDPSAVLTHRLPLAEIKQGFEMFKHKKDQCIKVMLQPA"
FT                   /protein_id="YP_002478400.1"
FT   misc_feature    178610..179776
FT                   /note="Glutathione-dependent formaldehyde dehydrogenase
FT                   related proteins, child 1; Region: FDH_like_1; cd08283"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5445"
FT   misc_feature    178610..179776
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="Cyan7425_5445"
FT   misc_feature    order(178721..178729,178736..178738,178865..178867,
FT                   179114..179116,179126..179128,179183..179188,
FT                   179192..179200,179255..179263,179273..179275,
FT                   179318..179320,179390..179398,179480..179482,
FT                   179531..179539,179606..179614,179732..179734)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5445"
FT   misc_feature    order(178721..178723,178727..178729,178787..178789,
FT                   179114..179116)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5445"
FT   misc_feature    order(178877..178882,178886..178888,178895..178897,
FT                   178919..178921)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5445"
FT   gene            179816..180994
FT                   /db_xref="GeneID:7280404"
FT                   /locus_tag="Cyan7425_5446"
FT   CDS_pept        179816..180994
FT                   /locus_tag="Cyan7425_5446"
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   npu:Npun_R2418 alcohol dehydrogenase"
FT                   /db_xref="GI:219883239"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:7280404"
FT                   /translation="MKAICWQGANKVGVDTVPDPKIINPRDAVIKITSTAICGSDLHLY
FT                   DGYIPTMEQGDILGHEFMGEVVEVGSEVKRIKVGDRVVNPFPIACGQCFFCKQSLTSLC
FT                   DNTNPNAFMAEAIMGYSPSGIFGYSHMLGGYAGGQAEYARVPFADVGLLKIPDGLADEQ
FT                   VLFLSDIFPTGYMAAENCNIQPGHIVAIWGCGPVAQFAIRSAFLLGAERVIAIDRVPER
FT                   LQMAKDGGAEVLNYEQVDVGEALKEMTGGRGPDAVMDAVGMESHGMGLEGLYDQAKQAV
FT                   RLETDRPHALRQAIVACRKGGTVSVPGVFGGFADKIPMGAFMNKALTMKTGQTHVHRYL
FT                   TPLLEHVQNGDIDPSFVITHRLPLEQAPDGYEIFKHKKDHCIKVVLKPGQSA"
FT                   /protein_id="YP_002478401.1"
FT   misc_feature    179816..180979
FT                   /note="Glutathione-dependent formaldehyde dehydrogenase
FT                   related proteins, child 1; Region: FDH_like_1; cd08283"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5446"
FT   misc_feature    179816..180979
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="Cyan7425_5446"
FT   misc_feature    order(179927..179935,179942..179944,180071..180073,
FT                   180320..180322,180332..180334,180389..180394,
FT                   180398..180406,180461..180469,180479..180481,
FT                   180521..180523,180593..180601,180683..180685,
FT                   180734..180742,180809..180817,180935..180937)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5446"
FT   misc_feature    order(179927..179929,179933..179935,179993..179995,
FT                   180320..180322)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5446"
FT   misc_feature    order(180083..180088,180092..180094,180101..180103,
FT                   180125..180127)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Cyan7425_5446"
FT   gene            181345..182457
FT                   /db_xref="GeneID:7280405"
FT                   /locus_tag="Cyan7425_5447"
FT                   /pseudo
FT   gene            complement(182716..186465)
FT                   /db_xref="GeneID:7280427"
FT                   /locus_tag="Cyan7425_5448"
FT                   /pseudo
FT   gene            183354..184904
FT                   /db_xref="GeneID:7280428"
FT                   /locus_tag="Cyan7425_5449"
FT                   /pseudo
FT   gene            184936..185646
FT                   /db_xref="GeneID:7280429"
FT                   /locus_tag="Cyan7425_5450"
FT   CDS_pept        184936..185646
FT                   /locus_tag="Cyan7425_5450"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: amr:AM1_H0075
FT                   transposase-associated ATP-binding protein, putative"
FT                   /db_xref="GI:219883240"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:7280429"
FT                   /translation="MDHLDAIEHQATQQNWSYGQFLLHLCHLEAQRREHVRLQRSLSEA
FT                   QLPAAKSFTNFDFSHCPQFNPAPLMQLAQATDWLARAQNCILLGPSGVGKTHLAASLAR
FT                   RCIELGKRVKFFAATALVQQLQDAKLQLQLYPLLKKLDRYDLLVLDDLGYVKKNETETS
FT                   VLFELIAHRYERKSLLITANQPFSQWDSIFSDSMMTVAAIDRLVHHGVIIDVQAPSYRK
FT                   AAASQRLTQSAATA"
FT                   /protein_id="YP_002478402.1"
FT   misc_feature    184963..185619
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Cyan7425_5450"
FT   misc_feature    185140..>185274
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5450"
FT   misc_feature    185200..185223
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5450"
FT   misc_feature    185203..185226
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_5450"
FT   gene            complement(186739..188382)
FT                   /db_xref="GeneID:7280406"
FT                   /locus_tag="Cyan7425_5451"
FT   CDS_pept        complement(186739..188382)
FT                   /locus_tag="Cyan7425_5451"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_R1868 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="GI:219883241"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:7280406"
FT                   /translation="MLNWFTANPFIPHGHCYLWQPALVSLHLLSDALIALAYYSIPLTL
FT                   LYFIRKRQDIPFPQIFSLFIAFIIACGTTHLMEIWTLWHPTYWLSGVLKAGTAFVSVLT
FT                   AFELVPIIPKALALPSPTQLEQSNAFLQSQIEERLRVEDELRHFQNELEQRVQARTAEL
FT                   VTVNQQLQREIEERRQTMVTLRESEERLRFALLASRMGMWDWNLQGQQVQWSDNLETLF
FT                   GLGPGEFDGSYAMFINRLHPEDKEPVQAAINHSIATGQNYDIEFRTLLPDGKIRWLLSQ
FT                   GKVFYDPNGQPARMAGINIDITERKSIENNLRQLTLELEERVQERTAALEASLQEKVLL
FT                   LREIHHRVKNNLQIVSSLLMLQSDTITDPYVTKVLQESQERIQSIALVHEHLYSSPNLS
FT                   QIDFSSYIEKLVKSLFTTWGNPNLKLHFDLESTVINLETAFPCGLLINELVSNALIHAF
FT                   PNQIKGNIWVVFRAAAAGFILVVKDDGIGLPEQLDYRNTESLGMQLICDLSQQLNGTLS
FT                   LMPLQEDDNCGRRGTCFKLDFQELIYRKRL"
FT                   /protein_id="YP_002478403.1"
FT   misc_feature    complement(187477..187791)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(187486..187743)
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(order(187564..187566,187579..187581,
FT                   187657..187668,187711..187713,187729..187731,
FT                   187741..187743))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(order(187537..187539,187543..187545,
FT                   187627..187632,187639..187641,187663..187665,
FT                   187675..187677))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(186745..187425)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: COG3920"
FT                   /db_xref="CDD:33706"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(187129..187356)
FT                   /note="Histidine kinase; Region: HisKA_2; cl06527"
FT                   /db_xref="CDD:157259"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(186769..187050)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(order(186781..186783,186787..186792,
FT                   186805..186807,186829..186831,186877..186885,
FT                   186919..186924,186928..186930,186934..186936,
FT                   186940..186942,187018..187020,187027..187029,
FT                   187039..187041))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(187027..187029)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5451"
FT   misc_feature    complement(order(186880..186882,186922..186924,
FT                   186928..186930))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_5451"
FT   gene            complement(188901..189074)
FT                   /db_xref="GeneID:7280407"
FT                   /locus_tag="Cyan7425_5452"
FT   CDS_pept        complement(188901..189074)
FT                   /locus_tag="Cyan7425_5452"
FT                   /gene_family="HOG000087981" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883242"
FT                   /db_xref="GeneID:7280407"
FT                   /translation="MKAPQINLPALLLAFAITGLIADTMPVPGLRAGVIAQTSNWVTAT
FT                   IQAPATAAVAPR"
FT                   /protein_id="YP_002478404.1"
FT   sig_peptide     complement(189006..189074)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.915 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_5452"
FT   gene            complement(189315..189557)
FT                   /db_xref="GeneID:7280408"
FT                   /locus_tag="Cyan7425_5453"
FT   CDS_pept        complement(189315..189557)
FT                   /locus_tag="Cyan7425_5453"
FT                   /gene_family="HOG000225392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00530"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   syf:Synpcc7942_0764 XRE family transcriptional regulator"
FT                   /db_xref="GI:219883243"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:7280408"
FT                   /translation="MDIEKEGANPLKIYCRLAVLMAEKDPKLSQHKLADDTGLGITTVN
FT                   RLFNNKFSRVDTHTIEVLCRYFECKVDDLLVLRQS"
FT                   /protein_id="YP_002478405.1"
FT   misc_feature    complement(189330..189521)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Cyan7425_5453"
FT   gene            complement(190498..190647)
FT                   /db_xref="GeneID:7280409"
FT                   /locus_tag="Cyan7425_5454"
FT   CDS_pept        complement(190498..190647)
FT                   /locus_tag="Cyan7425_5454"
FT                   /gene_family="HOG000088151" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883244"
FT                   /db_xref="GeneID:7280409"
FT                   /translation="MDPNKTSQVSNDENLNEIQDDEELDLGQDELNKIAGGLASTKNGK
FT                   TIVD"
FT                   /protein_id="YP_002478406.1"
FT   gene            complement(190860..191039)
FT                   /db_xref="GeneID:7280410"
FT                   /locus_tag="Cyan7425_5455"
FT   CDS_pept        complement(190860..191039)
FT                   /locus_tag="Cyan7425_5455"
FT                   /gene_family="HOG000087999" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883245"
FT                   /db_xref="GeneID:7280410"
FT                   /translation="MMNIPGQNIAQTSLATEVKDESLMLDDQTDEMLTPEELRQISGGA
FT                   IVFVGGWGASQYQY"
FT                   /protein_id="YP_002478407.1"
FT   gene            complement(191318..191467)
FT                   /db_xref="GeneID:7280411"
FT                   /locus_tag="Cyan7425_5456"
FT   CDS_pept        complement(191318..191467)
FT                   /locus_tag="Cyan7425_5456"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883246"
FT                   /db_xref="GeneID:7280411"
FT                   /translation="MVDPNENPKEQSEEIDKEASQEEESDLGAEELNRVAGGAACPGTV
FT                   NPKN"
FT                   /protein_id="YP_002478408.1"
FT   gene            complement(191680..191781)
FT                   /db_xref="GeneID:7280412"
FT                   /locus_tag="Cyan7425_5457"
FT   CDS_pept        complement(191680..191781)
FT                   /locus_tag="Cyan7425_5457"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883247"
FT                   /db_xref="GeneID:7280412"
FT                   /translation="MPVPGLRAGVVAKTANWVTATIQAPAAAALAPR"
FT                   /protein_id="YP_002478409.1"
FT   gene            192261..192527
FT                   /db_xref="GeneID:7280413"
FT                   /locus_tag="Cyan7425_5458"
FT   CDS_pept        192261..192527
FT                   /locus_tag="Cyan7425_5458"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all9002 unknown protein"
FT                   /db_xref="GI:219883248"
FT                   /db_xref="GeneID:7280413"
FT                   /translation="MGGEENIAPTPPFTEEPEAEPIQLSDALVHELSEVGVRLNKELLS
FT                   AVSSGIGLIAGIATFASLQGLHEVTIEIDANGKLRIKITPKKR"
FT                   /protein_id="YP_002478410.1"
FT   gene            complement(192805..193083)
FT                   /db_xref="GeneID:7280414"
FT                   /locus_tag="Cyan7425_5459"
FT   CDS_pept        complement(192805..193083)
FT                   /locus_tag="Cyan7425_5459"
FT                   /gene_family="HOG000225392" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: syf:Synpcc7942_0764 XRE family transcriptional
FT                   regulator"
FT                   /db_xref="GI:219883249"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:7280414"
FT                   /translation="MLYISLLKGELIMGVMNNGAGSLKIYCRLAVLMAEKDPKLFQHKV
FT                   AFDTGLAITTINRLFNNKFDRMDIHTLEVLCQYFGCNISDLITLRQS"
FT                   /protein_id="YP_002478411.1"
FT   misc_feature    complement(192823..193011)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Cyan7425_5459"
FT   gene            193621..193995
FT                   /db_xref="GeneID:7280415"
FT                   /locus_tag="Cyan7425_5460"
FT   CDS_pept        193621..193995
FT                   /locus_tag="Cyan7425_5460"
FT                   /gene_family="HOG000088070" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883250"
FT                   /db_xref="GeneID:7280415"
FT                   /translation="MTTAAHQNLIVSRVRVHRHLRILACDGQCGKAWGIHRRPKIQFDD
FT                   NDPDDYAWFADSEIGTAPVDPGTEEDGDSKPLNRIHNRWCYLECERSDCRPVEKFRAIQ
FT                   LPDFTDRIYNQPSKHPPREP"
FT                   /protein_id="YP_002478412.1"
FT   gene            194203..194379
FT                   /db_xref="GeneID:7280416"
FT                   /locus_tag="Cyan7425_5461"
FT   CDS_pept        194203..194379
FT                   /locus_tag="Cyan7425_5461"
FT                   /gene_family="HOG000087999" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883251"
FT                   /db_xref="GeneID:7280416"
FT                   /translation="MMNIPGQNTAQTSLAAEVMDEFLTLADQTDEMLTPEELRQISGGI
FT                   LIGLLLPAVQSAR"
FT                   /protein_id="YP_002478413.1"
FT   gene            194741..194887
FT                   /db_xref="GeneID:7280417"
FT                   /locus_tag="Cyan7425_5462"
FT   CDS_pept        194741..194887
FT                   /locus_tag="Cyan7425_5462"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883252"
FT                   /db_xref="GeneID:7280417"
FT                   /translation="MDSNRASQQSDEQLNQVKVEEEQDLELNADDLKDVAGGAIMHDRK
FT                   GNL"
FT                   /protein_id="YP_002478414.1"
FT   gene            194943..195092
FT                   /db_xref="GeneID:7280418"
FT                   /locus_tag="Cyan7425_5463"
FT   CDS_pept        194943..195092
FT                   /locus_tag="Cyan7425_5463"
FT                   /gene_family="HOG000088151" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883253"
FT                   /db_xref="GeneID:7280418"
FT                   /translation="MDPKKNSKMSNDENLHEIQDDEELDLGQDELNKIAGGLASTKDGK
FT                   TIVD"
FT                   /protein_id="YP_002478415.1"
FT   gene            195270..195461
FT                   /db_xref="GeneID:7280419"
FT                   /locus_tag="Cyan7425_5464"
FT   CDS_pept        195270..195461
FT                   /locus_tag="Cyan7425_5464"
FT                   /gene_family="HOG000088088" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883254"
FT                   /db_xref="GeneID:7280419"
FT                   /translation="MDRQNLQPQQAQPIHRTTAGQLPAKQAELSEEILSNSCVISSHYL
FT                   GTAWTGCSECSYDGDEAE"
FT                   /protein_id="YP_002478416.1"
FT   misc_feature    195270..195371
FT                   /note="bacteriocin leader peptide,
FT                   microcyclamide/patellamide family; Region: het_cyc_patell;
FT                   TIGR03678"
FT                   /db_xref="CDD:163391"
FT                   /locus_tag="Cyan7425_5464"
FT   gene            complement(195839..195973)
FT                   /db_xref="GeneID:7280420"
FT                   /locus_tag="Cyan7425_5465"
FT   CDS_pept        complement(195839..195973)
FT                   /locus_tag="Cyan7425_5465"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883255"
FT                   /db_xref="GeneID:7280420"
FT                   /translation="MEILGGFASADSQKKTRPVITADVAQMSDDELMQTIQAGLAGFG"
FT                   /protein_id="YP_002478417.1"
FT   gene            196184..196807
FT                   /db_xref="GeneID:7280421"
FT                   /locus_tag="Cyan7425_5466"
FT   CDS_pept        196184..196807
FT                   /locus_tag="Cyan7425_5466"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all7668 unknown protein"
FT                   /db_xref="GI:219883256"
FT                   /db_xref="GeneID:7280421"
FT                   /translation="MGRLSPESIDLSLICPYLLNLLNYQKWDSDSKPFLNDQIFSVANP
FT                   KPKGMVIQSFQTKPYLLVEMPPLVHEGIWNVFDQIKGEVERHEILDWYHLMENLEKVGG
FT                   SLQRLAQARSLLWQGKVDETLVLFEGCQRHQTHCFCQYLRKHRHRIGNYDYLQAEEICS
FT                   IGSGAVESTVKQIDRRLKISGARWKPEHVPTVLAHRCAYLNHQL"
FT                   /protein_id="YP_002478418.1"
SQ   Sequence 196837 BP; 50476 A; 48637 C; 47546 G; 50178 T; 0 other;
     TCCTCGTCGG CCCTGTCGCT TACCGCTTTC ATAATTCATA AGTGCCAATC CTATTAAACT        60
     CTTTTTCGAT AGTATAGTTC TTGAAAGACA ACTCTAAAGC AAGCTCCTGA GCCTCTTTGA       120
     GCAGGATTTT CGCCTTGGCT CAACATAATA GTCCCTCTCA GTTGACGAGT GAGATCGCTG       180
     ACGACCTGTA ATCCTAAAGA TGGAGATTGG CTCAAGTTCA GTCCTTCTGG CAAACCAATT       240
     CCGTTATCCC GAACGATCAA GCAATAGTGC TTTTTTTCTA ATTTAAAAGA TATCCAAATA       300
     TCTCCGGTTT CATGGCTTGG AAATGCATGC TTGAGGGCAT TTGACAGCAG CTCATTAACG       360
     ATCAGCCCAC AAGGCAGCGC TGTCTCAATG TTCAACGATA CGGCGTCTAG GTCCAGATGT       420
     AATCGCAGGT GCTGGCTGGA ATAGGTAGAA AAAATTTGCT CCGTTAGCCG CTTGAGATAC       480
     TGGTCAACCT CAATCCGCTC TAAACTTGGG GATTGGTAGA GCAGTTCGTG AACTAGGGCA       540
     ATGGTAGCAA TGCGGTCCTG ACTCTCCTGC AAGAGTTTTA AGGCAAGAGC ATCCTGCGTG       600
     GTTTCCGACT GGAGGTTGAG TAAGCTAGAG ACAACCGTCA GGTTATTTTT GACCCGGTGA       660
     TGAATTTCTT TGAGGAGAAG CTCTTTTTCT CGCAATGATT TTTTTAGCTT AGCTTCAGCC       720
     TGGGTTCTCT CCTGCAATTG AAGCTGCAAC TGTTGGTAAA GATCTGCCTG GTGAATCGCA       780
     ATGGCCATTC GCACGGCAAT TTGTTCCAAC AGTTCCACCT CCTCAACTTG CCATTCCCGA       840
     GGCGCTGAAT TTTGATAAGC CGCAAGGAGC CCCCACAACC GATTCTGTAC AAAAATCGGC       900
     ACAATGGCGT GGGCTTTGGC TTGGAATTGC TCCAAAAGCT CCAGATGGCA CGGGGTCAGT       960
     CCAGCGGTAT ACACGTCATT AAGGATGAAC GTCTCATGGT TCTGATAGCG TCCTCCCGCT      1020
     GTGGCTTGGA GGTAGGTATC TTCCCAGACT CTTTGGATAT GTGGTCCCAC CAGTGGAATC      1080
     CATGCTTCTC CTTTAGACTC CGCTACAAAC TGACCACTCC AATCGGGTTC AAATCGGTAA      1140
     ACCGCAACTC GGTCTGCCCT CATATTGGTT CTGACTTGAT GCAAGGTAGT GGTTAAGGTC      1200
     TCATCCAGAT TCAACGATTG ATGAATCAAA AGGGTAATTA ACTGCAGGGC CCGCTCCCGT      1260
     TCTGCCCGAT GCTGCTGGAT AGTTTCCGCC TGCTTGCGCG CTGCCAATTC CTGCTGGGAG      1320
     TTTTGATAAA GGGCGGATTG CTGGATGGCA ATGCCAAGAT GGGTGGCTAA TTCTTGCAGC      1380
     AACTCAACCT CGACGGGCTG CCACTGTCGA GGCGCTGCAC AGTGATGGGC AATTAGCAGT      1440
     CCCCACAATT GAGTGTTGGT ATTGATGGGG ACGACTAGAT TCGACCGGAC CTCCAAGTTG      1500
     GAGAGCAACT CGACATGACA AGGAGCGATG CTACCATCTT GAATATCGGG TTTAAGAGTG      1560
     ATCAAGCCCT GCCGGAAGAA ATCAGCATAG GTTTCATTAA AGCAAGGGTC ATAGTAGGAT      1620
     GTAGAAAGCA GAGCCGTCCA GTCTGCTCCA ACGGATTCAG TGCTCACCTT GCCCCAACCA      1680
     TCTGACTCCA AACGAAAGAT CAAAATCCGA TCCGTCTGGA GAAACTGTCG CACTTCGGTG      1740
     ACGGTCGTTT GCAAAATTTT CTCTAACTCT AGGCTGTTAT GGATCTTCCG GGTAAGTTGC      1800
     GTGCATAGTC GCTCTCGTTC AATCCGTTGG TCGAGTTCGG TGTGAAGCTG GATGGTCGCC      1860
     ATGGCACGAT CAACCGATGC ATGCAACACC TCTGGAGTCA CTTGCTCCTT CACTAAATAG      1920
     TCTTGAGCCC CCGCTTTCAT CACCTGGACT GCCGTCGCCG CATTGCCCTG GTTGGCAAAA      1980
     ACAATCACCG GTAAACAAAC CGGTACGTGT GACCGTGGAA TTAGAGAAGA TAATCGAGCT      2040
     AGAAATTCTA AGCTATTCAG ATCAGGTAGA GCATCATCTA GAAAGATAAG ATCAGGTCGA      2100
     TGCTGATCCC ACAATTCTAA ACCTCGTTCT GCCAGATCCG CTTCCAAACA ATGCCAGGAG      2160
     CCATCTAAGC CACTTTTAAG ATATTTCCGA TAAAGCTCTC GATCTTCAGG TGAATCATCA      2220
     ATAATTAAAA TTTTATGTGG GGACAAAACC ATAACAAATT TCCCACCTAG CCTAACAGTG      2280
     GGCACAGTTA AATCTCTCGT TGCGGTTTTT GGCAAGCCTT GACCGCAGCA ATGCTAATTT      2340
     CAGTTTAATC TTCTCTGATC TCATAACTTT AGTTTCTTAA ATATAAAAAG ACGGCAGAAC      2400
     AGCAAAGTTT TTTTGATTTG GTATAAACTT TTCCTCGTAC CACTTCAACA GCCTGCGGGC      2460
     TATTGGCTTA ACCCCTTTTG CCTGGGAGTA GGGAACTGAA ATAGCTTGTC CTGCTCTATC      2520
     ACACCATTTG AGCCAGGAGT CATCTGAACT GGCTTGCAGC GTTAAGACCT CATTCCGCCA      2580
     GTGGGCAAAC AGCGTAAGGT AGATGAAGGC TTTCCTATCC AAAAAAGCAA AAGTTGCAAT      2640
     AAAGTCCCCT TTTTTGTTGC GGAAATGCTC GTTTAAGGCA AATCCAGGGT GTCTAGCGCC      2700
     CCTATAAGCT TCAAAATGAA CTGTTAATTT ATCATCATAG ATGAATTGTA GGGGATAGCC      2760
     TGCTCGAAGG TAGTTGCAGT CGCTATCCGT TGGTTTAATC AAAAAACGTG TATCTGAAAA      2820
     GGTAGAGTTC GCGATCGACT CTAGTTCTTG AATAAGATTT ATCGGAACTA TATAGATCAT      2880
     TATTTTTCAA AAACGGTAGG TTCTAACTTT GACTGTCTTG AGCTTTTGCA GATGGATAAA      2940
     GTCTCAAGTT CCTGCTTACC GAATCTGGAG GATGCCCTTG CTGGTGGGGA TGGCTCTACA      3000
     ATCTCCTGAG CTAGTCACCG AATATCGTTG TCGATCGAAC ATATCACTGT TAGTCATAGC      3060
     TTGGTCTCAC TGGTGCTTTC TTTATCATCC AGTAGAACAC GGGAATCCTC CATCAGTTTT      3120
     TCCACAACGG CGTTCTCTTA AGGTTGGAAC AATAAACAAC GTTAAGCCTG TAATCCTTGC      3180
     TCTATAAGAC TTTCAGGCAT TTATTTTTCC AGATTTTTAG ACTTCAAAAT AGCTCTAATG      3240
     CTTGTTGCAC CTGACTTCCA AGAGTTTGAG AGGCAATCTA CTGTGACAAG CTTTCCCGAT      3300
     GAAGGGTAGA CAACTGCGAT AGGTGGATTG ATCTTGTGAC AGATAAACTC ATGCAGGGCA      3360
     ATCCGTCCCT CCCCTCCAAC CACTCCTGCT GATCTCAAGA CGAGGTGGTT TATCCAGTAG      3420
     GAGAAATTAA GGGAAATGGT TGTCCTCCTG CGTTAACCTG CAGAAGTGCC ACGGGAACAT      3480
     CGGCATTTCA GATGACAGAG AAAAAATAAA TCCAGTGCTG TACTAATGGA TTTTGAGTAG      3540
     TACGAAGTCC AAAATCAGTC CACCTTTGTA CTAATCCAGG GCTACGACCA TGATCGCTTT      3600
     GCCTGCAGCA CAGTATATTT ACGCCACTAC CTCAATATCG ACAATATATT AACCCTTACC      3660
     GCTTGGATTT AACCAAAAGC AAGACTAGGT AAGGGTTATG CTCATTAAGA CTTTTGGACA      3720
     ATATGCAAAA TTAGAGCCTA GAAGCCTTAC AGAGCAAAGG GTTTGGCCTT AGCGTTGTTC      3780
     TTTGTTCCAA CCTTAAGAGA ACCCCATGGT TGGCAGTGAA TAGCTGATTG GCTAGAGCTT      3840
     CTGACGTGCT TATCTGAGTG GAAAACGCTG TATCCCTTTT CTGCCACTCT AGTTAGGCAA      3900
     AATTGGGGTT GAACGCTCAA TCGATGGAGG AAGGGGCAAA AGAATTGATT CATCTGGTCA      3960
     ATCAAGGGAT AGCGACAGGA TACATGTAAA AACCTGCAAG ATGAGGTTCA ACAGATGTTA      4020
     ATCCCCGTCT GGGTAACACC TCCGGGAAAC GAGGCAGTGC CAGAATAGAA GTGAATTTCA      4080
     TATCACCGAA ATGCTTTCCC CTTAGTTGTA ATAACTAGGG GGTTCTTGTC TAGGGGATGA      4140
     ATTTTCTACC CGTTTGTCAA ATTCCCTATA CACTGAGATT TCACCACCAC TGCAGTCATG      4200
     GGCGACCTTG TCCCTCCAGC TATGCGGTGC AGTTCACCTA TCTCTAACCC CATTTCTTCC      4260
     TCCAGCGACG TTTCCTTGCT AAGTTCTTCA GATTGTCCAA AGGACGTTTC AGTTGGATTC      4320
     ATCGGGTATC TCCTAGTGGT ACGGTCGGTG TCTTTAAAGT ACAGTAAGCA AATTCAGCTC      4380
     ACAGTGTCCT CAGTCGCATC TACCTTGTAT CCCTTCCACT TTCATGTATA TTGCCCCACC      4440
     AGCAATACCT TTCAAGTCGT TTACATTCAG TTCTAGATCT TCATCTTCCC CTACCTTAAT      4500
     TTGGTTGAAC TGTTCATCGG ACGGCTGGGA GAAAATTTTG GCATTCATAG TTGGACTCCT      4560
     AGAACATTAG TAATTGCTTT AAGAGTATGA TCTGCACATT TGAGTTGTAG TGACATAGAT      4620
     CCGCTGAGAG AATGATCCTC CGCAGATAGA AGGTGTGATC TTGGTCGTTT TAATTAACTC      4680
     CACAGAGAGC TTTGACCTTA TGTTGTGCCC ATGGGCAACT TCCCATAATG CCGTCCCAAT      4740
     GGCAAAAATT CGTGCTCTCG CGTTTCAAAC GCTAGAGTTC CCGGAGTCGG GGAAAAGGTT      4800
     ATCCAGACTG CTTTCCAGGG ATTGTCCTGA AATCTGAGGG GTGTGCGATC GTCATCGAGC      4860
     CAGAACTGCC ACACCCTCTT CATGGGGGCA GCACGCATCC GTCATATCCC GCCGATAGTC      4920
     TTAGAACATC AAACCGATTC AATCTCACTC AGGAGAAAAA GCTATGAACA CTAAAACCAC      4980
     CAAAGAAGCC TTGATTGCCA AAGTTGCTGA CAAAATGAAA GCTGAAGTTA TCGGGTGCAT      5040
     CCTTGGAGCT GAACCAGTCA GTGCTGCCAC AGCTTTCTGC CAGATATTGT AATTGGGGTT      5100
     GCGACAGGAT ACATGTAAAA ACCTGCAAGA TAGCCCTCTA AGCCTTACTT AGCCTTGCTT      5160
     CCAGAGGGTG GTTTGACCTT ATAAGCAGTT CCACAATAGG AAAACTTCCA TGACAAAGTA      5220
     TGTAACCACT GAAGATCAGC GTTGGCAAGG AATCGATGTC CGAGGGGTAA CGATGGAAGC      5280
     CTGCCGTCTA TGGGAGGGAG ACTATAACGT GCGCTCCGGA TTTTTCCGTA TGCCCAAAGG      5340
     CATGCAAGTC CCCATGCACC ACCACCCTTA TTGGGTTCAG GTGTTTGTCA TGAGCGGGAA      5400
     GCTGGAAGTG GAGGCCGAAG GAGAGGAGGC ACACCCGATC GCAGCAGGCG GGTACTACTT      5460
     CGTCGAACCT GGGGAATCGC ATGTCGAAAC GGCTGTCGAA GATACCTTAC TCCTGGTTGT      5520
     ATCAGAAGAA GAACGGGAAG AGCTGCGTCT CAGACCGTCA ACGCATTAAG TAGAGTTAGT      5580
     AGGGATTGAA ACAGTATCCT GTTTCAATCC CTAATTAACA TTTAATAGCG TAGACAATAT      5640
     AGTTGCGGAT ATGTCTATTG CACGGGTGGG TTTGTTTAGC TTGCCCGTGC TTAGAATTTT      5700
     GAAAGAGTAC TGACTTTTAA GCAACCCGAT CTGGATAGCC GGAGATATTT TGTTTAGCAA      5760
     AAAGCAGTTG GCGGAATGAG AGCCTACTTG GGGCAAAGGG AGGGAGCCTG TAACAAAGTG      5820
     CCATGCACCT GCTGAAACCC ATGTGCAGTT AACGATCGAG CTAAAACATC CGAGATTTAG      5880
     CCACTTTCCC TTAAATGCTG GCTGGGGAAA CTCAACAGTT GAGGGCAGAA TGAGCGTTTC      5940
     AGTCCATTTT TTTCAAAAAC ATTCCTGTAA AAGACCATTT TCAGGGATAT TTAGGCTGAT      6000
     GAGGCAAAAT TTTTCTGAAA TCCTTGCTGT GCAGTACTTT CAGGCTGTAC GTGGTACTTC      6060
     ATCGCAGCTT TGCTGCCTCT CCCTAAATGA GACAATTTTT TTGGGTAACA CCCTCTGAAA      6120
     GCTGGTGAAA GCAGCGGGAA ACTAATCTCT AAGCGATTAG AACCCTTTAC CCTATTTGAG      6180
     CATGACCTCA ACTCTTCAAG CCGATTCTAA TAGGAGGATT CAACACCATG GCAGATAGTC      6240
     AATTCCTACC TCTGTTGACC AGAGTTGGCA CATGGGCAGT GGGTGGTTTG CTCGGAGGGT      6300
     TGGTCGGTTC CCTGGCTGCG GTGATGCTGA CGCAGATGAT TAAGCAAGTC CTTGATTTCG      6360
     TCTCCGGCTT GGATTCCCTC TGGATGCTGC TCCTGCCACT GCTCGGCGTT ACGTTAGCAG      6420
     TGCTCATCCT ATTTGGACTG GGTAAGGGGG CGCCTGTACA AACATTAGTT CTGCGTCAGG      6480
     ACGACCGTCT TGATCGGCAG CGTCCACTGG CTTGGTACAT TTTTCCTCAT GATGTTGCTC      6540
     GAGCCGATCT GACGGGTGAT GTGGTGAATA CGGCTGGGGA GGAGGAGGGG TTTCCCTGGA      6600
     AGCGGGCACC ATTGCGCGCT CTGGCCATCC TGTCCACCGT GGGGTTGGGC GCGGCGATGG      6660
     GAACCGAATC CCCAGCGGCC CATATCGGTG TTGCGGCAGG AGCCTGGCTG GGTAGCAAAA      6720
     ATCCAGCACT GCGCCGACTG GTACGTCCCG CTGCGATCGG GGGGGGTGCC GCTGCAGTGT      6780
     CAGCCTTGAT GGGAATCGCG CTGGTGGGTA GCTTCTTTAT GTTCGAGTTG AGTCGGCGCC      6840
     GAAGAGTTCC AATTACCCCG GAACGGGTAG CTGCAATGTT AGTGGGGGGA GGGGTAGGAT      6900
     GGGCTGTCAA TTTTGTCTTT AAGCTCAGTC TAATCCGGCT GGTCGTACCC AGGATTCCCC      6960
     CTGCTGACTT GTGGGATGCT GCCGCTGCTG CGTTATTCGT CGGGGCGCTG GCGGGTTGTA      7020
     TTACATCACT TTCGGGTGAG GCAATCTACT GGGCCAGAGG CTTAAAGACC CGTCCGGCCA      7080
     CCCGTCTCCT GGTTGGGGGT CTGGCCATGC TGGCACTGGC GATCGTTACC GCACAAATCG      7140
     CATCCCCGGC CGCGGCTTTT GGGCCGGGTG GAGCGGCCAT TGTCTGGGCT GAAACCGTCG      7200
     AAACAACTCC TTACCACTTG CTGGCCGTAT CCTTGCTCCG AGCGGCATCC ACTACGGCTG      7260
     CGGTTGTGGC GGGGGGATGT GGTGGAGTAT TTGTCCCTTT CCTGGCGATC GGCGATCTGA      7320
     GTGGACGGGT ATTCGCGACA ACCTTTGGGG TCCCGTCAGA TCTGGCCGGG GCGGCCGGGG      7380
     CGGCGGCTGG CATCGCTGGC GGCTATAGGC TTCCGTTGAC AGCCATAGCG ATGGTGCTGG      7440
     GGGTTGGTGG TCCAAGGGAA GCCACTCTAA CTTGCCTTGC CACAGTGGGG ATCGCCACCC      7500
     TTTCTGGATT GATAGCTGCG CGGTCGGCTG AGCAGCTCTT CAGTTCCCTA CGCGCAATGA      7560
     CCGGCAAGAA GCCATCGTCG GAGGACTAAT ACCCAGCGTG GACCTGGGAC AGCATTGGGA      7620
     TGGGAACTTT TAAAGAAAAA GCTGGCTCGG CTCCCTGAGC TAGCAATGTC CTCGTCACTT      7680
     CAAGCGAGTT AATCACCTGT ACGGACCAGG GGTCTGGAGA GAAGCCTCTC TCGATCGTTA      7740
     AGCCGTGCCA GTTCGACCAA ATGACTTGAC TGCTCTTGCA AAACTTATCT GAGTTCCGAG      7800
     AAGGTTATCC GTAATCGCAC TGCACTCCAT CCGCTTGCAG CGGAGACGTT TATTGAACTG      7860
     CCGTCCGCAC TGGTAGTATT TGAACTGTTG TTTCCCATTG TGAATGCGAC TATTCTTGAC      7920
     TGTTGGGAAA GACGCATAAA TAGGCAAACA CACTGGTATA CTAGGAGGAT TGCAAGCAAC      7980
     TCTAAAATCC AGACTTACAT CTTAATCACG ACCCAAAATG TTAGTTGCCG AAGCTATTTA      8040
     TAATTAGCAT CATTTATGTT TTAGGTTGAT AAACTATGGA ATTTATAGGT GTAGCACTCA      8100
     TATCGTCAAC ATTACTCTGT TTAGGTATGG CTGGAAGCAT TGAAGCTGGC TATAGGATGG      8160
     GTAAGCGCAG ACTCAAGAAG TATCCAGAAA GCAAAACCGA AGGAGCTAGT GCCGTTGAGA      8220
     GTTCTGTTTT TGCTATTTTA GGTTTAATTT TAGCTTTTAC TTTTACGGGA ACGTTATCTC      8280
     GCTATGAGAA TCGAGTCAAG CTGATTTTAC AGGAGGCAAA CGCCATTGGT ACTGCCTACC      8340
     TCAGGCTTGA CTTACTACCG AAGGATGCTC AAGATAAGTT GCGCCCACTC TACAGAGAAT      8400
     ATGTTCAATC TCGCATCAAT GTATTTAAGT ACTATGAAAA CCGGCAGCTA TCTAATTCTT      8460
     ACTTCCGTCA AAGTCTAAAC TTACAAGGTC AAATCTGGAA AATTGCTAAC ACTTCTGTTC      8520
     TGATAGATAA AAATCCTGGA ATCATTACCC TGGTTCTTAG CTCCACCAAT GACATGATTG      8580
     ATATTGCCAA TGAACGGCTA CAAGCGACCC GTACCCATCC ACCGGTGATT GTTTACATTT      8640
     TATTATTCGC TCTTAGCCTG GCTTCAGCTT TTTTGGTTGG TCAAGATATG TCCGTAAATG      8700
     CAAAGAGACC GTTATTCTAT ATGTTTATAT TCTGCGTAAC CATATCTGGA ATCACGTATA      8760
     TTATTCTTGA TTTAGAAAAT CCTCGACTTG GGTTGGTAAG AATTGACTTA GGCGATAAAG      8820
     TACTTGTAGA AACTTTAAAA AGTATACAAT AAGTTGTTAT TGAACCGTTT AAAACAGCAA      8880
     TATATTAAAT GCATCAAGGT TTTGAATCTG CTCAATGTCA AGCTGATGCA GTTCAAGACT      8940
     TTCTAACTTG TACTGCGCCA AGTGACGGGG GGTGATTTCA GCCCAAGGAC GATCGGTCCA      9000
     ACCCAAAAAT TTCTTCAGTT CACGTCGGTA CGCTTTTTCA GTATTGGCCG CTAACGATCC      9060
     CGCCTGCAAA AACTCGGTCA CTCGGACCTC CCGTAGATCT ATTGGAGCGG GTGATCGAGC      9120
     ATCTGCTTTC ATTTCCCCCA CGATTAATCT CAGGGTAGGC AACCCCTGTG ACTCAAATTG      9180
     CGGCTCCAAT CCCTGATTCC TCCGTTGCTC TCCCCTAGTG TATCTGGTTT TAAGTAAGAT      9240
     AAGTGAACAT TATCTAACCT ACGACTAAAC TATGATTACA TTCATAGAGG GGAGTCGTAT      9300
     AATGAGTTCA GACTTCCCCA GCAGAGGGAA CCGGCACGGA TAGCTCTCTC ATGCATACGA      9360
     TTACCCTCAC AATTTCTGAT GAAACCCTGC AGTCTCTGCA GACCACATCT GAACAGCTAA      9420
     GCCAGGAAAT TCTTTTAGTG GTCGCGGTCA AACTTTACGA GCTGGGCCGG TTATCTTCAG      9480
     GGGCAGCGGC GGTGCTCGCT GGGGTGCCTC GGACTGAATT TCTAGTGCGG CTAGCAGAGT      9540
     ATGGCTTCAA CACTTTCTCT TTAGGGGCAG CCGAACTAGC TGAGGATCTC GCGAATGCCT      9600
     GAGGTCACCG CCGCTTCTCT TGATTCAATC TTGTGCAATG GCTCGACCTG ATCAAGAAAA      9660
     ATGCCGCCTT TGTGCCAAGC TTACGGCTCA GGAAGCTCAA CAACGGCATG GCGTGCAGGG      9720
     AGATGGCTGT TGGACGCCTC AGGTTTGCTA TAACCGCCGC TCCTATTACC GCCACCGCGG      9780
     GGTCCGCAAT CAGGGACGTA AACTGCGGCG ACGAGAGGCC AGGGCAGGCG CGATCGCGGG      9840
     GGGAACCGTG GTCTTGGAAC TGCCGGCTCC AGCCGTTCCT GCAGCGGTGG TGCATTGGTA      9900
     TCGGGTGACC AAAGATGCGC CGTTGCACGC GATCGGGGCG GAACTGTGGC TAGGGAATGA      9960
     CCGCACGGCC CGGATTGAAC CGGTTCATTG TTTGGGGCTG ACGGAGTCCC AGGTGAAAGC     10020
     CTTGCTGATC CAAATTCTGG CCCTGTTCTC GCAGCAGTGT GGACGGAAGG TGGAGCGGTT     10080
     TCGCACCAGC GTGGAACTGC ATCCAGACTA CTGCCCCATT CGTCCCTGTC CCCTTCACCC     10140
     GGAAGGACTC GGGCCATGAT GCAGCAGCTT GAACTAAACC TGTGGGGTTC TCTAGAAGCC     10200
     GCCGCCCAAG TGCCGCAAAC CGCCGACTTG AGATCGCTCT GTCAGGTACT GGAACGGACG     10260
     CTGGAAGGGC AGGCACTCAC AGACCAACTG GCGATCGCTG GAAATGCGAT GGTACAGCTT     10320
     TCTGAAGTCT ATGCCGATCG AGCTGCAGGG ATGATTGAGG CTTGGGAACG GCGCTATCAG     10380
     CCCCAGGAAC CCGTGATTGA CCTGGACGAC TGTGCGGATC TGCTCGTCCA GTCTCTTTCC     10440
     CTGGATGTGT CTGATTTGTT TGAAGCGCCT GAGCCTGTGG CTTATCCAGT GAATCGTAAA     10500
     GGGGCGGAGC GAACCGGCTC GATCGTGGGA GAAGTTGCTA AAGCAGACTT GCTGGACTGG     10560
     ATCGAAGAAA CTTGTGTGGA GATTCCTCCC GATAGAGCAA CAGTGGAGCA GGGAATTCTC     10620
     AACCTGGCCC ATGATGAAAA CGTCCAGGAG ACGATCGCGG CGATCGCTGC TTACTTAGCA     10680
     GAAAAGGGAG GCTCATATCT CATCAAACTT CGAGAGGAAC TGCCCATGAA TCTGGTGGAT     10740
     CTCTGGTTAG GTTTACTCCT CGGCAATTTT ATTCTTATGC AAAGAAGTAG ATTTTATGAT     10800
     GTTGAAGGAA TCTGGGTCAA GGTATGAAAA GTTTGTGAGT CCCTATGCTT CTTTTGCTTG     10860
     CTAAGCGATG CATGAACCAG ATGAGCCTTA TTACAGAGCC AAAATCTTAA GAAGACTGCA     10920
     TATTCCTCAA ATCCTGCCTA GAGAAATCTT CAGAACGGCT TTGAGGAACT TTAACTATGG     10980
     CAACTCCACT GGCAGCGCTG CATGGCGAAG TCCATCGCTT TACGGGTGTG ATTGATCGAT     11040
     TTGGCAGCTT TCCAACCGCC GAAAACGTTG TTCGGACCGT CTGCGTACGA GATCTCCGCC     11100
     TAGCGGATAG CAATCGTCCA GTTAGTCCAG ATCACTGGTG GTTTCCCTTA CGGCAGGTCT     11160
     GGGAAGACCT TAACCTACAA CCTGGAGATG AAGTTCTCTT CACCACTAAA ATCCAGCGTT     11220
     GGACCAAAGG CTTTCAGCCG GCTGCAAATA ATATTGTTAG CCTCAGTAAG AAAAATAGTC     11280
     CTCTACGGAC CGCTTATGGA CCAGGGCGAG AACCTCGTTC AGTCGTTATC CTCCGTCGGG     11340
     CCGAGGTGAC AGAAAGGGAA CCTGCGGAGA CACACCTGCA AGTCTATGAG CAGCTTGAAG     11400
     CAGAGGACCG GGTGAAATCC CAATTCATCG GGGTGATCGA TCGGCTGGAG GGAACGATTC     11460
     GGGAGCTGAA ATCAGAGCTA GGGGTCCGGC AACAACAGTT AAGCAGCACT CAGGTTGAAG     11520
     TTATTCAGTT GAGCCAGGAA AAACAACGGC TTTATCAGAC CGTACAGCAG TTGGAGCAAC     11580
     AAGTGAATAG CTCAATTTCC CGCCAGGGAG CCGCTGCCCT GCTCAGCCTG TCCATTCTCC     11640
     TGGCCCTCTT TACCGGATTT GGGATGGGTT CCCAGCCCGT TCGTAGCCCT GCCCGCTAAT     11700
     CCATGTACGA CTAACCATTG AGCTTTGAGA AGGAGAATAT TTGTGATGGG AATGAATGAG     11760
     ATGCAACACC ATCGTGATCC CCGCTTTCAA GTTATCCAAG GGGATATTAC AACTCTGGAA     11820
     GTCGAGGCGA TCGTCAATGC CGCTAACAAT GAATTGAAAC CTGGGGGAGG GGTTTGCGGA     11880
     GCAATTTTCC GAGCAGCGGG TTATAAGCAA CTGCAACAAG CCTGTGAACA GATTGGTTAT     11940
     TGCCCTACCG GGGAGGCGCT GATCACCCCT GGCTTCAACT TACCTGCTCA GTGGATTGTG     12000
     CATACAGTGG GTCCAGTCTA TGGAGTAACC TGGGCTTCAG AGGAATTACT CGCCCGATGC     12060
     TACCGGAATT GTTTGCAGTT TGCGGGAGAG GAGAGCCTCT CTTCTATTGC CTTTCCACTC     12120
     ATCAGTACGG GAATTTATGG CTTTCCTCTG GAACCCGCCG CGGAAATTGC GATTCGGGAA     12180
     ATTCTGACTG GGCTGAGCTG CTACTCGGAG ATTAAGCAGG TCTACCTTGT TTGCTATACC     12240
     CCGGAATCCT ATGCTGCAGT TCTACAAATT TATGATCGGA TTTGCCAAAA GGGGAGGGTT     12300
     GATCCCTAAC CGTTCAGGGG CGTTCTTTCT GTATCCACTG CAGAATGGTT GTGATCTTCT     12360
     CAGGGGGGAG GTTTTGGATC ATTTTGAACA GCTCCGGGGG GCGGGCGGGT AGGTTTTGCA     12420
     TCATCTTGAG TAGCTCAGGA GAAGGGGTCG ATAGGTTTTG CATCACCTTA AACAGTTGTT     12480
     GAACGCGCTG AACGGGCTGA GCAGCTTCCC GCTCGGATAC ATCTTGGTCT TGGAGCAGTT     12540
     CATGAATCCA TTGCTCCTGC AGGACATCCA GTTGTTCCCG ATAATTCAGC GCGATCGCTG     12600
     CGGCTGCCTC CAACCGTTGC CCTTGATAAA TAGCCTCCAG TTCGATGAGC AAGTCTTTCA     12660
     TAATCCCAAT GCGGGAATAG TTATCCAGAA AGTCTGAAAC CTGCAGGTAG AAGCGGGTGA     12720
     GAATGTGGTG GGGTAAACCC TGGCGGCTAT AGAGGGCGAT TGTCACTCGT CTGAGACTGG     12780
     TCTCCTGATT CAGGTGGGGC AGGATCTCCA GCATCATGGC GATCGCAGAT TGCTCTGGGG     12840
     ATAACCCTGC CGTACCCGTG GCTAAAGCGG GTAGGGCGAT CGACTGAAAC CCCTGGGCAT     12900
     GACAAATTTC CAGACATTTG CGGGTGACAC TGCGGATCAA ATCCACGGTC GTTTGGGTCT     12960
     GCTGCTGATA ATCCAGAACA GCGGCATGAA AGAGCTGCCT GGCCTTCAAA TGACCCGCGG     13020
     TTGTAATCGC AATCTCACCC AATTTCAGTG GAACTCGTCT TCGAGCTTCC TCCCAGGCCA     13080
     CTTCCCCTGC TGCCAGCAAA ATGGCTTCGG ACACTCCACC CCCCATACTC AGGTGGATAT     13140
     CATCCGAACT TACAATCACA TCAGCTTCCA GTTGCGTAAT ATCGCAATAT TGCACCCGCA     13200
     CGGTTGTATT TCCGACCCGC TTGACCATGA CCAGTTCGTC CACAGGCAGC TCGATCGGAA     13260
     TACTTTTGGC CGGTGGTCGA AAGAAGGTCT CAGCTTTGGG GCGCTGGAAA CTTTGCCAGG     13320
     TCAGGGGAAC GAAGGCGGGA TGCTGGCAAA TCACGGGTAA CCAGGTGGCG CAGGGAAAGT     13380
     CTTTTTCTAG GGATTGCAGC TTTTCTCGCG CCTGGCGGAC GGACAGGTAA AGGGAGTCCC     13440
     CGGAGGAGAA AGCTCGCAGG AAGTGTTTTA AAAATGCCTG AGCAACCACA TCCGGAACGG     13500
     GTTCGCGCAT CACAATCAGC TGGGGGAGGT GCAAATTCAC CAGGGCCCGC GCTAATTCCA     13560
     ATCCATCGCA GGAGTTAAAA ATCGCTAGCT TCAGCCCATT CTGAATTGAC TTGCGTAGTG     13620
     CATACTTGAC CTGCTCCAGA GAAATTGTGT CCTTGGCATT AATTCGGAGA TGTCCCTGCC     13680
     CAATCTCGGG TTGGCTGGAA CTATGGCCGG CAAAGAAAAG AATATCCCAG CCCTGCTCCC     13740
     AGAGGTGATC ATTCAGCTTG TGCCGAGGAG GCTCCACCAA GAACTGGACT TCGGCATTCG     13800
     GCAGTTGGGA CAGTTGACGC CGATCGCTGT CCAGCTCTAA CCCGGTACTA CAGCCAAAAA     13860
     TCGCTAGAAT CTTAACTTTC TCTCTGGAAG TGGAAGCAGG TTGAATTTTA TTGTAATTTT     13920
     GGGGGCTAAG GGCTAATTCA GCTCGATGAT ACCGCTCTAA AAATGGTTCG AACAATAAAT     13980
     GCCAGGGCAA CGATCGCAGT TGAGGATCAT CAGTTTGAAT CAGTAAACGC ACCTCTTCCG     14040
     ATCGATCCAG CTCTTGCAGT AAGGTTTCCC GAATTGGTTT GAACCCACTT TGCTCTGAGC     14100
     TATACCAGTT CCGCAACTGC AGCTTTAACT GATCTGCCAA GGTGGAGCAG GTCTGCCAGG     14160
     GATGAGCGGT AGAAACATTG GTCACTTGCT GCTGGGGAGC GCCCAGTCGA GCCACATGGC     14220
     CCAGGGCCCA GTAAGCAGCT TTCCAGTGGC GATAGGTGTC CAGGAGATCC GGGGAAGCGG     14280
     CTAAGTGCCC AGCAACTTCT GTATACGGGG GAAACCCCTC CTCGGCGATC GCCAGAGTCA     14340
     CCGCAAACCC CTGGTCAAAA TCACCCTGAC CCAGTCGCAG GACTGCCAAC TTAGTCATAT     14400
     TCCACCTAGT ACAAATAAAC TATCAGAATT ATTTGAATTC TATGTTCTTA AACAAGAATA     14460
     TTTCTATTCT TGAGTTAATG ATTGATCCCG GCCATAAGAT TGATCAATTT GTTCTAATAT     14520
     CAAATCCAGT TTATTTTTAA ATATATTGAA CTCATGAGAA ATCTGATTTT GAATAGTTCT     14580
     TATAAATTTT TTGTGACGTA TATCTTTTGA CTGTTGTATA ACATATACAG CAAAGCAAAC     14640
     AATTCCAAAA GCATAGGCAA CACGATTCAA AGAAAAATTC ATATTATGAT AGTTTTGGTT     14700
     CCAGAACAGA ATTGTTAAAA CTGCAGTTGT GGCAACAATA ATGATTGTTC TTTCTAAATG     14760
     ATTAAAAAGG GTTTCTTTAG GGAATTCATG TTGAATAGTA ACTGCACATA CAATGTCTGA     14820
     AAACTCTTTA CCAGTAATTG GATTTTCTCG AATCAGCTTT TGTAGCCAAA CACCCTCAAA     14880
     TGCAGTTTCA TTGTTCCAAC GACTCTTTGT TTGATCAATT ACTTGATTAA TCAGTTGATT     14940
     TATTGAAAGA GAACGATTAA CCTTTCTGGT TGAAAGTTGC TCCAAAAAAC GTGACATAAC     15000
     GAGCTCACAG AAAATATTCC ATTGGTGATC AAATTGTGAT TTGAAACTCA TTATCTTCTC     15060
     CGCCAGCAGA TATGTATTAT TGCGTGCATG ATCAAACCAT TGAAGTAACT TGTTTAAATC     15120
     GTGGTAGTAT ATTCGCGCCA GCTCCAATTT TTTCGGATCG CAATATTTGG GTTGATGACA     15180
     TTCTTGGTAT TTTGCAATAA AAGTATTAAG AACTTTAAAG CGTTTTTCTA TCACCGCGTT     15240
     TAGGAAATCA GAAATATTAT GGACAAACTG TAAAACAGTT TCCCTATTGT GTTGTTCTAA     15300
     ATCAAAACCA ACATTGCTAG CAAGCCATCG ACTCATTTTG AATACTTTTG AACTACCAAT     15360
     TATTCCTCCA ATGTTAGTAG CAAAATCAGT ATCAATTTTA TTGCGTTCAA AATAAGATAC     15420
     TAAGTCATAC TGGGCATTTG GTATTTCCAT TTTGAGCTCA TTCATTACAT GGAAAATCTT     15480
     GCCTTCAAGC TCAAGTATGT AATTATTAAA CTCTTTCTCA ATAAAAGACC TTACAAGATC     15540
     TGCCCAAGCA GGATTATTTG ATTTAATTAA TTTCGAAGCT CTTTCTATAC AAACAACCTC     15600
     TAAAGATCGG AGATCGGATG GTATGTTTCC CTGAATTTTA AGTAGATCGG TTAATAAATT     15660
     ATTAACGAAG CTTTCAAAAT CATCTTGCTT TCTTCTAAAA TCATCTTGAG CTTCCAGTTC     15720
     AAGTTTACAG ATTAATTCTT CCGTCTTTAA AGATAGTGAA AAAAAGTATG ATTTTGCTTT     15780
     CAAGATTTCA TGATTTAAAG TACCTAATCT TGAAACCAAA GTAACTCTAT CAGAAAGATG     15840
     GCTATTAAAA ACTTGATTTA GAATTTGGAG AAAGCCATGC CGTAACTCAA GTTCATTGTC     15900
     TGTAGGAGGG TTTCCCTTAA GCCAATCTTT AGCAACCGTA GTAAACAAAG CAGGGTAACC     15960
     GACTAAACGA TTACCTATAG TCTTTAAGGT AGATTTTGCC CATTCCAAAA CACGAGTTTT     16020
     ATCTTCTAAT TCTTCAATTT GATCAAAACG ATTTATAACG ATAATAAGAT TGCCATTAAG     16080
     AAGATTGTTA ATATCTCGAA GCACTTGACG TTCAGCTTCA CCCAATAGTT TATCAGCAAG     16140
     CAAAACAACA ATCGCTAGAT CTGCTTTATC TAACTCTTGC TGTGTGACAG AAGTAAGATT     16200
     GGCATTATCC AATAAACCTG GTGTATCAAC CAAAGTCCAA TTATTATCTC TCAATATTTC     16260
     TATCGGCAGA CCAATTTCAA CTGCAATTAC ACCATCGGGA GCTTCTGCTT CCTTAGTTGA     16320
     TAAATTTAGA AGAATGTAAT CTGGTACCCG ATTAATAGAA ATTGGTTCTC TGAACTCACC     16380
     AGTCAACTCG TGTTGCTGAA TTACCCATGC ACAAGGATTG CTACTATAGA AAATTCTAGT     16440
     AGGTACTCCA GTAGCTCGAT TACTACGGGA GGGTAAGCAG GGCTCCCCAA TTAAGGCATT     16500
     CAGTAAAGTA GATTTACCTG CTTTGAAAAC TCCTAAAACT ACGGCTGTTC TTGCTTTATG     16560
     CTCAACTTGA AATTTAAACT CCTTGAGAAA CTTAAGATAT TCTCCGTTTT CTTTTGTAAG     16620
     ATTAACATTG GGGATAGCGG AAATATCCTC TAGGAGTTTA TTTAATTCTT TATGAATGTA     16680
     AGAATCGATC CACATATTAA AATTGAAACT ACTAGATTAA CTTTTCACCC CGTGAAAGCC     16740
     ACTTAATTTG GTCTAAACTA TAAGTTTTAC TATAGGTAGC CTCACAGATT CGATTAAACA     16800
     TTAAGACTAG TTCTTGACCA ATCAAATCCA TACGTTTTTT CTCAGTATCC ACAGAGAAGT     16860
     TTTCTGTTTT CTTTTGCTCA ATTATTCTTT GTTGTTCCTG TCTAACTTCG TCGATCTGCC     16920
     CTTGAAGTGA TTCGGTTAGA TGATGGGCTA AGTTCCAAAA CTGCTCCTTA GTTCTCCAAG     16980
     TTATTGATTC CTGCATTTGG GGTAAGCGAT TACGGAGTTC CTGATGAATC TTGTCACCAA     17040
     TGCTTCTAAT AATTTCATCT TCATGACGGT TCATATTGAA GATAAACTGC CCAATTTCTA     17100
     GAACTATAAA TAATGCCCAG CCTAATGGAC CACCCTGGAA AACCGACAGA ACAAATGTTC     17160
     CAATAGCAGC TTGAAAAATA GCACCTTGAA CAAAACTAAG CCAGTCTCCC CGTCCTAAAA     17220
     GAGCACTTGA CATATGGCTG AAGTCACCCA TGGCAAGACA AAGAACAAGT TGCAAAATCT     17280
     TCTCTTCACG GTTTCTAGCT AGATCTTCAA TTACAGAAGG ACCCTCGTTA ACCCCACCAG     17340
     AAAAGAAGTT TTCAACGCTG ACTAGCTCCC GCGAAAACTC TGTGATTTCA GTTTCGAGAC     17400
     GTAGTGATAA TTTTTTTAAC TCTTCATCTG CAACGAAGGC AGCACTATTC GACCAATCTT     17460
     TAAAGATATT TTGTAAATAA TCTTGGGTGT CTCGCTCAAG TGTTCGCTTA ATGTTTTCTT     17520
     TCTTGCTTGA ACTAACAAAA GATGTGGCAA TTTCAAGTGG GTTAAATAGG GATGTAGTAA     17580
     TAAAATGGGG TGCCTTAGTC TTCCATAGAT CCTTCTGTTC GGAAAGATAT CCTGCAAGAT     17640
     TTGAGCATAG CTTTGCAGCA ATCACTTCAC TATAAACTCG GATCGTCTCC CTAATTTCTT     17700
     CCTGCTTTGC TTCAAGGGAC TGCAATCGAA CTTCTGACTC AGCACGACGC AGTTCTAAAT     17760
     CAGCGATGGA CTGCTCTAAT GCAGCTTTTT CATGCTCAAT TCTTGCATGA GCATCATAAA     17820
     CGATGTTGAT TAGCCGCTTA AAAGTTGAGC TTAAAGCTGA TCTAACTTTG TCAGGACTGG     17880
     ACAAAAATCT TTCAAGGGCT TTCTCTAACT CAAGCACACC AGATGCTTCC AAAGCTTGGT     17940
     TGTTTACTGG CTCCTTAAGG CGAGCATTGA GCGCAGCTCT AGCATTAGTA AAGAAAAGAT     18000
     GGCGATCGAG TCTTTTCAGG TCAGGCTTAC CATCAGAGTC AAGAAAATAA TTCTTTAAGT     18060
     AGTTTCTAAA GTAGTTTTTT ACTTCTTCTA CTTCATCTTC GTCGTCAATT GCATCCATGC     18120
     GATTAACTAC GAAGAACACA TGGTCTACAA AACCAGGTTT AAAATATGTT TCAATAAAAT     18180
     CTCTTTCGTT CTCTCCTAGT GGTTGACATG CATTAAGTAT AAATAAAGCT GCTTGTGACT     18240
     GCTTGAAGAA GTTGGTAGCT ATCCGCGTTC TGCTAAGCTG CTCTGCAAGC CCAGGAGAGT     18300
     CAATTAACCT AACGCCACCA GAGCAAAGAG GATGTTTACA TTCAATCTTG GCATATTCAA     18360
     TATTTTCAAA CCGGTCAATA AATCCTCTTT GCTCAATAGT TTCTTGATCA GAACTACTTA     18420
     GAGAATAACT TTTCCTGAAT TCATCAATAC TTATTATCTT TGATTGTTTA GGCTCAGCTT     18480
     CAAAAATCTC AACTTTATCA GTTTCTCCTC TGACAAGCAT GGTAATAATT GCAGTTGTAG     18540
     GTAAGGTGTT GGCAGGGAGA ATTTTGCCAC CAAGCATGGC ATTAAGTAAG GTGCTTTTTC     18600
     CATGTTTAAA CTCTCCAATT ACGATTAGGT TAAAAATACC CTCATGAAGA TCTGTTGCAC     18660
     GCTTGAGTAA GTCAACGGCA TCATTAACCA TGCCTAATCC TGGAAAAATG TTTTCTCCAG     18720
     AAGAGAGAGT TAAAACTTTT TGTGATCGCT CTCCAATCAA AGTAGAAATA ACTTGTAGTG     18780
     ACTCTTCAGC AATTGATAAT AAACTGGCTG TGTGTTCGTG AGTTTCCGAC CAATTAGATG     18840
     GTGGTAAGCA AGTTTGCTCT ATTAATGCAT CAGCAATTAT TTCAGTCATC AAACCAGAAA     18900
     GAAATTTTGT GTCTCCGCCA TATATCAACC GCTTTCCCAT TTCTTGAAAC TGTTGTTCAG     18960
     CTTGAAGTGC TCTTAGTTTG GCATGATTTA GCTCTTGTTG CAGACTTTCA ATTAAGCCAC     19020
     TATTAGTGTC TAATGATACC TGTGCTTGCT GAAGTTGCTT TTCTAATTGA AGTAGATTCT     19080
     GCTTCGCGGC ATTCAGCTGT TCTGCTTGAG TTTGAATTTC TTCTTTGTCT AATTCGGGTA     19140
     GGACTTCCGG TAGTTCAAAT TCATATGAAG CTGGTGGATT GTATGAAATG TATTTCTTAT     19200
     AGTACCAAAC ACTAATTTCA TAAGCATCTC TTAAACTCGC ACCTGCATCT CTTAAATTTC     19260
     CTCTCCATTC GTGAGTAGCA GAGTTACCCA ACCTGCGTAA TTTGTCAAAC TTATCGATGA     19320
     TGCTCTCATC TAGAGTTCTC TTAAACTTTT TGCCAATTTT ATCAAGGCGC TCTTTTTGAT     19380
     CAATACTTTC ATCATCTATG CTCTCTTGGC AGGCAACCAG CCTAGCTAAA CGTTCAGCAA     19440
     AGGTACGAAT CACGCTAATA CTTGCCTGAG GTTGTTTGAG GGCGTACATT CGTTCGGCTG     19500
     CTTCTCCAAT TTCTGCCAGT TCTTGATTAT GAGGTTGAAG AAATCCGAAG TTACTTGCTT     19560
     TGTGCTTCAT CAGGGATGAT CGAAGACAAT AATGTTGATC ATTATCAATA ATATCCGTAA     19620
     ATATCGATCT TGTGATCAGT ATATTCACGG ATAAGGTGTT ACTCTGGGCT CTTGGCTTGT     19680
     CTTTGCCTAG TTTATTACTG AACGTTCAGT TTATTTCAAT AAGCTTGGGA AGTACCGTTC     19740
     AGGTCGGAGA GGTCACAAAA TGAAATTTTC TCGATAGTGT CCCTGGTTCA GCTTCAGACT     19800
     GATGCCAAAT TCCTCTCCAG GGCTGCCCCA AAACTTATAT TGCAAGACTC GATCCTGCTC     19860
     CCGTGCCGAT AATTGCTGAA AGACTTCCCC GGTCTGGTCC AGAATCTGCA ATTCCAATTT     19920
     TGCAGGAAGG CTGGCTTGAG GCTGCAGGGG ATAGACGCGC ACAAACACAC TGACCTGCTC     19980
     TGAGGACTTT GGCAGTACCG CTAAGACCAA CCCGATCGCC TGGCCTGCGA GATCAATTCC     20040
     CAAATCCACC TGCTTCATTC CCCAAAATCC AGCAGCCTGA TTGCCAGGAC TGAGCAGCCA     20100
     TAAGGTTTCT GCTGCCAACC AACGGGTGTC TTCTTCCTGG GCTGTTTGTA GGATTTGCTC     20160
     TAATTCTGGG ATGGCTTTGA CTGCTTCGGG GCTCTGAGGA CTGAGCTTGG CCCATTCCTG     20220
     GATCAGTAAC CGCACCTGGG GGCTATCCAC TCCGTATTGT TCAATGGGAT TACTGGCTGA     20280
     AAATTCAGGA GAAAGCGATC GCATGGCTAT AGCAGGCGAA AACGCAGTTC CAAGATTGGC     20340
     ACCTACAATA GGAACTACTC CAAGTTGACC CAGAGACCCC AAAGCCGAAC TCAAGTTTTC     20400
     CCATTTCTGC CACCCACTTT CTTTAATCCC TTGCCATTGC TGGCCAAGCC ACTCGCCCAA     20460
     GCGCACTGGT TGACGTTGTT GGTATAACTG TTGCCGCCTT TCAGGATGAC TGATCAGGGC     20520
     ACTCCATTGA GAAAAAGGGA GACAGAGCCG CGGATTGAGC ACCTCAGGAT CACTCAGCTT     20580
     TTGAATCAAC GCCTGGGTCT GGGTAGGGTT TAAGCTGTTA GCTGCTGGAA TAAAAGACAG     20640
     AGTGGAAAGG GCCTGCTCCT GGCTAATCAT TAACAGGGCG ATATCCTCTG TTAAATCTTC     20700
     CTGTTCCAGC GTATAGGTCT GATCCAGTGG ATCTAAATCC CCACGTTCCT TGATGTCTTC     20760
     ATAGGTAACG TAGGCCCAAA GTTGTAACCA CTGCTGGTCT GGATTGACCT GAATGCCAAC     20820
     GTAGTAATGG CCCGCCCACT CTCGGATATC AACCCACTCT TGGGGAATGA CCAGCTCCTG     20880
     TAAATCATCT GTTTCCTGAG GTAACAGAAC CCAACGACGA TTACCCACCG CGATCGCCAT     20940
     TCCATTCACA AATTCCCAAA TCTGCGGATG TTGGTCAGCA GGGAGCCAGG GTTCAACGTT     21000
     CAGGTCATCC CCCCATTCAC TTTTCAGCCA GGAAAGGACA GGACCTAAGG CTAAAGCATT     21060
     GAGATACGCA CGCCAGCGGG CCGCAGGATT AGAACACCGT TGAGATTGCT GTTGGGCCAG     21120
     TTTTAGCTCT TCTGAGGATA GGTCAAACCA GAGGTGGTCA GTGGCAGGAT ACATTAAGGA     21180
     CTCGGCGCTC ATAATTGCTC ACCCCCTCTT AAGTGGTTTT CTAACCAATG TTCAACAATA     21240
     GACTGTAAGG CGTCATTGAC GATTTGGATG CGTGGCAGCG AAACCTGGAA TTTGGCTTCA     21300
     ATATAACGTC GCAGCTCGTC AAACAGATTC ACCACGAGGT CTTCCTTCTG ATTTTTATCT     21360
     ATATTTTGCA TATGTCTTTG ATAAAGGGAG TCGAGACAGT TATTGAATTC TTTAATGAAA     21420
     TAATGTTTCA ACCATTCATC CAGTACGGGT TTAATCTGCT TTAGTTGAGC TTCAGTTAAG     21480
     GGTCCTCCAT TTGGATTTAA TCGTTGTAGG AATGCTTGAT AAAGCTGTTT ACGGCACTTC     21540
     GTTAGCTTAC GAGCCACCTG ATATTGTTGC TGGGGAAAGC CTGGGAATTG CTCCTGCCGA     21600
     ACCTGGGAAA TATCCTGCTG CCTGATACGT AAGCCGGAGA TAAATAACAA CAACGCCTGC     21660
     TGGTCTAGTG GAAGCTGACC AAAGGACTGA TTCAATATCT CACTTAATTC CTGTTGTTGC     21720
     TGCTCCTGCT CTTGGGCAAT CAAGGTCTCT ATCCCAGAGT CTCTATGATC CTCAACATCA     21780
     AAGTTATCGG GTGGTTCAAC TATCGGCAGA GTACTGAAGG CACGAATGGA TTGAACACTG     21840
     GCAGAAATCA AGGCGCGGAA TTGGCTTACG TTAACGGATG CCATCTCCAG CCGGGCAGCG     21900
     GATTGGTTGT ATTGTTGCAC CATCATTTGC CATTGACCCT GGGTAGGCTC CGCTAGCTGA     21960
     CGGCTGGATT GCCCAGGGAT AGGAGCATAG ACCTCCTTGA AGGAATTCAC CGCCAGTTGA     22020
     TGAGCCACCA GCTCCTGCCC ACTCACGCCC AGGTGTCGTT CCACCGCCTC CTTCAATTGC     22080
     CTATTAGAAA CCTTTCTGAG CAATCCCCAA TTCGTACTTT GCCGCCAGCC CCGCATTGTA     22140
     TAGAGCCTTT GGCCAAGTTG CAGCTCTAAA CGGTGTTGGG CATAGGTTTT GAGCTTAGTT     22200
     CCCCAACTAG GATCATAGGT TTTCAATAAC TTAAGCGGTT GTGCCAGAAT CTCGCTGGCC     22260
     ATCAGAAAGC ATTCCCGCTC CTCCAGGTCA GACCATTGCA GCGCTAGACG CCGTTGAACT     22320
     TTCCGGGCAG CCCAGTAGCA AATTTCTTGA AGATAGGCGA TCAGGTGGGC ATTGGACTGA     22380
     GCACAGGATG ACTGGCGTAG CTTGTCCAAA AGGGTTAAGG CAAAAGCCTC TGGATCACTG     22440
     ATCTCCCTTG CTCTGACCGC CCGGGCCAGA TTGGATTGAG TGATCCACCG ATACTGAATC     22500
     TGCGGACCCT CGCCCTCGAT CGATAAGAAG CTGGAGAATT GTTCCTGGAC GGTATGACGT     22560
     GCTCGCATAA TTGCCACTCC TCCAACAGGG TTGTTCGCAT TAACCAGTTT CATCATGCCT     22620
     TGGAACGATA GAGCCCTACA TACCGTTCTA TGCGAATGAC TGCGGGTTCG ATCGCTGGGA     22680
     AGACTTGTAA AAGGGGAGGG TGGAGCAGCA ACAGGCATGA GGGGTGTCCA TGGGTGAGGT     22740
     TATATTTGCG AGTCACAGTA AATATCCCCA GCTTTCTATT CTAGGGCTGG CGGCGGTGGT     22800
     GGCGGCGGAA AATATTTCCA GACCGGAAAG AGCTGGATGA AGAACTCGGG CTTTGCTGCA     22860
     AGCGAAAGGC ACTCAGGTGA ACAATCCGAT CGCGGGCGAT CAAGGCACTC CCCACCAGAC     22920
     CTGAACCCTC TAGCCGCAGA TCGGTCCCTT CGCCCAGTGC TGGAAATGAC TCACTTTTGG     22980
     ACTGAACAAC GGTCTGGAGA AATCCTTGGG CCTGCTCTGA GGTAGAGGCC TCTGTGACAA     23040
     CGTTGGGGTT ATCCAGGGCA TCCAGGGCAT AGCTCCGCAC CAGTTTGGCA AAGAGTTTAT     23100
     CCATTGTGGC TGGAAAATCA AACAGATCCA GACCAATCAA CTGCCCATTG ATGGCAAACA     23160
     ATGCCGCAAC CTGATGGTTG ACTAGTGATA GTCCCAGAAC ATAATCTTCG AGGGAATGTT     23220
     GGTGGTTTTC GTACATCGCA GCCATCGCCC CCGTGGGAGA AGATGTCCGT AGCCGACTGG     23280
     CCTTTTCAGC AATATCTGCC CACACAGCCT GCTGGTCAGA ATAATGGCAT CCTGTTTCGG     23340
     TCATACAGGC AGTCACCTGG CGCAGTTTCT TAGCCCGGCC TGAAGAATAA TAAGCTCGGG     23400
     GAGAAGCCTT GAATTCTGCC GACTGATGTT GCCAACGTCC AGCCTCAACA CAGGACACGG     23460
     GGATCTTTAA GCTGGTCTGA GCTGGAACCA GGAGCGTGAG GTTGAGAACA CGGTTCTGTT     23520
     TAGCCCCCAG TAATTCCTCC CCATCCAGCA GCAACACCGC CCGATCCGCT TGATTGGAGA     23580
     ACTGAAGCTC AGGCACACTT CCCTGTTGGG AAACTTCCGT AATTCTGGCC ACCTGCCGTT     23640
     CCAGGGCCTC ATCTAGAACC AAATAGTCTG GCTTCTTACT CGCGTTTGCT ACCAGGGGAA     23700
     ACATGGAGAG GTTACGGTAA TGCTGGGGGG CACCAAGGGA AAGGGACTGC AGGGTATCCT     23760
     GGAGAATTTT CATCTTTGCG TATGTTGTCA GTGGACTCTA TCCTTTCCTC CAGGTAACCC     23820
     CACCTCAATA TGCAACCGAA CTGATATTTT TTACGGATGT ATCTGCATCT GCTAATAATT     23880
     AAGGTTTTGA TAAAGTATCC CATCCCATGA AGAAGATCAA AGGATAATAG GAATCATCCA     23940
     GAGCGGAGAA AATACAGGCA TGGGGAAGGT TGCAGTTCTC AAGCTGGGTA CAGGTAGTTT     24000
     TGAGGAAGGG TTTCCGGTCA CGTTACGTCT GAGTGAAGAT GCTCCCCTCC ATCTGTTACT     24060
     GGAAGTCGAT GGTCAATTGC CCCCCTGTCC AGGGGTTTGG GATTGCTACT GTCAGTGGCA     24120
     AACTGGCTAC AACCAGATAG CAAAGAATCT CAGGTTAGGA GCACCAACGG GACAGGTGGT     24180
     CCAGGTTCGC TATACTGAGC CTGCCGAAAC TTACCGACTG ATTGCCCTGA ATTTGCGGAA     24240
     GCAGCTGAAT CAATGGTTGA ACTCAGGTTA TAGCGGTTTT CAATCGGTAC GCGATCGCCT     24300
     CTTGATCCAT CTCAATCCTC AAGAAGAGAT TCGCTTCATT ATCCAGACGC AGGATCTAAA     24360
     CCTCTGGAGA ATTCCCTGGC ATCTCTGGGA CTTAATTGAA GCTTACCCCC ATGCGGAGAT     24420
     CGCGGTGAGT AGCCCCCAGT ATGAAAAGCC AGAGAACATT GAGAGACCTC GAAAAAAATA     24480
     TGTCAAAATC CTGGCTATCT TAGGCAATGC AGCCGGAATT GATGTTAGTG CCGATCGGCA     24540
     AGTCCTCCAG CAGTTACGCC ATGCAAAAGT GACCTTTCTC GCAGAGCCCC AACGCAGCCA     24600
     ACTTCATCTT TTGAGGGATG AGAGCTGGGA TATTCTCTTC TTTGCCGGGC ATAGCCAGAA     24660
     GGGTAAACTA AAAATCAATC AGCAAGACGA GATTACGATT GATGAACTGA AGAGCACCCT     24720
     GGTTAGAGCA GTGAGTAACG GCTTACAACT AGCAATCTTT AATTCCTGCG ATGGGCTGGA     24780
     ATTAGCCCGA GATATTGCCG ATCTAAAAAT TCCCCAAACC ATTGTTATGC GTGAACCTGT     24840
     TCCTGATCAA TTAGCACAGG AATTTCTGAA ATACTTGCTG AATTTCTACT CTCATGGGCA     24900
     TTCATTATAT TCTTCTGTGC GTGAATCCAG AGAACGTTTA CGTGAATTTC ATGATCTAGA     24960
     GGCTTATATT CCTGGTGTAA GTTGGTTACC CATTATCTAC CAGAACCCAT CGACAGTGCC     25020
     AGTCAGTTGG CAGCAACTTC ATGAAAGGTT AGCAGAACCA TCCTATAAAC ACTCTATTAA     25080
     GAATAAGTGG AAATGGTTAA TTTATCTTCC ACCTATCTTT TTGACCTCAT TAATTGCTTA     25140
     TAGTCTTATA CGTTCTATTT ATGACGAAAA TTCAAATGAG AACTATCACG AATTCATGAA     25200
     GCTGGCTTAC GATGGCATGA AAAAAGCTAA GAGTGAAAAT AATTATCACT ATTATCACAA     25260
     TACTTTTATT AACTTTAGAA AAGCTTTGGA ACTCCGTCCC TTAGATCCTT ATGCTTGGTA     25320
     TGGGCTTTTG GACACAGGAT TTGATTTATT TCAAAAAACC CCAGAAAAAG GTTCTCCCGT     25380
     TTATCCCCCT TCTTCTCCAT TACCTAAATC CACTCCAAGC CCTGCGAATC GATCTTTTGC     25440
     AAACAAAGAA ATTCCCAAGG TATTTCCAGT AAAACATCCC ATTTCTCCTC AGGAGCTAAA     25500
     ACCTCGCTCT TTGAGCTCAA CCAAAGCATC TTCAAATACA AAATTGTCTT CTGGGCACCT     25560
     CGAAAAATAC CTAGAAACAG TCTCATTGCA AGACAGCTTA GTACAATGGT GAGGTGGGAG     25620
     TTAGCAGAAG TCAAAAGCAT GGGGCAGCAA GGATTCTGGG ATGTGGAAGC GCGTCAAGCG     25680
     AAACTCGCGG CAAAGCAGAA TATTCTAGAA CGGTTGAATG CCGTGATTCC GTGGGAGAAC     25740
     TTCCGTCCAA TCCTGGAACA ACTCTATCAG AAACCCCGCA AAAGTCAGGC AGGACGAAAG     25800
     CCTACCGATG TGATTTTGAT GCTGAAGTTA TTAGTTCTGC AAAAGCTCTA CAACATCAGC     25860
     GATGAAAGCT TAGAGTATCA AGTGAATGAC CGCTTATCCT TTATGACGTT TCTGGGCTTG     25920
     GGACTCGAAG ATGTGGTGCC GGATGCAACG ACGGTGTGGT TGTTTCGGAA ACAATTGCGC     25980
     GATGCCGAAC TGATTGACGT AATGTTTGAG CAATTTGAGC AGTATTTATG CCAGCAGGGG     26040
     TATCAAGCGC AAGGGGGACA AATTATTGAC GCGACCTTGA TTCCCGTGCC CAAACGCCAG     26100
     GATAGCGAAG ACGACAAGCA ACAGTTAAAC GCCGGAGAAA CGCCGCAGTC GTGGCAAGAG     26160
     AATCCGCATC GGGCGGTCCA GAAAGATAGG GATGCCTGTT GGACGAAGAA AGGCAACGTC     26220
     AGTCACTTTG GCTATAAAGA CCATATCAGC ATTGATGTCG AACACGGCTT CATTCGTCGC     26280
     TATGCGGTTA CCGATGCATC CGTGCATGAC TCCCAAGCCT TCACCGCTGT CCTGGATGCG     26340
     GACAATCAAG ACGATGGGGT GTGGGCTGAC AGTGCCTATC GGGCGGCGGG GATTGAAACG     26400
     TTACTTGAAA CCCTCCACTT CGAGAGTCAT ATCCATGAGC GGGCCTATCG CAATCGACCG     26460
     TTAAGCGAGA CCCAGAAACA GGCGAACCGA GACCGGTCTC AAACACGGGC GAAAGTGGAA     26520
     CATGTCTTCG GTCGTTGGGT GATGCAAATG GGTGGAAAAC TGTTGCGCTC AATTGGGTTA     26580
     GCCAATGCCA ACGCCCATCT TGGCTTAAAA AATCTCACTT ACAACCTGCT GCGCTATAGC     26640
     TTCTGGCAGA CACAAGCAAG TGTTTAACCT GGGTTTGAGA TCGTTCCTCT GCTTTAGACC     26700
     TCTCGTTTTC GTGGTTCAGG GTTTGAGCTG TGTTGGGCGA GAGCAAGGTT TCTATAGCCC     26760
     AGTGATTAAT GCCAAGACAG ATTTGAGACT GTTTTCTCAA AAGGAGCAAT TAATCGAGGT     26820
     GCCCTTCTGT GATAGATCCA AAACTAACAC GATTAAAAAG TTTGCTTGCA GCTAAGAAAT     26880
     GGGGATCAGC AGAAATTGAA ACCAATAATA CTATTAAACG ATTGGTTGGT TACAAAAAAC     26940
     AAAGCAATAT CCCACCTGAG TTAATCAAAA AAATGCCTTG CAAAGACCTG CATAATATTA     27000
     ACCAACTTTG GGTATCTTCA ACTCCTAAAC CTCATTTTGG TTATAGTGTT CAGCTTGATA     27060
     TATGGGAAAG CCCACCAATT AACAAAAGTT TTCAACGCTT TGGTAACGCT ACCGGCTGGC     27120
     AAAAAAATGG CAAATGGCTA GAAGTCTTGC AGCTAAGCTT TTCTGTCAAT AACCCAACTG     27180
     GCCACTTGCC TTGGCATGGA TGGCAGTATA ATAAAAACTA TGAGTTCAAG CGCATTGGAT     27240
     TTGGCTTGTT TATGGAACGT CTTAAGCAAT GCAAAATTTG AAACAATCGA TAAATCAGCT     27300
     ATTTCTATAA ATTATCGAAT TACAGAAGTT GAATTTGTGC TGTTGAATAA TTTTAGAAAT     27360
     TGCCTTGGAA ATCGTAACTG TTCAAGGGGT TGACAAAATT TAATTGAGAA AACCAGGGGT     27420
     AGCTGTTAGG GTAGCAGGAT GATGGAACCC CTTCCCGTGT CGATTGAGCA GATTAGCGAT     27480
     TCAGAGTGGG TCGAAACACC GGAGAGTGTG AAGCGTTATC TTTTGGGACG CATCGAGCAA     27540
     TTAGAACGAC AATACGAGGA GTTGAAAGCG GAAAACGCAA TGCTGCGAGA GCAACTTAGG     27600
     CGCAATAGCC AAAACTCGTC AAAACCCCCG TCCCAGGATC AGGGCAACAG GTTTAAGCCC     27660
     AAGGCAAAGC AGGAGAAGGA GAAGAAGAAA CCACGAGGTG GGCAATTGGG GCATGAGGGT     27720
     CATGAAGGGA AATTTTATCC TTTAGAAGCG TGTGAGACGG TTACGGAACA CTACCCCGAA     27780
     CGCTGCATCA ACTGTGGAGG GAGGTTGCAG GGCAAAGACC CAGAACCGTA TCGGGTTCAA     27840
     CAGGTCGAGA TTCCTCCAGT AGTGCCGGTC GTGAGGGAAC ATCGGTTTCA TGCCTTAAAG     27900
     TGTGCCTGTT GTGGTGTGAG AACCAGAGCT TGGGATGAAG TCATCATCAA TGGATGTCGG     27960
     TATGGGGAAC GGATTGTCTC GACAGTGGGT CTCTTGAGTG GGCAGTATCG GCAGTCGCAT     28020
     CGGATGGTGC AAGGGTTGCT CGACCAGTTG TTTGGGGTTG AGTTATCGAC CGGCAGCATC     28080
     AACCAACTGC GGCAGGAGAG TAGCACCTCG GTCGCCAGCG CAGTGGAGGA AGCTCACCAC     28140
     TATGTGCAAC AGCAAGAGCA AGTGAATATG GACGAAACGA GCTTTGCTCA AGGCAACAAC     28200
     GATGGCAAGA ATACTGAGGG ACGCAAGGGT TGGTTGTGGG TGCTAGTGAC CCCATGGGTG     28260
     AGTTACTTTG CGGTGTGTTT GAGCCGTTCT AGTCAGGTCT GCCAGCAGTT GTTGGGTGAG     28320
     ACGTTTACAG GCATCGTTGG CAGCGACCGC TACAGTGCCT ACCAGCATTT GAGCCTTGAG     28380
     CACCGACAGG TGTGTTGGGC GCATCTCAAA AGGGATTTGA CTCAAATCGC TGAACGCAAA     28440
     GGTGTGGCGG GAGAACTGGG TCAAGCCTTA CTGGAACAAC AGCATTTATT GTTTGAACAC     28500
     TGGTATCGGG TGCGCGATGG AACCCTCAGT CGAAGTGAGT TTTCTCAAAC AGTGCAACCG     28560
     ATTCGAGAAC GATTTAAGCA ATTGCTCACA GAAGGGGCAG GGTATGAGAT TGCACCCAAA     28620
     GAGAAAACTC CCTTGGCGAA AACCGTTCGC ACTTGCCAGC AATTGTTGAA AATCGAACCT     28680
     GCGCTCTGGA CCTTTGTGAC GACTGAGGGC ATCGAACCCA CCAACAATGC GGCGGAGCGG     28740
     GCACTTCGTC CAGCGGTACT ATGGCGCAAA AATAGTTTCG GTTCCCAGAG TGAGGCAGGC     28800
     AGTTTGTTTG TCTCTCGAAT GCTCACGGTC ACCACTTCTT TGCGGGCCCA AAATCGTTCG     28860
     GTATTGGAGT ATTTAGTGCA AGCGTGCCGC GCTTCCAGGC AGGGTCTACC AGCACCCTCT     28920
     TTGTTACCAA TTCAAGATCG CACCCTCTGA ACGGTTACTG GAAATCTTTT GCCCACCCCT     28980
     TTCAGAGGGT TCGATCGGTG AAACCTGGGA GTAGTCTTCT GCCTCAGTAC AAATTGCTCT     29040
     CAAATCAATC ACAGGAATAC CCACGGCAAT GGCTTCCCGT AGAATCACAT CATTGAACAG     29100
     GGACAGGGCC GTTTTCTCGA TGCTGCTCAA ATTGGGTACG GCATCGTAAA TGGTGCAGAC     29160
     GCAGGTTGGC TTTTTGTAGC TCAGAGCCGT TTTTAGCATT TGCCGATAGC TGGTCTGAAA     29220
     GTCTACAATC ACGGTGGCAA AGTAGGCCAT GGCTTCCCCT ACAGACTTAA CCGGCTGATT     29280
     GAGGATAAAC GATCGAGTTA GGGCATCATT CCCACCCACA CTAATGACCA GATGGCTGGC     29340
     ATCGGCGGGT AACTGCTGTA ATTGCTGCAC CACATCCGAA GTAACATCTC CATCAACAGC     29400
     TAACAGGGTC GCCTTCCAAC CTTCCGGTAA TTGCTGTTGC AATTGTTTGA TGACAGGGGG     29460
     TTCGCCTGGC ACGTACTGGG CATTATCAAA AATGGAATCA CCCAGAAGTA CAACGTGATT     29520
     TGGATTTTTA GGGTTCATGG TTGAGTCCAG GTTGGTGAAT GAGGATGGCA TTGTTGATAC     29580
     TCCTGCTAAA ACAGTTACTG AATGTTTTCA AGCTTGTTGA GCGCGGGTTA CTGCTTGGGG     29640
     CTGCGATCGC GATAGCCCAG ATGGACCAGA GCGGTCTCTA CGGTGTTGAC TTTCTCGACC     29700
     AGAGCCACCC ACCCCTTCGC TCGAATTCCA TAAAGCTCTA AAAAGTGCGC CTGGGCCTGG     29760
     CGAAAGGGTC CGATCGTCTG CTGCATCGTT TTCACGGTCC AGGGCTGGTG TGGAAGGGAG     29820
     CGGGTTGCAG CTAAGTGCTC GATCGCCTGT TCATGGCTCT CCATCAGCTC AGCGGTGACC     29880
     CCGAGGATTT CAGCAGTGGT GCGACGGGAC CGGGCAACAT TATCGCGAAT GCGTTGGGCT     29940
     AAACTCATCA GCTTTCCTCC GTTAGCCAGC GGATGACTTG TTGAATCTCA GCCCCTAGCT     30000
     GGGGGTTAAG CTTAGATTTG ATATTGGACG ACAATCAACC TATCGGGCAA CGACAACCTT     30060
     TTGGCGGGTT AGCCAAGATG GACCCTGAGG GAGCCTCGGT CGAGAGCAGG GGATCAGGGG     30120
     TATCCGTCCA GGTTGTTTTC GCCTAAAAAA AGACACTAGG TCTTCCTCAC ACACTGGAGT     30180
     AAAACTAGTG TCTCCAAAAA CAATTGACTC CTATCATATC CGGGTTTACA TGAATGCACG     30240
     TCACCATGGA CTGACTCAAG TGGATGCGGC TCAAATTGCC GAGATTTCCT GTCGCAGTGG     30300
     TCAACGGATT GAAGCCGGGA CACTGCAACC CCAGCGAGGG GAGCGCCCCC GGGGGCGAAC     30360
     GGTGCCGGAC CCCTTAGCGG CGGTGTGGGA CAGCGAACTG GAACCGATGC TGGTTCGAGA     30420
     GCCGAAACTC AAGCCGATGA CCCTGTTTGA GTATTTGCAA GAGAAATATC CGGGTCAATA     30480
     CCCGCAGGTG TTACGGACCC TTCAGCGGCG GGTGCAAACC TGGAAAGTAC TGCATGGACC     30540
     GGCTCCAGAG GTGATGTTTG AGTTGCACCA TGCCCTGGGG GAGATGGGCC TGTCTGACTT     30600
     TACGGAACTC AAAACTGTGC AGGTCACGAT TGCCGGTCAA CCCTATGAGC ATCTGTTGTA     30660
     TCACTATCGC TTAGCCTATA GCGGTTGGCA GTACGCTCAG GTCATCGAAG GGGGGGAAAG     30720
     CTTTGTCGCG TTGTGCGAAG GCTTGCAGAA TGCCCTGTTT CGCTGTGGCG GGGTGCCCCA     30780
     ACAGCATCGC ACGGATAGCT TGAGTGCCGC CTATCGTAAC CTTGGGGGCA AATACCCGAA     30840
     ACCCTTGACG CGCCTATACA GCGACCTCTG CGACCACTAC CGCTTACAGC CCACCCGTAA     30900
     TAACACCGGG GTTGCCCATG AAAATGGCAG TATTGAATCC CCTCACGGTC ACTTGAAAAA     30960
     CCGCCTGGAG CAAGCGATCT ATTTGCGCGG CAGTGCTGAT TTTGCCAGTG TTGCTGAATA     31020
     TCAAGCGCTG ATAGAGACCG TGACCGCCCA ACTGAACCGG CAGTGCCAGG ACAAATTTGC     31080
     CCAGGAGCAG TCCCACCTCC AACCCTTGCC GGCCTACCGC CTGCCCGATT ATGAAATCCT     31140
     CAGTGTCAAA GTGAGCTGCC ACAGCACCAT CACGGTGCGC TGTGTGCTGT ACACCGTCCC     31200
     TTCCCGCTTG GTGGGTCGCC GTCTGGAATT ACATCTGTAC CACAACCGGA TGGTCGGCTA     31260
     TTTCGGCACT CAACGGGTCG TCGAACTCCC CCGTGTTCGG GTCCATCATC CCCAGAAGCG     31320
     CCGGGGGCGG TGTATTGATT ATCGCCATGT GATTGAAGCC CTGCATCGTA AGCCCCGCGC     31380
     CTTTCTCTAT TGCACCTGGC AATCCGACCT CTTGCCGAAT GCGGACTACC GCGAACTGTG     31440
     GCAACAGCTC AAAACTCAGT TCTCTCCCGA TGATGCCGCT CAACTCATGG TTGAAGCCCT     31500
     CTACCTGGCC GCCACCGGAA ATCAAGAGGC GGCCGTCGCC GAGTATCTCC AGCAAGCGCT     31560
     CTCGACCGGC ACCTTGAGTT TGTCGCGCCT GACGGGACAC TTTACGTTTC AGCCCACTCC     31620
     GACCTTGCCT GATCTGACCA TTCCTCAGCA CGACCTCTCC AGCTATGACC AACTCATCCC     31680
     TACCACCCCA GTCGAACCCA AGGGACTCGC TGAGCCCCCC CGCCCAGAGT CTGCCCCTGC     31740
     TGCTGAAGCA ACTGAATCTC TCCCACCTGT TGGATCACCT GGACGCTATC GAGCATCAAG     31800
     CTACGCAACA GAACTGGTCC TATGGACAAT TTTTGCTGCA CTTGTGTCAC CTGGAAGCCC     31860
     AACGCCGCGA GCACGTTCGC TTGCAACGCA GTCTCTCAGA AGCTCAACTC CCCGCCGCAA     31920
     AAAGTTTTAC CAACTTTGAT TTCTCCCACT GCCCCCAGTT CAATCCCGCC CCCTTGATGC     31980
     AGTTAGCCCA AGCGACCGAC TGGTTAGCCC GAGCTCAAAA CTGTATTCTG CTGGGTCCCT     32040
     CTGGGGTGGG CAAAACCCAC CTGGCCGCCA GTTTAGCCCG TCGCTGTATT GAGCTGGGCA     32100
     AGCGGGTCAA GTTCTTTGCG GCCACTGCCC TGGTCCAGCA GCTCCAAGAT GCCAAGCTCC     32160
     AACTCCAACT GTATCCGCTG CTGAAGAAAC TCGACCGCTA TGACCTCTTG GTCCTCGATG     32220
     ACCTGGGCTA TGTCAAGAAG AATGAGACGG AAACGTCGGT GCTGTTTGAG TTGATTGCTC     32280
     ATCGCTATGA ACGCAAAAGC CTCCTGATTA CCGCCAATCA ACCCTTCAGT CAGTGGGATA     32340
     GCATTTTCAG TGATTCCATG ATGACAGTCG CCGCCATTGA CCGGTTGGTC CATCATGGCG     32400
     TGATTATTGA CGTGCAGGCC CCCAGTTACC GCAAAGCTGC CGCCAGCCAA CGTCTAACCC     32460
     AATCTGCTGC CACGGCATAA CCCCAAGCCC TAGCGTGACA CCCGATCTGA TCCGAGCTTG     32520
     TCGTCCCGAT CTGGACTTGT CGTCCTGATC TGGTTGAGAT CTGAAGTTGT CATTGGACCC     32580
     AGCGATGGTC GTTTGACTCT AAAGGGGGCG CCTTTAAATC AAGTTGACTC CCTATCCACC     32640
     CGACCAGTAG GTTGTCGTCA TCTTGCTATG TGCTTGACAT TTGACAATTT GATCTGTTTC     32700
     AGCTTTTCGA CACTACGGTG CTCATTCATT TCTTTACGTT CGACCACCTC GGCGATCGCC     32760
     AGCATTTCCT GTTCCTGTTC CGCCCGTTGC TGAATCAAAG CGGCTACTTT CCGTTTTAGT     32820
     CCTGCCACCC AGCGGCTATA GCGATTCAGT TCACGGCAAA GCGTATGGTT ACGTTGCTCC     32880
     GTTTCATCTG CCAGAGCTAA CCCCGCCTCA ACATCAGCAG TCAGGTTAAA AATGGTCGAT     32940
     AAAGCTTGCT GAAGTTGGCA TTCGGCCTGT TCCGCCTTTT CTCGCTGGCT TTCCAGTTCT     33000
     TGCAGCAGGT ATGCAAGCTT ATCTTCCAAC TCACCAGGGT AGAGGTTATT GTCAAAGGTC     33060
     GGGGCAAGTA ACAGTTTGAG GATACGGGCG GCTGTCCTGC GGTTAATGAT CGCATTGTCG     33120
     TAATGACCAG GAATCGAAAC ACAGGGATAG CCCTCGCGGA TGGCTTTGAA CGGTTCTTTT     33180
     CCTCCCTGCA CAATCTGCCA CCCATGCTCC CGGGCGATCG CGACCAACTG TTTGCGGGTA     33240
     ATATTTCTGG CCAGCTCACG GACCAGTTCA TTCAATGACT TTTTAGGTTC AGGATATTGC     33300
     ATTGCCATCA TAATTTAGAA CGCTAGGGAT TACTGAAGGT GGACTGGGGG ATCGAGCTGT     33360
     TGGGGCATCC TAAATCTGGG GCATCTCAGA CTGAGAGGAG GCTGTTGTGG GGGGCAAAGC     33420
     AGCCTGTTCC CCGCCACGCA AACCCAGAAA TGTCGCACCA GCTTCTTCGA GCAGGTCAAA     33480
     CACCGCATTG ATCACCCCAC GGAATCCCCG CTGAGTCCGG GCTAATTCCA TCACCGCTTT     33540
     GTCCAGGTCT GCCTGCTTTA CGCTGAGCTG TACTTCAAGA TTGTTTGACA GGTCTTGATA     33600
     ATGAACCAAT GTCTGCTGCA CAGTTTGCAG TTCTAGCTGG ACCTGCTCCA GTTCGCTGTT     33660
     TAGAGTAAGC TGTATAGCAC TGGCCTGCTC CAGTTCGCTA TTTAGAGTAA GCTGATTGGC     33720
     CTTGGCTTGC TCCAGAGCGA GTTGTAATTC CTCTACCCGT GCCCGCAGTT GTTGTTCCTG     33780
     CGCTTCCACC TGCTGCAATT TGCGATTTGC TTCACTTGAT GGCGGGGAGG GGGGAGCTTT     33840
     CAACTCAAAG CGGAGCACAT ACTCTCGAGC ATAGGCAAGG ATAAAGACAG CACTACCAAT     33900
     GGTGGCAACC CCTCGAACGA GCATGGGAAG TGTAGTCTGG ATAAATTCGT GATTCATGGG     33960
     ATAGGTCTCT CAAACGCTTT ACCTATTCCT CCAGGCCGGT TGAGCGAGAT ATGCAACCCC     34020
     TTCAGATCAG TCCATACTTT TTTCTAAAAA TCACGATGGC TTTGAGAAGC ATTAGTTGTG     34080
     TAGGGGCTTG TACTACTACA GAAATGACCA AAATGTTACA AAACTATACG GATTTCTGTT     34140
     ATTCGCATTA AATTCGACCT CTGCAGCAAG TCATGCTCTC ATACTGTTAG GTATCAAAAA     34200
     TACAGCAGTC CCTAAAGTCA TAGAACCAGG ATAGACGTGC TTTTCGCGTA GTCCAATGTT     34260
     TGAAGGGCTA ATGTATCTTC TTGTCTAAAT TTAAGGAATT TCTTGCAAAA TGTGAGCTGC     34320
     AGGATAGTTG GCTTTAAAGC AGCCAAAATA GCAACTGCTT AACTTCCACC CATTTATCTA     34380
     TTTACATAGG ACCTAGTTAA AAAGGGGTTT TATGACCATC TCATCCGACA CGCTAGCAAA     34440
     TAATCAGACT ATTTACACTG CCATAAGCTT TGCTCCCGTT CAGGGCTTTA TTGAAAAGTC     34500
     TCGTAAGTTA CGAGATTTAT TTGGTGCTTC TCTAATACTT TCCTACTTAA GTGCCAAGTT     34560
     GGTTGATCTT GCAAAAGAGC AGGGTTTAGA AGTTATTTCT CCTGGATCGG TTGATGTTAA     34620
     AGAGGGAATG CCAAACCGCA TCCTAGTAAA AGGAAACACA AATCTAAATC GTGACAAAGT     34680
     GAAAAACACC CTCATAATGG AATGGGGCAG AATTCTGGAT AAATGCCAAG CTTGGGTGGA     34740
     ACAAAAAGTC AGTGAGGAAG AGTACCATTG GTCGCAAAAA GAGGAAGATC AGGGTAAACA     34800
     GAAGGGCGAA TGGGAACGTT GGAAAAGCTA TGCTTGGGAA GTGTTTTGGG GATACGGTTC     34860
     AACTGTCAAA GATGCAATGG AAGATCTCGA GACGCGCAAA CTAAAAAGAG ATTGGATTGG     34920
     TATTAACTGG ATAGGTGAGA GTTCAAGCTT GAGCGGAACT GATGCAATTG CATGGCATGG     34980
     TTTAGGACAG GAGTCGGATC GTCCGTGGGA ATGGGCGCGC CATCAGGACT CTGTGAACAG     35040
     ATTCTATGAG CAATTAGCTA CCGCCTTAGA AAAATCACCA GATGGTGTCT TGTTAGGCAA     35100
     GTTCTTGGAT CCAAATGAAC GCTTAAGTAT CCCTGAATTA GTCAAACGGT TAGTCACTCG     35160
     TTATGAGGAT ATTGGACGGC ACTTTGGTAA GGATTTCCGC TTCGATAGCC TCTCCGAAAT     35220
     GGTGCGCTTG CCCCAACCAG ATCAGCCAGG ACACTGGACA GGTTGGTTTA TGGGAGATGG     35280
     AGATAGCGTG GGTGACATGC TCAAGGAGTT AGCCAAAAAT CCCGATGACA TCCACCCGCT     35340
     GAAGACATTT AGCAATGCCA TGCGGGATTG GGGCAGAGAT TTTAAGCATG GTTTTCCCGA     35400
     TGAGCTAGGC CGGGTGATTT ATGCGGGTGG TGATGACTTT TTAGGGGTAA TCTACAGCAA     35460
     AGATCCCAAG GCTCCGATAC CTGAACAAAC TGCGTTGCAG TGGTTGATGA GCCTAAATGG     35520
     CCAGTGGCAA GCTCATGGTC AGCCCATTAC CCTTAGTGTG GGGTTTGTTT GGGCAGGGCA     35580
     TAGTGTGCCA CAGCGGGATG TATTGCAACA TTGCCGAGAG GCAGAAAAAC GCGCCAAAGC     35640
     ATTAGGTAAG AACCGTGTCA CGATTCGTGT GTTGTTTAAC AGCGGTCAAT ATGTGCAGTG     35700
     GACTTGTCCT TGGAACTATT TGAATATTCT GAAGAAGTAC CGAGATCGTG ATGGCAGGAC     35760
     TAGCTCAGAA GCTAACTGGA ATCACCTTTA TAGCGATTGG GCAACCCTAA AAGCTCGTCA     35820
     TGCTATTCGA TTAGAGGAAA TGGAAGATTT TACAGTAAAT AAACAAATTG CTGTCTCAGT     35880
     ATTTGACCTG TACTTTGACA ATTCAGCCAC AGAATTTGAG ACAAAGCGAT TATGGCAAGA     35940
     ACTGACTGGC GATAACTCTG CAAAGGCGAT CGTCAACTGG ATGGATGACC TGATTCAAGT     36000
     GGGGTGGCAA TTATGTCGCA ATTCCAAGCT CTAATTACGG TGTCGCCCCT AGGGCTCATG     36060
     TATGGAAGTG CTGGTGGTTT TTTGTCACCT GAAAACTTAG TTGGGCGATC TAACACCAAA     36120
     TTTCCACCCG ATGCCGCGAC AATAGCAGGC TTGTTGCTGA ATGCTAATCG GGAAAAGCAA     36180
     TGGCTTGATC CGCAGCAGTT GAAGCAGGAT TTAGTTATTG CAGGTCCGTT TTGGGCAAAT     36240
     CGGGATACCC CAACCCGCTT TTATATCCCT ATTCCCTGGA ACCGAGTAAT TGGGGAAAAC     36300
     GATAGTGATG AATGGGAATT GGCTAAAAAG CCACGGGCTA ACCAGGAGTC AGAAACTACC     36360
     AATGAGCAAT GGTTGCTGAA CCAACACCAA TGGCAACGAC ACAAAAAAGA TGTTGAGCCA     36420
     GCCTATACTT GGCAGTTAAT TGATGGCTGG GATTTGCCAA CTGATGAGTT GCGGGAGCGA     36480
     GAGGCGATCG CAGAGGTGCC CTGGAAATAC ACGCCATTCC TTCACCCCAA AATCAAGCCA     36540
     GATGAACGGC ATGTGGTGGA TCAGGATGGG TTGTTTCTGG AAAATGCGGT GCAACTGAGA     36600
     GAGGATGCCT GCTTAGTCTA TCTGACTAAC ATTGCCCAAA GCGACCTAGA TCCATTGGTG     36660
     GGGTGGTACC GGTTAGGGGG TGAAGGGCAT TTGGTGGAGG TCGAAAGCCA TGAACTATCA     36720
     GCCAAGCACA AAATTAATCG TCTCTTAGCT CAAAAAATCG ATCATGCTTT TGCCCTGATT     36780
     ACACCAGGAG TATGGGGGTC GAACAAGCTG TCCTATCGTT ATCCACAACA CTCGAGTTTC     36840
     CCCAATCGAG ATTTGAAATT GCTTACGGAT AAAGCAGTAC CTTACCGTTA CCGCGTGGGT     36900
     CACTCTCAGA AAGATAAGCC AGAGGGGAGT GATTTCTACA ATCCCAGAAC TACAGGGCGC     36960
     TTAAGCCGGG GCCGTTATGC CGTTCCCGCT GGCAGTGTTT ATGTGTTTCG GGAACCCCTG     37020
     GGGATGACGT GGTGGGAATT TCCAGACGAA TGGTTCCCCA AGGAAGGTTT TCCCCTGAAG     37080
     CATTTGGGTT GTGGTTTATG TTTACCAATT AATTTGCAAG GAGTACCGGA ATGTACCAAA     37140
     AAGCTTACGG CGTAATTGAA GCATTGGCCC CTGTGCATGT GGGTGCTACA GCTGGGGAAG     37200
     AAACAGGCAA CCTTAATCTG ATTTTTCGTG ATCAGTTTAC TCAAACAGGA GTGATTCCTG     37260
     GTAGCTCCAT TCGGGGGCGG TTCCGAGCGG ATATGCGGGA TAACGAAGCA GGGGAAGAAC     37320
     AACGCTGGTA CGGTCATGAA GCGGTTACAG GTCGTCCAGA CGGTGGGACA AGTGAAGCTC     37380
     TAGTTAAGTT TGAATATGCC TCCTTAGTTT GGTTTCCCGT ATTCTGTCCC GGCCAACCTG     37440
     TAGTTTGGGT GAGTTGCCCC CTGTTGTTGA AGCGGTATAA ACGCATTGCC GGCATTGATG     37500
     CTAATGTGCC AGAACCCTAC ACCGCCCAAA GAGGTTTACA GGGGCGACAA ATGCCTGATC     37560
     GAGGTAAAAT TTTGTTCTTC AATCTGGGAT TCTTGGAGAT TGAGCATGAA GCTGATCTGT     37620
     CAGCCTGGGT CCCGGCTGGA ACGGAGTTGG ATGCCAATAA ACTCGTTATT GTCAGTGATA     37680
     ACGATATTTC TATGCTGCAT GACATGGCTC TTTACCGCCA GAGCCGTGTG AAGTTACTGG     37740
     ATGAAATGAA GAAGGTAGAC ACTGAACGGG GGGCTTTCTT TAATACAGAA GCTTTACCCG     37800
     AGGGCAGCAT TCTGGTTTTC CCTATTGCCC TGAAACAATC AGGTTGGAAA CCATTTGGAG     37860
     ATGAGGCTTC TTCGGAGTTG TACTTTGGCG GTTTGGAGTC AATTGGTTTT GGTCGGTGCC     37920
     GTGTGTTACT TGAAGGAGAT TATCAGTAAT GGCCTGGAAA TCCTATGAAC TCGATCGTAT     37980
     TGCTCAAAAA TTGGTACTGG TAGCTCGTGA ACGTGATCCC AAATCCTTGA ATCAATCCCA     38040
     CAAAATGCGA ATGGCAGTTG CCTATGGACT AGAACGTTTC TGGGGCGAGC ATTTACGACT     38100
     CAAAGGTAAG GAAGAGGCAA AGTCTAAGTA TTGGAAAGCC ACATGGGATG CCTTCTGCGA     38160
     TGTGATGGCG AAGGTGGATA TTAAACTACC CAAAGATACT GTAGGAGCTG AAGATACGAA     38220
     GAAAATTCAA GATATTTCTA CGCATCTGTG GAAGTTGCCT GTGGAGGATC AACGAGTGGC     38280
     AATCGCTGTC CTAACCCAAC TTTGTGACTG CATCGTTTGG TGGACTCAAC GTTACAAAAT     38340
     TGGGAGGTTA GCCGATGAGA GCGATTCCTG ATGCTCACAA AAAAGTGCCG ATGATGTTTC     38400
     GGGCACAGGT GAATGAGCGG TGCCAAATTC AACGGTTGGT CAAAGGCGAG GAACCAGATG     38460
     CCGTTCGGTG GGCAGATGAA TGGACTTCGC GAGTGGAAAC TCTTCCCAGT CCTCCATCCG     38520
     AAGAGGTGCA AACACGGGAC TGTGAAATTG CGTGGCGGTT GATCACCAAC TCTGGCTTAG     38580
     ATGATGGAGT GATTCGTCCG GTCATTGGTG CCCAAGGGTT ACCCTACTTT CCGGGTAGCA     38640
     GCATGAAAGG GATGTTCCGA CGGGCTTGCA CCCCTGCCCA AGCCGATCGC TATTGTGGTA     38700
     GACCTTTACC TGGAAATGAT TGGCAACCTG GAATTCTACG ATTTCATGGT GGCTATCCAA     38760
     TTGAACAAAA CTGGACTGAA CATCTAGTGG ATATTGTCCA TCCGCAGCAA AGTTGGCAAG     38820
     TTAAAAGCAA CGATAAGGAA GGGGGAGCAT TCGTGCAGAT CTCCCTCTAC AAACCCATCT     38880
     TACGCTTTGG TATCTCCAGC ACTTTACCAC TTGAACCCAG CGAATGGGAT GACATTTGGG     38940
     ATGTTTGGCA ACGGGCATTA GCGAAAGGCA TTGGGTCACG AGTGGCAGCC GGTTATGGGC     39000
     AAGTGCGGGA TAGCCAGCCA ACGGTGTTGC ACAAATCTCG TTTGAAAGGG CAAGGACAAG     39060
     CCCCCAAACT GATTACCCAA GCAGGGGAAT TCCGCCCCAA TATGTTTCGT GCAGCCTTAC     39120
     GGGGTCATGC CCTCCGAATT TTTGGCGGTT TAACCGATGC TACCACCGCA GAAAGGTTAG     39180
     TTCAAAACCT ATTTGGCGGC ATCCAAGGGC GGGAAGGTAC GGTAGGGTTG CTAGGCTTAA     39240
     AGTTTGTTGA GTCTAAGTTG ACCATTGGCA GTTTTGGCGG TGGTTCCTAT GCCCAACCCT     39300
     GCTATGACGT AGAGGGAGAG TTAACCTGGT ATCTGGCGCG ATCGCTCCCT GATCCAGCCC     39360
     ATGAACCATT GTTGAAAAAA CTAGTCGCTA ATTTGATGCA ATTCGCTATG GTGTTTGGTG     39420
     GGTTTGGAAA ATCCTGGCGA AGGGCGGATC ATCGCAAATT TTTCGAAGAG TATTATGACG     39480
     ATGGTTACAA AGCCCTGATC GGCTGTCATT GGCAATGGTT AGGCGATCTT TCGTTACGCC     39540
     GCAATGTCAA GGTGTGGAAT GTCAATAAAA TCGGTGGGGC GATTGACCAA GTGCGGACTG     39600
     CAGCCGAAGA GTGGATGCGA TCACAAGGTG TAAACCCAAC CCCCAACCGT TGGGCGCAGC     39660
     CCTGGCGGGA AGTATGGCAT CCCAGTAATG TACAAGTGTG GGGACGAGAA GCCACGGATG     39720
     CTGAAAGCAG CGAGGCCATT CGTTGGTTCC ATAGTGCCTA TCGACAAGCT ATTCCTAAAG     39780
     TCTGTTCTGA AGGCTCAATC TACAAAAGTG ACTTTGTTGG CAGGGTGAGC CAAGTCGGAA     39840
     AACTCTGGCA TCGCATGTAT CCAGTCGTCA TATTGATCAA AAATCCGGAT GATCCTCAAA     39900
     AACCGACGGT GCGGAAGACG GCCAAGTATT TAGAGTTGTT GACCCTTTTC CCTGATGGCT     39960
     CCGATACTGC CAATGCCTTT TTAGATTTTT TAGAAACGAA ACCCTTTGGC TTTGAGCAAT     40020
     TGTGGGGTGG GGAGTAAAAA TGCATCTGTG GATTGTGACG ATCGGAAGTA GTGATGTCCA     40080
     ACTCATCAGC GACAAGGCAA ATCAGGCTAA GGGAAGAACG GAAAAGCAAC GCAGCGATAA     40140
     GGTCTGGAGT TATTGGTACA CAGATGACTT GAGGGCTGAC TGCTATGATA TTCCCTTTGA     40200
     ACCAAAGCAG CTTTTTAAGG ATAAGGAAGA GTCATACCGG ATTGCCCCTC GAATTCTAGG     40260
     TAGGGTTTAC CAGGCTAGTG ATGAGTCGAG GCAACACGAG ATTTTGGACT ACTTAAGTTT     40320
     TCCTTTATTG GACAACTTCG TACAGGCATT AAAAGACTAC CCTGCACCAG AGGCGATCGC     40380
     AGTTCTCCTC ACGGATCAAT CAACCATTTT TGGCAGCGAT CGCCAACGTA AGCTCAATAG     40440
     CCCTTATTGG CAAGACACCT GCGAGTTACA ACCCATTTTG CAGGACTATT TTGCAGAAAA     40500
     GTTTCCGGGT GCAGCCTGTG AGTTTATCTC CCTCATCCCC AACTCTGAAG CCGAAAGTCT     40560
     TGATAATTGG AATGCAGTTC TAGATTTGGT GCGTGGAAAA TTCCGCAGCT TAACCATTGC     40620
     GGATCAACCG ATCCAAGTTA ATCCAGGGAA AAATGTCTAT GTCAGCCATC AGGCAGGTAC     40680
     ACCCGCAATT TCATCAGCAG TACAATTTAT CAGCCTGTCA CGGTTTAGAG ATAATGTACA     40740
     GTTTTTGGTT AGCAATGAGT ACGATCGCCA AACCTGCACA ATACCCCGTT CTAACTATCT     40800
     CCGTGAACTT CAGCGTCAGG AAGCGATCGC CTTGTTAGAG CGACGTGATT ACGGAGGAGT     40860
     ACGAGATGTG TTGGGGCTTA CCGCAATAAC ACCAGGTAAC TCATCAGAGA AACGGGCTAA     40920
     ATATCTTTTA GAAGCTGGAA ATCAATGGAA TTTTGCTGAG TTTCAAAAGT TCAAAAAAAT     40980
     CCTTGTCGAT CGCAAACTTA TATCTGGTGT TAAGTTCCCC TGGTGGCGAT TGGGTTACGA     41040
     GTCTGCATAT CTTTCGGTAA TTCGTTTAAC AAAACAAGAA AATACGGTGG AAGCTCTGTT     41100
     TCATAGCTTT CGAGCGATTG AAGGTTCAAT TAGTCGATGG GCTCAAGATA AATATAGATC     41160
     TCACATTGAG GTAGACCCGC AATATGGTCC TCAAATTAAA CTTTCAATTC AAAGAGAATT     41220
     ACCAGGCTAT CTAAATGCTC TTTCGGAGTC GATGCAGGAT AACTTCCAGA GGAAGGGAAG     41280
     AATTGGGCTA TATGGTGTCC AACTTTATGA GTTATTGAAG GAAGCACGCT CTGACTGGCA     41340
     AATAGACCAC CATATCAAGG TAGTTTGGGA AACGACGAAG AATCAGCGCA ATGAGCTATT     41400
     CCATCGAATT GAAGGCTTAC AAACGGTTGA GGTTTACCAA GCCTGGGGTA CCAACACAGT     41460
     AGAGGAATGG AAAGCAAAAG TCCTTGGTTG CCTAAACTTC ATTGCTAAAG ATGATCTACC     41520
     ACAAAAGTTT GAGTCTTTAG AAGAAGCGAG TTTAATGACA GAAGTACATC AGGAATTGGA     41580
     AAGGGCGATC GCCGATCTCT AAGCCCCAAT TTGTTCGGCG TACAATCCAG ATTCAATGTG     41640
     TGATCGCCCA ACTCTAACCC TTCTAAAATA AACTCATCCC CACTTCTTGC CCGGATCATG     41700
     ATTGCTTCAC CCCAACCGTC CCTGTCTGCT GAAGCCTATC TCCAACTCGA AGCCCAAAGC     41760
     CAGACCAAAC ACGAATACAT CAACGGTGAA GTCTATGCCA TGGCAGGAGC CAGCGATACT     41820
     CATGTGACGA TCGCAGGCAA CCTCTTTGTC CTTCTCCGTA GCCACCTGCG GGACAGTGGG     41880
     TGCCGTGTTT ATATTGCCGA CATGAAAATC CGCATCGCAG CCCGCAATTG TTTCTATTAC     41940
     CCAGATGTGA TGGCCACCTG CGGCCCACAG GATCAGCAAA CTCCCAACTA CAAACGCTTT     42000
     CCTAAGCTGA TTGTGGAAGT CTTGTCTGAC TCTACGGAAG CCTTTGACCG GGGCGATAAA     42060
     TTTGCAGACT ATCAGACCCT AGCCAGCCTG GAAGAATATG TGTTACTCAA TACCCGCCAC     42120
     CGACGAGTTG AGTGCTTTCG GCGAAATCCA CAAGGATTAT GGGTTTTGCA ATCCTACCTA     42180
     CCGGAAACTG ACAGCTTTGA ATTGCAAAGC GTGGAGTTTT CTGGCACCTT GACCGCCTTA     42240
     TATGAAGATG TGGTGCTAGA ACCATCCCAT TCACCGCCAG TTTGATGATT CTGACGACTC     42300
     TGCCGCGTTT GGAGGGAAGT GATTGGCAAG GGCGATCGCC CATCTCTAAC GCAACCGCAA     42360
     TTACCCAGCC AAACTTATTC ATCTAAGCAC AAAGCCTTCA GTTACAGGGC TGGAATATGG     42420
     AATCCCTAAG CAGTGTCATC GGCCAGCAAA GCTGCAGATT TCCTTTCAGA CTGTCATTCG     42480
     CATGGAAGAT ATTTGTCACC CTATAGTATC AACCTAAACT GACCTTAGTT CCTGAGTGGA     42540
     GTGAGGTCTG ATGAACAACC AATCGTTACT CCAGCTTCCC CGCTATAAGT GCTGGCCACG     42600
     CTATGCCAAT GGTCAACAAG TCTTCCATCT CCATGACCGC AACTATGTCG GTGTGAGCAC     42660
     CATTCTTAAA GCAACGGAAC CGCTTGAAGT GCAGGCCCAA CTGGCTGCCT GGAGATCGCG     42720
     TGTTGGAGCT GAGGAAGCCG AACGGATTAT TCGAGCGTCG ATCAATCGTG GTAAGCGGTT     42780
     ACATCGGCTG GTTGAAAATC ACTTCTTACA ATCCCAGGGG GCAGAGGCAA CTCCAGAATT     42840
     CTGGGGGTAC TGGCAATCCC TTCAGCCCGT CTTGTCCGAG ATCACGGATG TCTATTTGGT     42900
     GGAAGGGCTT GTCTGGCATC CCCATGGGTT TGCAGGGGTG ACGGATGCAT TGTTGGCTTA     42960
     TCAGGGTCAA ATGTGTGTTT GCGACTGGAC GACGTCACCT AAGCCAAAAC AATGGACCTG     43020
     GATTCAAAAT AAGTGTTTGC AAGTGGCTGC CTATACTGCT GCAATCAACC GTGTCTATCA     43080
     GTCTTATGGG GTGCGGGTAA ATCAGGCTCA GATTGTGATT GCCTTACCTG ACACCGATGC     43140
     TCAGGTGTTT CGGCTCGAAC CCAGCCAGTT AATGGACTTC TGGCACCAAT TTCAGGACAG     43200
     GTTGGCTGAA TATAAAAAAC TCTGCGCTAT TCCTACTCAC TAAATCTTGA AGGTTTTACA     43260
     GTGTATATAG CAATTTCCAG CCTGTTGAAG CGCAGTTAGT ACAATAGTAA GTAGGTTTAC     43320
     TACATCTCAA TCAAGTGAAG CCCTACTCCC TCGATCTTCG ACAAAAAATC GTGGACGTTT     43380
     TTATTGAAGG TCAGACCTCC CAACGTCAAA TTGCCATCCA ATTCCGAGTC GCTTATAGCT     43440
     TTGTGCGTAA GTTAATCAAG CAATATCGAG AAACCGGTGA CATTGCCCCA AAACAAAGAA     43500
     CGGAGCAAAC TCCCACTAAA CTCAGTGCTG ATCAACTAGA GACGCTCAAG ACCCTCGTGG     43560
     AATCGAACAA CGATGCGACG TTGTCCGAGC TGTGTGACTT GTTAGAACAG GCGGTCGGCG     43620
     TACGGATTGG GGTCTCGACC ATGTTTCGGA TGCTCGAGAC GTTGAACTTA ACACTCAAAA     43680
     AAAAAACACT GCATCCCGAC GAAAAGGAAA CCGAACGGGT GCAAACTGAA CGCGTAGAGT     43740
     TTTGGCAACG AGTTGGAGAA TTTTTGGCTC AAGACCTGGT ATTTATCGAC GAATCAGGCG     43800
     TAGACTTAGC GTTGACCCGA TTACATGCTC GTGCATTGAA AGGAAAAAGA GCGCATGGCA     43860
     AACGTCCAAG CAAGCGCGGG AAACGGGTCT CGATGCTGAG TGCGATTAGC CTTCAGGAAG     43920
     TCATGACTCA CTGCAGTTTG ATAGGGGCAA CGGATGGACT CACGTTTGAA GCCTTCATCT     43980
     CCCAAAAACT AGTTTCTAAA TTGTGGAAAG AGGCCTGTGT CATTATGGAT CGGTGCTCTA     44040
     TTCATCAAGG GGAAGAAGTC AGAGCAATGA TTGAGCGTGC AGGCGCGAAT CTGATCTTCC     44100
     TACCGCCTTA CTCACCAGAC TTTTCGCCCA TCGAAAACTG CTTATCTAAG ATTAAGAGCA     44160
     TTCTGCGTTC TATTGGGGCA CGGAGTTATC CAGACCTTGA CAAAGCAATT AAAGAAGCTT     44220
     TTTCCCAAGT ATCATTGAAT GACCTAAGAA ATTGGTTTAC TCATTGCTGT TACTGTACCT     44280
     CACTAGATTG AAAAATGCTA TATTTCTCCC CCTGCTCTTC AGGTACGTAC TCTGGTAATC     44340
     TCTAAAATTA ACGCCATTTT TACGCTAGTG ATACTGTTGA AATATTAAGC TCTTCTAAAA     44400
     ACCTAATAGT CTTTTAGTGC CAAGCTGTTG TTCGCATGAA TTCATCATTC TGTTTCCCGC     44460
     TTACCTCTAG ACTTGGGATC TGTTCTTTGG TTTAGGGGAG TAACTACCAT GCGTCTTAAC     44520
     AACTGGAAAT CGAGTGGTAA ACCACAAAAT AAAAGCTGCA AAACTCCAAA AGCTGCCCGT     44580
     CGGAAGCGGC GAATGTTAGC TAAATTAGCC CAAAAGTTAC GCAAGGCGCA TCAGTAAAAG     44640
     CTAAATATTC CTATCTACCT GATATTTGTC TATCTGGTCG TCTCATGTAT TCCCGTGCCA     44700
     GTATAGGTTT AAGCTCTTCT GTCCGATTAT GGGTTTTGTC TGACTATGGT CAGTGTTGCA     44760
     CCGCCACCCC AATTCTCTGT CCATCCGATC GGTGAGAAGC GCGTTACGTT TCACCATCTC     44820
     AACTGGCAGT CTTATCAGCA AATTCTCCAT GCCCTCCCCC AGAGCCGTGC TGCTCGACTG     44880
     ACCTACGATC GTGGAATCCT TGAAATCACC ATGCCCCTGG AAGACCATGA ATCTGCTGTA     44940
     CGCTTGATTG AACTCTTCAT TCGTATTCTT GTGGTCGAAA GGGGATTGAA ACTCAAAACT     45000
     ATAGGCTCTA CTACCCTGGA GCGGCCAGAC CTCGATCGCA GCCCTGAACC AGACTGTGCC     45060
     TACTATAGCT TTAGCCATAT TTATTAGGAC GCGACCTGGT TGAGAACAGC TTCCATTGCC     45120
     TCCCGTAAAT TCTCACATTG AGGGAGTAGT TTGCGAATTC TGCTTTTTAA GGTAGCCCAA     45180
     CACTTTTCAA TGCGATTGAG GTCCGGGGAA TAGGGCGGGA GATAGACTAA CTGGCATCCG     45240
     GTGGCTTCAA TCAACTCAGC AATCCGACCC CCGTGATGAA ACGTGGCATT GTCCACAATC     45300
     ACCCACTCCC CTGGACGTAA CAACGGTATC AAGCAGGTTT CTAACCAAGT TTCAAACACG     45360
     GTTCGATTAC ACGCACCTTC AACGGTAAAG GGGGCAATGA GTTGACCCGC GCGATAACCC     45420
     GCGATCATAT TGATGCGACC TTGACGCCGA CCAGACTTGA GGTCGTAGAA GCGTTGACCG     45480
     ATGGGGGCGT AACCATACCC ATAATTGTCT CTTTCATCCA TGCCCGACTC ATCCACATAG     45540
     ACCAGGTGAG GCGCTTTCGG GTTTTTCAGT TGAGCTAAGA ACGCTGCGCG CTTGACCTCA     45600
     TCGCGTTGAG TGTACCCGTA CGTTTTTTTT TACGGCTATA TCCAATCGTC TTTAAGGCTC     45660
     TTGAAATCGT GCGTTGAGAG ATCTCCCCCT CCCACAGTTG GACCATCTCA TGCTGGGTTT     45720
     GATCCCCATG CTCGTTCACA AACGCCCGGA ACTTCTCCCA ATCCCTAATT CTTCTACTCC     45780
     GGTCGCACGC AGGTCTGGCT TTCGGTTGGA TATCTCCGGT TTCGGCTTTA CGCTGGCACC     45840
     ACAAGTTGAT CGTGTTGCGA CTGATATTGA ACAGTTGGCT CGCTTCACTT TTCTTGAGTC     45900
     CGTCCAACTC AATCGCTTGT ATGACTTTTC GCCGGAAATC TTCGCTATAG GGTTTAGCCA     45960
     TTTCAAGGGG AGGAGATGCA GAGGTAATCT TTATAGTCTA CGTCCTAACC TTCCCGGCTA     46020
     AAGCTATACA TCCAGAATCA AGCACGGGTA GCCGGAAAGA CTGTTGATTT GACCCAGGAT     46080
     CCTCCACCCG ATCTCGTTGT CGAAATTGAC ATCACCCACA CAGATATCAA TAAGCTCAAC     46140
     CTTGATGCCA ACTTGGGGGT ACCAGAGTTC TGGCGTTACA ACGGGCGGGA GTGGCGGATC     46200
     TATCAGCTAC AGGGTCAGGA ATACTGTGAG CTAGGGAGCA GCCCCACGTT CCCCCAAGTT     46260
     CCGAAGGAAA AGTTATACGA ATTTTTGGCT CAGGCTCAGC TGGATGAAGT TGAAGCAGAG     46320
     CAGTCCTTCC GGTCCTGGGT ACGGGAACAG CATGTTAGTT AACCTCCAAA CCTGGGTGCG     46380
     GTTTAGTTCT CCTTTGCTTC TTCGTTATTC GCATCAAATC CGTACAGTTT ATCTAGTGAA     46440
     CTGACTAAAT TGGTTGCAGT TTCCCTGAGG TAAATATGTA CATCTCTCCT CGTTTTGCTC     46500
     AGGTTCGCAA CCTTACGGTG GCTATTGTTA ACGGAACCGT TACTCTGGTG ATCCTTCTAA     46560
     TTGCCCCGCT TGGGTTAGCG GCTGTGATCA TCAATACGGC TCTGGTTACT CTCAGTTCCT     46620
     ACATCACCGC CATCGCTGCT GATCGGGTTG TTCTTTTCCT GCAGGCCGAT GGCACCCCTC     46680
     AGGCTCATTT AATTAACCAT CAACGCCGTC GAACCACCAG GGACCAGCTT CCCCCCTCTG     46740
     CAGAAGATGA CATTGAGCGT TGGTAGGTAA CCCATGCGAT CGCTCTACAT CAGTCAGCAG     46800
     GGTTGCTATG TTTCTCTGCG CCAGGAAATG CTACTGGTCA AACAGGGAAC CACAGTGCTG     46860
     GAATCGGTAC AACTTCCCCT CCTGGATCAA ATTCTCGTTT TTGGTACAGC TCAGCTCACC     46920
     ACCCAAGCCA TGCGGGCTTG CCTCAGCCGT CATATTCCGA TCGCTTTCCT ATCGCGGATG     46980
     GGTTACTGCT ATGGTCGCTT ACTGCCTCTG GAGCGGGGTT ATCGTCGCTT AGCCCGTTTT     47040
     CAACAAATGC TGCACACGGG TGAACGGCTG GTGATTGCCC GACAGATGGT CTGGGGAAAG     47100
     CTAAAAAATT CGCGGGTGCT GCTAATGCGC CAACAACAAC GACGCGACTC TCCTGATCTG     47160
     ACTACAGCCA TACAGGCCCT GGACCATTTT GCTGATAATG TTCGCCTGGC CAATTCGCAC     47220
     GAACAACTCC TGGGGTTGGA AGGGGCAGGG GCAGCCACCT ATTTCAAGGC CCTGGGAAGC     47280
     TGCATCCTGC GGGAGGGGTT TACGTTTGCA GGCAGAACCC GCCGGCCACC CACCAATCCG     47340
     GTCAATGCTC TCCTCAGTTT TGGCTATCAG GTACTCTGGA ATCACTTGCT CGCCTTGATC     47400
     GAATTACAGG ATCTGGATCC CTATGAGTCC TGTTTGCACC AGAGTGGCGA TCGACATCCT     47460
     GCCCTCGCTT CTGACCTGTT GGAAGAATTC CGTGCCCCCA TTGTTGACTC TCTCACCTTG     47520
     TATTTGGTCA ACCGTGGAAT TGTGGATGCG GATAAGGATT TTGAATACCG GGATGGCGGT     47580
     TGTTTGCTAA ATAATAGCGG TCGCAAGAAG TACCTTTCAG CTTTTTTACA ACGGATGGAA     47640
     GAGCAGTTAC ATACTGCTAA TGGGCTACAA CCCCGCTGGG AACTCCTCAC TCAACAGGTG     47700
     CGTGCTTATA AGGCTTTTGT TTATGCACCT GCCCACGGTT ATCAACCTTA TCTAACACGC     47760
     TAGCCAATGC TCTTTTACGT CATTGCCTAC GATATTTCCT GCAATAAACG CCGTAAAAAA     47820
     GTAGCAGACT TGCTATGTGG TTATGGGCAA AGGGTGCAGT ATAGTGTTTT TGAATGTGTT     47880
     CTCACTCCAG ATAAGTACAA TGAGCTTCAA AAAAGATTGA AAAAACGCTA TAAAGAAACC     47940
     GAAGATAGTA TTAGATTTTA TCCTCTTTCA GGTCACACTT TGCCACAGGT AGAGGTATGG     48000
     GGTGGACCTC CTGTTTTTGA ACCACCAGGC TCCTATGTTG TCTAACAGTT TGAATTCATT     48060
     TGCGAGGGAT CGCCGAAATC GCCAGAACCC CTATTGTCTC GTCGGGAGCC TCGATGCCTT     48120
     GCCCAGTAAG GGTTTCAGAT TTTATTCGCT TGGATTATAT ACAAATTCCC TTCAGATTAA     48180
     AATGAGACTC GCAAATGCCC TCTGGAAGCT GCTCCTGGTA TAGGGTGTAG ACTATAGGGG     48240
     TCCCTACTTG TTAGGGAAAT CAATTGAATG GAAACAACTC TTCCGTCGCG CCACTGGGTT     48300
     GGGTGAGTGG AAGGTCCCTA CTTGTTAGGG AAATCAATTG AATGGAAACC TAGTTTATAG     48360
     AGTTGTTCAT CTGCCAGTTG AAAGTCCCTA CTTGTTAGGG AAATCAATTG AATGGAAACG     48420
     CTTCGACTCG GCAGCAGGGC ATTACCGACC ACTGAGTCCC TACTTGTTAG GGAAATCAAT     48480
     TGAATGGAAA CCTGTTCATG CTCCTTGCGG AAGGAGGCAG TCAGCTGTCC CTACTTGTTA     48540
     GGGAAATCAA TTGAATGGAA ACTCGTGTTG GACAGTATCG TAATAACGAG TTTATTAATG     48600
     TCCCTACTTG TTAGGGAAAT CAATTGAATG GAAACGATTG CGGGCCAGTC GCTTGACCTT     48660
     GCCAGTTCAA GAGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACAA AATCTAGCTA     48720
     ACTGGCAAGG TTTTCTAGAT GATTGTCCCT ACTTGTTAGG GAAATCAATT GAATGGAAAC     48780
     TGTATCGTCA TTAGTTAGGT ATGGGTAAGG GTAAGAAAGT CCCTACTTGT TAGGGAAATC     48840
     AATTGAATGG AAACCAAAAT TCATTACATC TTCTTACTCT AAAGACTTAG GTCCCTACTT     48900
     GTTAGGGAAA TCAATTGAAT GGAAACAAGA GGGGATACCG GAGACTAACA GTGCAGGGCC     48960
     AGGATGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA CGGTAAGACT GAGGACGGCA     49020
     GCGACCTGCT GTTTGACAGG TCCCTACTTG TTAGGGAAAT CAATTGAATG GAAACAGGAG     49080
     TTAGCAGGAG ATTAGACTAC GGGACTAGCA ACGTCCCTAC TTGTTAGGGA AATCAATTGA     49140
     ATGGAAACTT GGCAGGGTTA CACCGCAGAC AGCGCAGACT TTCCGTCCCT ACTTGTTAGG     49200
     GAAATCAATT GAATGGAAAC TATCAGCAGC GAGGCACTGG CCCTTCTACT GACTCAACGA     49260
     GTCCCTACTT GTTAGGGAAA TCAATTGAAT GGAAACTATT GCGTACCCAA ATGGAACCAA     49320
     TAGCGTGCTT TTGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACGA TGGGTTTTAT     49380
     GATTCTGGTC ACTACTTCTA CAGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACAA     49440
     CTTCTATTAA ATTACTACAA ACCGCTATTT ACGATAGTCC CTACTTGTTA GGGAAATCAA     49500
     TTGAATGGAA ACGAGCAGAG AAGGTCGATA AGAAGGCGCT GCAGAGATTT GTCCCTACTT     49560
     GTTAGGGAAA TCAATTGAAT GGAAACCAGT CGGTGGGATG GTCCCTCAGG CTAGCGAGAC     49620
     AGGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACAT AACAGTTAGG GGGTCGAGAG     49680
     GCCCCCTTCT CCTTAGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA CGGTGAATGT     49740
     GCCTGGCGGC GCGGGGAAGA GTGACATACG TCCCTACTTG TTAGGGAAAT CAATTGAATG     49800
     GAAACAAAGT CACGGGCGGT GAAGCGACGC ATCAACTTCT CAGCTGTCCC TACTTGTTAG     49860
     GGAAATCAAT TGAATGGAAA CTGGTTCTCA GCAGGTGACT GAGGGATGGA GCAAAGATGT     49920
     CCCTACTTGT TAGGGAAATC AATTGAATGG AAACGATCGG AGCAGAGCTT ACGCAATTCC     49980
     CTGATGTTTA GGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACGCA ACTAAGACCG     50040
     CACAGGCAGA GTTAAACCGA TTCGTCCCTA CTTGTTAGGG AAATCAATTG AATGGAAACT     50100
     ACCTCAGTCA TCGCTCACCC TCTTCTTCAG GTTCCCAGGT CCCTACTTGT TAGGGAAATC     50160
     AATTGAATGG AAACCCGCTT TAGGGGAGTC ATCCTTAGCT GATCTTGCTT ACCGTCCCTA     50220
     CTTGTTAGGG AAATCAATTG AATGGAAACC TCTGATGTCC GCTTAGAGAT CAGCCAGAGA     50280
     TAACTGACGT CCCTACTTGT TAGGGAAATC AATTGAATGG AAACACCAGA TAGAAGTTAG     50340
     CTGTATGTCC TACCTGGTAA GGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACCCC     50400
     CTAACCTAAG CTGGCTAAGG GTTCTAAAAT TTTTTGTCCC TACTTGTTAG GGAAATCAAT     50460
     TGAATGGAAA CCCGGGGTTG GTCATACCTG AGTAGTAAGA CTCTTATGTC CCTACTTGTT     50520
     AGGGAAATCA ATTGAATGGA AACCTACTGT GAGTCAAGCA AATTTGCCTC TCCAGATAAC     50580
     GTCCCTACTT GTTAGGGAAA TCAATTGAAT GGAAACCTTG GGTAATGCGC TGGTTTCGTT     50640
     CGGCGTTCTC TTGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACGA GATAGACAAC     50700
     GTTATCAGGT TTGGACATAT TACTGTCCCT ACTTGTTAGG GAAATCAATT GAATGGAAAC     50760
     CATAACCATG CTGCTGGCAT CTCCATTGCA CCAATGTCCC TACTTGTTAG GGAAATCAAT     50820
     TGAATGGAAA CCTAAACATC ATAAAATTGA TGGTGGTTGG GAATATTGGT CCCTACTTGT     50880
     TAGGGAAATC AATTGAATGG AAACAGGTAT CAATTCTCAA GAAAAGGCTA AAGCTTTAGA     50940
     CCTGTCCCTA CTTGTTAGGG AAATCAATTG AATGGAAACG TTGGATGCGG CGGGACAGCG     51000
     GCGGTTCTAC AACCTTTGTC CCTACTTGTT AGGGAAATCA ATTGAATGGA AACACCCGCT     51060
     CACGGAGCTG CTCGGCGCTG AACCCACCCC GGGTCCCTAC TTGTTAGGGA AATCAATTGA     51120
     ATGGAAACAC CGTAGCCTGC GGCTGATCTT CTACGACAGG TTGAGTCCCT ACTTGTTAGG     51180
     GAAATCAATT GAATGGAAAC GTAACTTAGA GTACACAGGC ACCAAGTCCC ATTGGGTCCC     51240
     TACTTGTTAG GGAAATCAAT TGAATGGAAA CAATGTGGAC ACGGATTGTC CCTTCCGTGT     51300
     TAGTGGCATG TCCCTACTTG TTAGGGAAAT CAATTGAATG GAAACATCCT CTGCTTGCCA     51360
     CCCACCAGCT TGCGCTAGAA GAGTCGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA     51420
     CAGCCAGTAG GTTAGAAACT GTGATATTCC CGGATAGCGT CCCTACTTGT TAGGGAAATC     51480
     AATTGAATGG AAACACCAGG TTGCTGCCTT TTCTGCAATT TCACGCTTCA TGTCCCTACT     51540
     TGTTAGGGAA ATCAATTGAA TGGAAACAAG GCGGCCCCAC ACTTACCTAG CCGATGCTGT     51600
     TAATCGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA CTCCCCATCG CTGGGGCTTA     51660
     GTCATATCGA CCCAGCAAAG TCCCTACTTG TTAGGGAAAT CAATTGAATG GAAACTGTTA     51720
     ACGCTTCCCA CTTCTGGGTT GCACTTTTTA AAGTCCCTAC TTGTTAGGGA AATCAATTGA     51780
     ATGGAAACGG GGGATGCGTT CGACTCCCTG GCCTCCCTAG TTACTGTCCC TACTTGTTAG     51840
     GGAAATCAAT TGAATGGAAA CTCATTACCC CGCCCAAGAT GCCCAGCCTC AGCCAGTCCC     51900
     TACTTGTTAG GGAAATCAAT TGAATGGAAA CAAAGGAGTT CGTCTATGAG TGAATACTTA     51960
     CCTTGGAAGA GTCCCTACTT GTTAGGGAAA TCAATTGAAT GGAAACTGGG CGTAGTGCGC     52020
     CTCATCTGCA ATCAAGATAT ATGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACCC     52080
     GCAACTGGGT ATTAATCGGG AATCGTCGCC GGTCTTCAGG TCCCTACTTG TTAGGGAAAT     52140
     CAATTGAATG GAAACTAGAT GTAGTAATCA CTGGCCTGGA AGAGACCAGG GAAGTCCCTA     52200
     CTTGTTAGGG AAATCAATTG AATGGAAACG TCTGGTTACC ATTGACTTCG ACAAGCGCGA     52260
     GGTTAAGTCC CTACTTGTTA GGGAAATCAA TTGAATGGAA ACACAGGCTC AGTGAGTATG     52320
     AATTCAGCGA ATTGACTCAA CGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACTTT     52380
     AGGTCAACTG GGAATATGCG TCCACTCGCC GATGGGTCCC TACTTGTTAG GGAAATCAAT     52440
     TGAATGGAAA CAGATTTACC TGTACCGCCA TCAGCAAAGA AAATGCCGTC CCTACTTGTT     52500
     AGGGAAATCA ATTGAATGGA AACTGCTGTA GCAGAAACAG CAATCCAGTA AGGTAGGGTC     52560
     CCTACTTGTT AGGGAAATCA ATTGAATGGA AACGCAGGCT TGAACATGGC GCGCACAGCG     52620
     AGCTTCATAT CGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACATG ACTAGGTAGA     52680
     TACGGTACAG CTCCTCTCGT AAAGGTCCCT ACTTGTTAGG GAAATCAATT GAATGGAAAC     52740
     AATCTATGAG AGCGGCTACT TGGGGGGTTA CACCAAGTCC CTACTTGTTA GGGAAATCAA     52800
     TTGAATGGAA ACCCAACAGG TTGCTGCAGT ACCCCCTATC CAGGCGGAGG TCCCTACTTG     52860
     TTAGGGAAAT CAATTGAATG GAAACATGTT GAAGTGGTTA GCTAGGAAGG ATAAGTCAGG     52920
     GGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACTGG ATGGTGGTAT AGACAGACGG     52980
     CGCCCAGGTG TGCTCGTCCC TACTTGTTAG GGAAATAATT GAATGGAAAC ATCACACCAT     53040
     CCGGACCGAC GATCGTGATG TTGCGGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA     53100
     CCAGAGGCGG GGCGATCGGA GAGGGAGCAG CGAGGGCCGT CCCTACTTGT TAGGGAAATC     53160
     AATTGAATGG AAACGCCACG AGCACTGAAA TTGTGGCTCA GGCGCTTCAG TCCCTACTTG     53220
     TTAGGGAAAT CAATTGAATG GAAACTTCAA TATGGGTTTC CCAGAGTCCA CCACCTCGGA     53280
     GGTCCCTACT TGTTAGGGAA ATCAATTGAA TGGAAACATA CTCAATTTCG TTGCCGAAGC     53340
     CGACAAAATT GCGGTCCCTA CTTGTTAGGG AAATCAATTG AATGGAAACT CCACCAGAAG     53400
     TGGCCCTTGC TAGCGCTATA AGGCAGGTCC CTACTTGTTA GGGAAATCAA TTGAATGGAA     53460
     ACACCGACTC ATTGCCAACA ACAGCAAACA ATTCTCCAGG TCCCTACTTG TTAGGGAAAT     53520
     CAATTGAATG GAAACGACGG CATCACGGTC CTCCTGCCAG GAGTCCAGGA TAGTCCCTAC     53580
     TTGTTAGGGA AATCAATTGA ATGGAAACCC GACAGCGGGG ATGCAAGTAG CCTCACGGTA     53640
     GTCACGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA CTTCACCTCG TACAGCACGA     53700
     CCTTGCAGAC GTTCTGCAGT CCCTACTTGT TAGGGAAATC AATTGAATGG AAACCGAGGG     53760
     GGCCTTGAGG GGTTACTCTT CCACTTCGAG GTCCCTACTT GTTAGGGAAA TCAATTGAAT     53820
     GGAAACTACA TAAAAGGAGA AATCTCATGG GTCTGTTTAA TGTCCCTACT TGTTAGGGAA     53880
     ATCAATTGAA TGGAAACGCC TTGTCCCACT TCTGGCGTTC CGACTCATTC TCACCGGTCC     53940
     CTACTTGTTA GGGAAATCAA TTGAATGGAA ACCAGGGGAG GGCTAGCCAA TTTTGTATCA     54000
     GTTATTCTCG TCCCTACTTG TTAGGGAAAT CAATTGAATG AAAACACAAG ACGAAAGGTG     54060
     ACACGCTGCT TCCCCTTCGG GTCCCTACTT GTTAGGGAAA TCAATTGAAT GGAAACCATA     54120
     CTTGCCGTTA ATGGTTTCCC AGAATTCCTT AGGTCCCTAC TTGTTAGGGA AATCAATTGA     54180
     ATGGAAACCG CCAGTAATCG ACGAGAGTAT TCGCGACCTT GATAAGTCCC TACTTGTTAG     54240
     GGAAATCAAT TGAATGGAAA CTTCACCTTG AATAGCTCCC ACTAGTGGGA GGGCGAGGAC     54300
     GTCCCTACTT GTTAGGGAAA TCAATTGAAT GGAAACGTTA CAATGAGGGG CGCAACATCG     54360
     GTAACGCAAA AGTGCGTCCC TACTTGTTAG GGAAATCAAT TGAATGGAAA CTCATCTCTA     54420
     TCGTAATTCC TTTACGTATG CAGTACTCAA GTCCCTACTT GTTAGGGAAA TCAATTGAAT     54480
     GGAAACAATG GACTCAGCTT AGAGCGCTTG CTAGCGCTAT CTGAGTCCCT ACTTGTTAGG     54540
     GAAATCAATT GAATGGAAAC GATCATATTT CTGTTCGCAG TACCGAACCC AGAAGGAGTC     54600
     CCTACTTGTT AGGGAAATCA ATTGAATGGA AACCATCAAA ATATTAATTA ACTGAAGAAC     54660
     GCCAAAGAGG CAGGGATACT CTTGACCGTA GAGACTAATA AGGAACGGTC CAGATACTTA     54720
     TTCCCCCGCT CACAGGAAGT TTCCGGACTG AATAAACAGG CATGACAGGC CGCCCAATGC     54780
     AGTTCAGTTG TATTTTGAAA TGGACTGTGT TCCGCACAGA GGGGGTCAGA AGCGCACAGC     54840
     CGCATTTGCT CTAAAGCCTG ATCAATGTGT TGTCCGAGTA ATTTGGGTTC TCCCAGGCTT     54900
     ACTAACCCCC CTAAAGTTCC CTCGCTATCG GCTGCAGCGG TATAGATCAG CACTCCAGCC     54960
     ATCGGCCCAT TATCCTCATT CGGATATTTC GAATAGATCC GTTCCCTTAA ACTGGCGGCA     55020
     GTATACCCGC AGGCGATCGC CAGTTGTCGC ATTAAAGCAT GGGCAAAGGA ATGCAGGAGC     55080
     ATATAACGAA TACCTGGAAA ATTCGCCTCT GGATTGCGGA TCGATCGAGC AATTCGCCAG     55140
     CGACAATGGG CATCAAAGGT TTGCTGTTCA TAGGTTTTGA GCGATGGGTT ACTTGCCAAC     55200
     CAGCTCGTGA TCGCCTCCTC CTTAAATTGC AGAAATACAC CCTCCCCCCG GACTTCAGAG     55260
     GCAGGAACCC ATGGGGTCAG CTTGCGACTC AGCGGCGCTC TGACTTCTTC TTCCAACTCA     55320
     CCTGTATCGG TAAAATCACC GGGAGACTCA ATCCGGGTAA AGCCTATCAG TGCTCGTACT     55380
     TCCCGTAGCC GTTCCAACAG CACTACTTTC TCGAAATAAT CCTCATACCC CTGGGGAGGC     55440
     TCGACGGGCG TTAACCAGAA GTCAGCACTA TTCAGCTCTG TATCTGCAGC AGTAAATACT     55500
     TGCCATTCAG GGGTCTTAAT ATCCTTGATG TCGGGCGGTT CCGTACCTCC CGTGTTTGTG     55560
     CGTTTGTGGC ACACTTCCTG CCAGATGTCG GCATCGCTAT AGGCCCCAAA TTCCTTTAGT     55620
     TGACCGATCT CACGAAAGGC ATTCAGAATT TGGATACTGC TAGCTTTTTC CAGAGTGACC     55680
     CAGTGTTTTT CTACTAACCG GTACAGCTTA TTCGTTCCTG TTGGAATCGA GAGGGCAGAG     55740
     AGGGTAACCG GAAACCAGCA GTTAGAGGCA CCCAGAGAAA TACTGACCAT TTGTTTATCA     55800
     CAGCCGCCCT CAGCAAAGGT TCGCAGATGG GCATGGCGGC CACGGCACTG GGGCATATTT     55860
     CGTTTTCCCG GTTCACCAAA GGCATCAGAC ATCCGCCGAG TTACACCACA ACTTTCACAC     55920
     CGCACCTCGA TATCTGCCGC CGATCCAGAA ACCCCGTACT CAAATAGCCT GAGGGTGCAT     55980
     TTGTGAAGCG GTACACTGCA CTCCCTCCCC TGATGGACAA AATAACGCCA GGGAAAGTCA     56040
     TCCAGATGAC CGTGGCAGCA GGCGACCAGG AAGCGGGCGG GGATTACAGT AGGCGGATAC     56100
     TTTCCCTTAG AGCAGTTGGT GTGGACATAG CGGTTATTTT CAGTCCGAAA GCGATCGGTC     56160
     TTTAAATCAA ATAAGCCAGA TTGTAGGGGA GCCAGTAAGC GGCAGCCAGG GCAGAGCATC     56220
     CAGGTGGGAA AGGGAGAGGC AGGAACCCCA ATGCGATGGC TATCCTCCTG TAACCCACCC     56280
     ACACTATTCG ACTCAGTCGG CATGGGAGCG GAACGTAAAG ACTTGACCTG TTGTCCCAGC     56340
     GAGTGCCGTA CCGCAGCGAG TAACCGCTCT TCTCCTAACT CGTTGGCATA ATTCGTATCC     56400
     CAGTCATCCA GTCCCATCAC CATAGTGGAC AGGTTGGGCA GATCCACGAC GGAACCGATT     56460
     CCGGCAGAAA ACAGAATCTG GCTGGGGCGC AGTTCACCAA CTTTACAGCG GTTGTTAACA     56520
     GCCATCTTAA ACCTCACAAC GTTCAGGGTG ATTTGGGCAT GGGTTGAGGT GGACGAAAGT     56580
     CATCATCAGG AATGCGATCG TCCAGCACGA GACTGATCGT GGGTTCAACA TTGCGTAACG     56640
     AGTTCAAACA GGTGAAGGGG AGCCAGTCCT GATTGCCGGG ATACTCCAGC AGTGCCAGTG     56700
     TTTTTCCATC CTTCTCCGTT TTGTACCCCA GTGACGCACC CCCCTGAAGG TTATTGACCT     56760
     GATCCAGCCA GTACTCCAGT TTCGTCAACA GCTCTTGCTG CACCTCCTCA GCCGTGGTCT     56820
     GATCAGCAAC CTGAGCGGCT CGGGCCACGA TCGTGGCGAT CGCTTCCTGG ACATAGGGAT     56880
     GGTCTGGATC GATCCGACTC GCTTTCTCAT TTTTGTTCAG TTCAATCCCT TTCAGCCGAA     56940
     TGAGGGACAC CAGCAGGGCA GCCAATCCCC GATCGAGGGC CCGAGGCGCG AAGGGTGTAA     57000
     CGGATAGAGC CTCCACATGC TGATAAAAGG TGGCGTGGTA ATGCTCAAAC TGTTCGTAAT     57060
     GGGACAGATC GCGGGGTCGT GCCCAGTTGT AAACCGTAAT GACTAAACCG GGAAAACTCC     57120
     GCCCTACCCG AGACGTAGCC TGAATATATT CCGCGGTTGT TTTGGGCTGG CCCGTCACCA     57180
     CCATGGCTCC CAAGCGTCTG ACATCCACAC CCACAGAAAT CATGTTGGTT GCCAGCAGCA     57240
     CATCCAGGGG TTTGCGTTTA CCCGTTTGTT TTTCCAGTCC CGGCACGAAG GGGGTTTCCA     57300
     TCCAGTCCAG CACAATCGGA ATATCTGTAG AGGTTTTACG GGACGTTAGC TCTTCCACCT     57360
     CCAGCCGCGA TCGCTTGGCC AATCCCCGTT GGTCCATCTT TGCCAGTCGC GATTGAATAT     57420
     CATCGTCCAC CAGGCGGCGG GTTCCCCCCA GTTCCCGCAG GGAGTTGAAG TAGCCCACCA     57480
     GGGTCATCCA GGGATCCACG ACCTCCCCAT AGTCTTTGTA AAGGGCTTGG GAAGAAGCCA     57540
     ACACCGCCGT ATAGACCCGA ATCAAAGCCG CTTTCAACCG TCGGCCCGTC GCACAAATCC     57600
     CCAAGTAGCG TCTACCGGGA GCTTCCTGGC TGGGGGGGCG CTGGCGGGAG AAAAAGTTAT     57660
     CGCTGACCTC CAGTCCCTGG GGAGGAAAGA CCTCAACCTG GCGCAGAAAG AGGCGATGCA     57720
     CTTGATCGCG AGCCTGTCGA ATGGTTGCTG TGGAAGCAAT CACCTTCGGG CGAACTCTCT     57780
     GCCCATCTAC GGTCCAGCTA CAGAGATCAT CCACTGCCGT TTCATACAAA CCCACCAGGG     57840
     TACCCAGGGG GCCACTGATC AGGTGTAACT CGTCCTGAAT GATTAGATCG GGGGGACGCA     57900
     AGGGATTGTG GGGAAGGGTG CGGGCTGTAG GTAAGCCATA CTTGGCGGGA TGAGTGCTGG     57960
     GGCATTCCTT ATCAAATTCT GGAGAGACAA ATCCGTGGCG CGGGCAATAG CTTTCCACCT     58020
     GCCCAAACAA CATCTGGACT GCTCCATTCC AGGGCATCTG AGCAAATTTG TCGACCGTAG     58080
     CTATCAGCAG TGTTGGCAGA CGGCGATAAA TCTCCTCATC CACTACCATC ACTGGTAACC     58140
     CTTCCGTTGG CGATTGCTTC TGACTGAACA GACACCGGCC TAGGGCATCA CCGCAGTAGA     58200
     TTAAAGTGCG TCCCTGTCCC TTCGCAAACG GTTCCACCTT AATGTGCTGT TTGCCTGGCT     58260
     CAATTTTGCT CCCACACCAG GGGCAATTCG TCAGTTGATG GGGAGAACCA CTGCTACTGG     58320
     ATTGAGACTG TCCTAACTTT TGTTTAAGAA ATTCTTCGCT CTGTTCCGTG CGATTCGGCG     58380
     TTGTTTTCTG TCCCACCCAT AACCCAATCC GAAACGGCTC CTTGCCCCAC TGCTCTGGCT     58440
     GCTCACGGCG GATTGCTTCA CAGGCACAAA TTAAGGCCGT GGCCCGCTGG AACTGCTGCA     58500
     GAGTCAGTAA CCGCAAGGTA TAGCGCATCA ACACGGCTAC CCCATACTCT CCCGATCGCC     58560
     CCGCAACTGT TCCCTGTAAC CGACGTAATC CAATCGTGTA GGCTGTTAAC CCCAAATAGG     58620
     CTTCCGTCTT ACCGCCCCCT GTCGGAAACC AGAGCAGGTC CGCGATCGCT TCTGTAGCAT     58680
     GGCTCCGGGC TGGATGATGC AGGTCGGTAA TACTGGGCAA GTTCAGAAGA ATAAATGCTA     58740
     ACTGAAAGGG CCGCCAGGAA TGGTTTTTGG GCGTATCCAG AATTTCGAGG GTGGTTTCTT     58800
     CGCCCCGCCG TTGGTGTTCG GCATAAAGCG TATGGAGGCG TTGCAGGGCC ATAGCCCGAT     58860
     TCATAAACTG AAAGGCCGCG GCTGCCTGTG GATTTGCCTG CAGCAGTTCT AAACCGTCCC     58920
     GAATCCGTGA GAGGGTGCGG CTGCAATGGT CGATCGCCGT CTGAGCGGGT TCCTGATAGT     58980
     CAGCCAAACC GGAGGCAGGA TTGGTTATCT GGATCGCCTG AGCATCAATC CACTGTTCGT     59040
     AGGCATCCGC CAGGGGAGAA AGTTTACTCA CCAGTTGATC GATCGGTAGC TCTGCCAGCA     59100
     CTTGCATATC CAGCACCAGT CCCCCCAGTC CAGGAATTTC CTCTGCGCTT GGAGCATCTG     59160
     TCTTGGGCAC TTCGTAGGCC GGCACTACCG CTGTCTGGAG TCGAACGGCC CGGTGGCAAT     59220
     CCGTTGCTGA TAGTTCGGCA TGCACCCCCA CCCCATGGCC CACAGCAAAC TCGACATGGT     59280
     TGCGGTAGAG CATTTCCATG GCCTGGGCTT CAGCATATTG AACTGGGTCC AGTTTGCCCT     59340
     GCGATCGCGG TTGGGCTTTG CGAATAAAGA TATCCGGTTG GTCAGGGTCG GCGGACTCCA     59400
     CACTCAGTTC GGGTTGAAAC AGCCAGGCCT GGTCGGGGAG TTTTTCGGGT TCCTGCTGTC     59460
     CATTGACGAG GAAGAGGGAA ATAATCCAAT CGTCCCCCGC GGCTCGGATC TGACCCTGCA     59520
     CATACACCTC CCGATCGGGG TTGACCTGCC ACCGTTCGAT CGACCCCGCT TGAAGGGGAA     59580
     TAGGTGGAGA TTGATGGCAG ATGGGGTATC GTTTCCACAC CTTTTTCGGT GATCCTGTCG     59640
     GGGTTGTCTG GTATTCGCTA AATCCCTTTT CGTACTGGCC CCAACCGGCT GTGACTTTTA     59700
     TGGCTGTGAC CGTCCCCCTG ACACAGAAAC TCAAACCGAT CGACGAAGGA AACATCGTCT     59760
     CACTGGCCGG ATTGGTCGTT TCGGTGGAGC CATCTTCACT GGAGCCTGTT CCACCCACCG     59820
     CTAGATCATC CTGTTGTCCA GGGACTTCAT CGACGGTGCC CGTTTTTGCA CTGATCAGCT     59880
     CTTCACTTTT TTCCAACAAG TCATCCCCCT CCAGAAGCCG TTTGCGCCGG TGCAGGGGAG     59940
     CTAAGAGTCC CACCAGATAA CGATCGCTCA CCCTGGCTTC ATCTAATTCT TCGTACTCTC     60000
     CCCCCGCAGG GCCAAGCAGA TCGTTCAGGA TGGCCTGTTC GAGTTTGGCG CGAATTTGGT     60060
     AGGGGGTTGC CCGCTCTAAT ACCCTTAGTG GTTCAGGTGG GGGCGTGTCG GCTTTACCAG     60120
     AGGTTGCGAT GGTTTCAGAT GGAGTGACTG CATACTGTCC CTTTTTTTCA GAGACTTTAC     60180
     CCGTAACAGC AGGCTCCTCT GGCTCTGGTT TCCATACTGC TGGTTGCTGC TGGGGTGATT     60240
     CTTGCGGTTG CTTAGCCTTC TTTCTCTTAG ATTTAGTTTG CAAAATTCGC ACCACTTCTG     60300
     CCCCGATCGT ATCCGAAAGG GTACTGGCAT CGGGATTATC CAGAACATCC GTAGAGCCCA     60360
     GATCTAAACC CTCTAACAAA ACCTTCAAGG CTGATTCAGG AGCGGAGATG ACCGCACTCC     60420
     AGTCCAGCTG CACTGATCGC TCCCGTAGTT GTTGGTTCAG GGCAGCCAGA TCCAGTTCAC     60480
     CCGGCAGGAT AGGGGGGAGT TGAATAATTT TCATGCAGTC GTTCCCAGGT TCCAGAGGTG     60540
     GGGTGCAAAG TTTTGCAGGA CAGGAGACGT ATTTTTATCA GGGACCAGCA GCAGCAGAGC     60600
     CCGCATCGCC CGCGTCATGC CTACGAATAG GGTACGCCGA GCCCGGTAGA ATATTTCATC     60660
     CAGTTCTGTT TCCGGGGTAC CTTTAGCGAT CGTGGGGAAG GTAGATTCGA GGAAGCCAGC     60720
     GATCGCGACG ATCGGGAATT CCAGTCCTTT TGCGGATTGC AGGGTCAGGA TTTTTACACC     60780
     CGCACAATTC AGATCCAGGT CTTTACTGGT CATGTAGGTT GAGGGCAAAT CCCGGTAGTT     60840
     GAGTTGTTCT GCCAGTTTTC TGCCGGCTCG TTCGGAAGGC ACCAGAATTG CACAGGCATT     60900
     AATCCCTAAG CGAAACTCTC GACTGGCCAC TTTGCAAAAC CGCACCAGTA GATCGGCTTC     60960
     ATCTCCACGG TTAGAGATTG CTCGCACCGC TGGCTGAGGA CCGTTATGAA TATATTGATG     61020
     CTGAGGGATT TCCTGGTCCA GGCTGCCATC TGCGAGGTAA TGTAAAGCCG CTTCGTTGAC     61080
     CTCTCTGGTC GTGCGGTGGT TGGTTCGCAA TACTCCAGTT CGTCCGTTAA AGCGCAGGTC     61140
     GGCGTGGATA TCAGTCCAGC GAAAGCCACT ACTGTAAATG GACTGGTTGG CATCAGCGGT     61200
     GACAAACAGG CGATTGGGAG CCCGGCAAAG CAGAGTGAGA AAGCGCAGGG CATTGGGATC     61260
     GAGATCCTGA GCCTCGTCAA TGACGACCGC ATCAAAGAGG ATAGGAGTTT CCAGGTTCTG     61320
     GAGCAGTTTA ACGGCTCGGC TTCTGAGCTG CTCCCAGGTT TCCAGTCCTG CCTGTTCAAG     61380
     CAGTTGGTAG AAAGAGCAAC GAAGTGTCCA GATGGCCTGA CGCTGAACCT TATTGAGGGC     61440
     AACCGTACGA CCGGCCCGTG GGGTTGCCTG ATAATCCTCT AAGCTCTCTA AACCCCGTCC     61500
     TTCAATCACC CTACCCATTT CTTCCAGCAG GTAATCGGGG GTGAGGTTTT CCAGGATTTG     61560
     CTTCTGTGCA TGTTGTTGGA GCAGGTTCCC TTCCAGATTA AGAACGGCTA GTTCTCGGGC     61620
     CTGCTGGATC AAGATTTTGA GTTGATTGGC ATCCGCCAGC TTGGGTTCAC CGGCTTCCCG     61680
     GCACACCAGG GCATAGATGA TGCTATCCAC CGTATCCACG TTGACATGCT GGATATCATC     61740
     TCCAAGCAAA CTGGTTAGTA ACTGCCGCGA AAAAGCGATC AGGGCATTGG TGTAGGTTGT     61800
     GAACAGCACC TTAGGTTCAG CAATCCCATT GGCTTTCAAG GTCTGGATGA GCGTCCTGAC     61860
     CCGATAGAGA GCAACAGTAC TTTTTCCCGT TCCTGGCCCA CCTTTCACCA GGGTTGGCCC     61920
     CGTGGCATTC ATCCCCCAGG TGACAAACCG CTCCTGTTCA GGATTGAGTT TGAGCAGGAA     61980
     ACCGAGCAGA TCTCCTTCTT TAAACTTAAG CAAGTTATCG AGATTTCCAG TCAGAAAATC     62040
     GGGTTGTTGG AGAACTTCAA CTAAGGGGCG CTCGAACAAA TATTCATCCA GCTTAAGAAT     62100
     AACTTGATCG GGAATACCAG GGCAGTCAAA CAATTTTTCT CGACTCTCAA CCCGCAGCAG     62160
     CCGGGCATGG CAAACTTCTG GAATCCGAAG ATTGGTGAGC AGTTCGATCG TAATAGGTTC     62220
     GGGTAAAGGG GTTTCCTGGG CCTGAGGTTG TCCAAACAGC TTGTCCCAAT TTGGCTGATG     62280
     GGTTTGCGTC TCTAGAGTAG GGTCAAGACC CCCTAAAAAT TCTGCATCCA GGTCTTCGTC     62340
     ATAGGTGTCA TCATCACGGC GACGCAGGGC AAGCAGGCTG ACATAAGTGT TGTCGAAGGT     62400
     ATAGAAAATC CGGTAGTTTC CCGATCTCAG TCGGTGGAGC TTTCCGCCCA TGTACTTCAG     62460
     TTGTTTTTTG ACTTTGGCAT CGGGAGTTGG ATCGTAAGTC AGCAGATTAA TTTTCTCCAG     62520
     AATTTGATGG CTTTCTTTAG GTGGAAGGGC CAGCCATTCA GTCTGAAAGG TGGGTTTCAT     62580
     GGTTGTAAGC CAGGGCATCT TAGCTAAACT CCTTCACCTG CTTGTTGCTT CAAAAGGTTA     62640
     AATAGCACTA TTAGAGGATA AACATTGATA ACTAGATCAA TCGGCATCTG CTAACTCCTG     62700
     AGTTAAATCT TCAGGGGTAT ATTGCAGTGC GGAAACCTTA TAGCGGGAGA GAGCACTGAT     62760
     AAAGTCTGAG CGGGATAGAC CAGCAACTTC AGCTGCCTTA CTCTGAGAGA CTTCTCCCAA     62820
     CTCATACCAC TTGGCTGCTG CCGCTACTCG CATCTCTTGA ACAAACTCTG CGGGAGCTTT     62880
     GCGGAGAGCC GAGAAAACGG TTTCGGGAAG TTGGATCTGG ATAGTTTGCA TAGGATTTGG     62940
     GGCTAGGAAA AGAAATTTGA TCGGTTAATT TGTTTGATGT AGTTAATAAC AGGAATATAA     63000
     ATCTAAACAA GGCTTTCATT TCTGTCAGGA CAGAGAAGTG CTAATGCCTT GATATTTGGA     63060
     ACCCGAAATG GCAAATCCAT ATCAGTAGAA TTATCAACAA CAAATTGTTC GGCTTTAAGC     63120
     AACCAGTTTG TTAATTTTGC TGACGGTATT TCTATGTTGC CGCCCGACTC AATTCGTCTC     63180
     AATATTGGTT TTGTCAACCT ATTGAGGAGG TCTAAGACTT CATAATCATG GCGCAAGATG     63240
     GGCATATGTT TAAATTCAAC ACCAACAATA ATCGATCGAA TTGAACCACT ATTTTCAGTT     63300
     ACACGATCGG TAATGCTTAG TAAAACAAGT GGATAAGGTA GAAGTTCGGA TGGCAGTAAA     63360
     GCAGCTGTCT CTTCCAATGA TCGTGCTTGC TCGAGCGCTC GATCTAACAA TGGATGTCCA     63420
     ATTCCAAGAA TACGCTGTTC GGCATCAGCA CCTCTGAAAT TGCGATCGAA TACTAAGCCA     63480
     CTATAATTGG GCTTGATTCC AATTCCAGAC CAGCCTTCAG GTGTACGAAA ACTCAAACCG     63540
     TCTTCTGTAA ATCTGGCTTG GCGGTGATTA TGCATCAACA TTCCTGTGAA AAAAGGGCGT     63600
     AATGCTGGTA GATCTACTTC TAACAGTTGT CCAGCTAATT CTCTGTAATC AAAGCTTGCA     63660
     CAATGACCAA CTAGATCACG GACAGTTTGC AAAGCATCTT GGCCTCCAAA GCGAGCAGTT     63720
     TTGCCGTCGA ACCAAGAGTT TAAAGTTTCT CTGGGTACGG TTGGAGCTTC GGAAAATAAT     63780
     TCTGTCCAAA CTGAAGGAGA TGTCATGCCC AATACAATGG GAAAAAGATC CTCACTTTCC     63840
     TCCATAACAC CACTAAGCGC AAGCTGGATG CGCTGCATCT TTTCCTCAAG CCGCTCCCAA     63900
     ATAGTTGCCT CAATGGTATC AGGGTTACGA AGCGTTACTA CCTCAACTTT ATGAGTTTGA     63960
     CCATAGCGGT ACAATCGCCC AACCCGCTGA TGAAGTCGCA TTGGATTCCA CGGAATATCA     64020
     ACATGAATTA ACGTATGACA GTTCTGTTGT AGGTCAACTC CTTCACCAGC TGCTTCTGTA     64080
     GATACCAGGA ACCGAGCTTC ACCTTCATTG AATAACTGAA TAGCCCTTTC CCTTGGACAT     64140
     CGTATAGTTC TACCATTAAC ATTATGAACT TCCTGATCCC CGTTAATAAA GGTTACAGCA     64200
     GTTTCACCAT AATGTTGGAT TAGAGCGTTT ATTAGTAAGG ATTGGGTTGC CTTATACTCT     64260
     GTAAAAAAAA GTACTGATCG TTCAGCAAAA TCTCCCTTGA GTAAATCAAG AATACGTCGA     64320
     ATACGAGTTT CAGAGGTAAT AGCATTGGAG AGATTAACCA GTTTCGCAAG GTACTCTTCC     64380
     TCATTCTCCA TAAGAGATAG GGCCACAGAA AGTTCAATAA TACGTTCGTC CAAAGCACTA     64440
     ACTTCATCTT CAGAGCCATC ATTTGTATCT ATTTGATTTA AAATTGTCTT CAACTGTTGC     64500
     CGTAAAGCTT TGAGTTGAAC TAGCTCTTTC TGTTTAGATT TAAGGCTTTT AAGACGCTTT     64560
     TGCAACGCTG AACGTACTGC TGCAACTGAA CTTGACGCTA GTTTTTGTAA AGCAGTAAGA     64620
     ACTAAATTTA CAGCACGTCC TTCAATTCCA TCAAGCGAGG AAGCGTAAGC GTAACCTTCT     64680
     AAAATAAATT GGGTCAAAGT ATCATAAAAA CAAGCTTCTT CAGTTGAGTA ATAGTATGTT     64740
     ACAGCTTGAG TCTCTATACC GTTAAATAGC AGGCGGCCAT TCAAGTCGGT AACATTCTGC     64800
     TTGTTGTTTC GAATCATTAC GTCTCGTAGG GACGATAAAT ATTTTTCCAA TGGCTGTTTT     64860
     GGATCTTCAT AGACATCAGG ACGTAGCAGC TTTAGTAGTG ACAGAAAACT ATAATCTTTA     64920
     CCCCGGTGCG GTGTACCTGT AAAAAATACT ATTGACTTAA GCTTTTGAAA TTCGTGCAAC     64980
     TTCTGCACTA GCTTAAAGCT GAGAGTAATG CCATTGACCT CATCAGCATT GAGATGATGG     65040
     GCTTCATCAA TAATAATTAA ATCCCACGGG GGTGAGGCAA GGAGACGATC GTGTCGCCCG     65100
     CGCCGATCAT CACGCAGAGT CTGTAATGAA GCTACTACCT GATTATGAGT TTCCCAAAAA     65160
     CCATTGCGAG GTGTATCTGC CTCAGTTGTG TAGGGGGTGA AGCGTAAATC AAACATCTCG     65220
     CGCAAGCGTA ACACCCACTG TTCAACCAAT GAAGCTGGAG CAAGTATTAG AACACGATGG     65280
     ACGATCCTTC GCGAAATAAG AGGCCAAAGA ATCAAACCAG CTTCAATCGT CTTTCCCAAA     65340
     CCGACATCAT CTGCAATTAA CCAGCGAAAA GGCCAACGCT CCAAAACTTT GCGGCATACC     65400
     CAAAGCTGGT GGGGAAGCAA CTTTACACGT GAGCGGGAGA AAACACTCCA GCGATCGTTG     65460
     AGAGAGTCGA TTGTTGCAGC CAAGCTACGC AAGATTACAG GGAGAGGAGC CTGCCAGTTT     65520
     CCTTCTTCAA GAACTTGGGC GAGAGTTGTT AAACTGCTAA TTGAGATGAT TTCGCATTCC     65580
     TCAATACCAT GCTCAAATCG GACTATAACA GTTGCACCCC GATCAAGGAT TACTTCACCG     65640
     GAGCCAAGTG TCATGTGGTT TACAAAATCA CCTGTTTGAA ATGTCATATC TAGATTTGTT     65700
     CATCGAAGAG GAAACCGCAC TCCATCCCAA CGTGTACGCC ATTCACCTGA GTTACCATGT     65760
     TGTGGAAAAT TCACCCACCT GTATACATCT TCCTCAGACT CCAGAGGTTC GTGCGGAACA     65820
     GGGAACCTGC CTAGTAGCCT TTCTTGAATG TCTCTTGGTT CCTCCTGAAG CATTAGAAAG     65880
     GGTAAATCGT AATCACCTAA GTAGGTGGCA TCCTCTTCAC CCAGGTGTTT AACTAAAAAT     65940
     TCATAGATAC TCATCGAGTT ATCTACAGCT GTTGTTCTGC TGTCACCCCT GACCGCGCTA     66000
     CAGCCAATTG CAAACAGCAT GGCCCGTACC CGTCGAACTG GTACATAAGC ATAGGGGCGC     66060
     ATTCCAGGAT TCGATAATAT TCCACCACGT ACTAACTCGC GAACTATAAA CGTAGAACCA     66120
     ATTCCTAAAA TACTACCTAT TGGAGGTGCT CCTTGCCCTA TACCCGTGCC TTGAAGTGCT     66180
     GGATTTTGCT TAGGATTTAG AACAAGATCA ATTGGATTCC GAAGTTGAGT TGGACTGATG     66240
     CTTAGATATG CATTCGAATC ATTAGTTGCT AACAGGCTGT CACGATAAGC ATCCAGCCAT     66300
     TTAGAGAAAG CATAAAAAGC AGGATAATAG CGTACCCATT GATAGTACTG AAGGCGATCA     66360
     CCTACACGTG GTAATGTGAA ATACCTATCA AGTAGATTGA TCCATCCAGC CTCATCTACT     66420
     TCACCAGTAA CCATAACGTC GAGCCATCCC CAATCCTCAC AAAGCTGTAA AAAAGTACGA     66480
     TGCTGCTCAA GGTTAGTGCG CCCCATTGTA TGGAAAACTC CCAGAGTAAA TAAAGTTAAC     66540
     CAACGTTTTT TGGAGCAATG AGGGTTATGG TGATCGTTGT AATTGTTCTG GTTCAATTGA     66600
     AGGTCGATGC ATGGATAAAT ACTCTTTTCG TACTTTGCAA TTAGACGACT GCGTGCTTCT     66660
     GACCACCATT CCAGAATATT TATTAAAACA TCTTTTATGC TCAGAGCAGG AGATGCTGCT     66720
     GTTCTTGTAG CTTCATCAGA GTTGTTATCT TCGTCGATGT CTGTGTCTTT AGAATTTATG     66780
     TCACTGTTAA TAGATTGAAC TAGCAATCCT AAATTATATA GAAGTGCGTC GAATGAAAAA     66840
     GGATCAATTC TATATTCCTG CTGCAAGATT TGCCGTTTTG ATGGAAGTTC CGTTAACCAG     66900
     CTACTTCTAA GTTTGCCTTT AAGCCACTGA ATCAATTTGT CACGGTGCTC GCTCTTAACA     66960
     AGATACTGAA CGCAGAATTC ATGTTGTTCA GGAGAAGCTT CTAATACCCA TTGTCCTCGT     67020
     ACTTCGACAG GAAGAGAGAC TAGGGAAAGA TCTCCAGATC GACATGCATA GAATAAACCT     67080
     AAAGATCCAT ATTCATACTC CTCAGCTAGT AAGGCAGAAG CCGGAGCAAA TAGAGCAAGC     67140
     CGGGATTCTT CCGATCCTTT AGGAGAAGAC TCGACAACCA AGAGATTTTG TGCGATTGCA     67200
     GAATTATTAC CTCGGCTTTG GAACTGTACA GTTTTTAGAA ACTCTTGAAT AGAATGTGCC     67260
     TCCATAGAGG GTAAGTTAGC TAAAAAGGCC TGATTGATTA ATTGCTCGAC TATAAGTGAA     67320
     ACTTCTGGAG ACACTATACG TGCAAGCTGC CATTTTATAA CTGTAAGTAA ATCCAAACAT     67380
     TTTACCGAGA GCTTTGTTAA CTTCTTCAGC ACTTCAGCAA CCGAATAGGA TACAACCTGC     67440
     CCTGGGCGAA TTTGATGTTG TCCTTCTACT AGGACTGGCC AGTCTAAAAC TTGCGTCAAC     67500
     ACAGCTTCAT CAGCGTTCAG GATGCCACTC ACAGCCCATT GAATATTTCC TAATCGAGTT     67560
     AAACAGTTAA ATTGACCAGC ACTTTTTGGT AATTGCGTTG GTAAGGCTTC GCAGCTAGTG     67620
     TAAAGGAGCG GCATTCCTTC TTTTTCTACC CAAAACATAT GCTTGAGTAG GTCAATGCCT     67680
     TTATCACTAA AGTTTTGGTT GGCAAACTGG TCAGAAAGGA TATTCCAGAT ACTCGTCCAA     67740
     AATGTAAGTC GTGTTGTACC TGTAGTAAGG TTAAGTGCTT GGCAAAGTTG TACCTCGTTA     67800
     AGCTGATAGA GATTAATAAG TGCCTGGCTA AACATACGCC CCATTTCCTT CGCAAGCTCC     67860
     TCGTTAAATT GCTTGCCTCC ACCACACAAA TCCAATTGCG ATCGCCCAAT ATCCAAACGG     67920
     AAGGGCCCGT TAATAGCAAA GCCAACTTTT AAGAGCATCC GAGTAGGAGT TGTGACCCAG     67980
     AAAGTCGGAT AGTTTGAGGA TAGGGGTATA GCTCCAGATG AATTAAGAGG AATAAGACAA     68040
     CGTCTTCCAG GTTCTCCAAG GAGTAGTGCA TTTAGGGACT CATTGTTCTT AATCTCTTTA     68100
     CTTCTACCTG TGTAGACACT ACAGATACCG TCAATAGCTT TTTCGCTTCC AGTCCAGGTG     68160
     AATCTATTAT CTCTTATTCG CACCTTAAAC TCTCGTAGCC AGCGAGAGAA AGCTCCAAGC     68220
     AAAGGTAGAT ATTCAACGAA TTTTTCGACA ACAGGACGTG CATCTGACTC GTTAACATTC     68280
     AGTTTGACAA TTGTACCTTC TTTGCTATCG CCTAGCTGCC CTGTTGTTGT TTTAAAGTCT     68340
     TCATCTGAGA GTTCTTTTGG GTAAACACCG CCAATAACAT CAAACCCAAT CCGATCACTA     68400
     ACAACTCGTG GTTTGCTAGT TAGTAGAAAT ATACTTTTAA AACCCAATCC AAATTTTCCT     68460
     GTCACTCCTT CAGATTTATC TGAAAAATTG AGCAAGAGCA TTTTCTGAAG ATCATTGCTA     68520
     TACCCACGAT TACTCCAATC TTGTCCATTA TATTGGTACT GATTGATCCC TCTTCCCCAG     68580
     TGTATAAAGC ATAGGGATTT GTTTGCCAAA CTGATTGTGA ATTGGCGTGA TACATTAGGG     68640
     TGCCCCATTT CTCTCAATTC CCAACATGCA TCATCAGCAT TCTGAAAAAG CTCAAATGGA     68700
     ACTGAATATA TGTCATAGTT GGCATTTTTG ATACGCTGTC TTACGCCTAA TAAAAATGCT     68760
     CTCTGTGTTT CCTCATCATT TATTAGATAG TTGCGAATCT CCTTTTTGTT TTCTCGTAAA     68820
     TCTCTTTGAT TCTCTTGAAG TTTAGAGTCG TACCGTCTTC GTTCTGGAGA TTTTTCCTGT     68880
     AAACTAACTA AACTTTCATG CTGTTTTCTT AGATCGAAAT GCTTATGAAT CAGAGATTTT     68940
     ATCTTGCTAT CGTGGTCTAG ACTAAGTTGG CTCCTAAGGC TAAGGATTGC ATCATCCAGA     69000
     AGAAGATTTT GGGTTACGCG AATATCAGGT GGAGCTTGAT CCTGTAATTT ATCCCAAAAG     69060
     TTTTCAAGAT CTGTAACATG GTATCCATAA AATTTACTTA AAATGGTATG AAAGCTCTGT     69120
     TTCGCTAATC TAGACAAAAT GATTTCATCT AGGAATTGAC AGAGGCGTAA TGAAAGCTGA     69180
     ATATATGAAT ATCCATCTGA TTGGCGTTTT TTTTGTAAAT CGCCAACAAT TAAGCTTTCT     69240
     GCTTCGCCTT CATCAAGCAA CTGAACTTGT AATTTTTCCC CAGTTAGGCT TTTAACACGT     69300
     ATTACACTAC TCTGATGTTT GCAAACAAAA CATTTTGTCT TTTCGATATC TTCTACTAAG     69360
     AAATTAATCG TATTCCTTTT ATCATTATCA TTTTCCTCAT AAATTTCCTC TAAGAAATAA     69420
     TCAACTCTTG GAAAATAAAC TCTGGCAAGT TCTTCAATTT CTCCCTTCCC ACCTAAAAGT     69480
     CTAAGTAGAA GACCGATCGC ATTATTTGTC CGGCGTGGCC AATCCTTGAA GTATAGACGT     69540
     AGAGTTTCAT TGCTATTTCT CAGTGCCTCA TCTGAAAAAT CTTCATCTTC GATTTCCTTG     69600
     AAATCAGCAT CTAATTGGGA GTCACCATTT TCTGCGTTGG CTTGCTCAAT TTTTTCACTA     69660
     ATGATTTCAG CAAGACTGTT ATGTAAAACA TCAGACTGAG CAACATTAAT TGCTCCATAA     69720
     CACAGTTTTT GAGCGGTTTT CCACTGTTTT GACTGGCTAA GAAGCTGAAT ATCTTGCAGT     69780
     ATGTCTACCC ACTTATCGCT CTCGCTTGCG AGCTTTAAAT ATTGTCGATA TGTTTCTAAC     69840
     AGAGCTGAAC GTAGATCATT ATTGTTCTTC GTGTTCCTAT GACAATCAGC AAGACTGTTT     69900
     AGAATTGTAA TTAATCTGTC TGCCCCTACT GGTTTTCCAA GAATCTCAAA TAGCTGTTCT     69960
     GTCCCAGTTG GAGTACAATT ACGAAGCTTT GCTAGTAAAC GTGACGCAGG CATTACATCG     70020
     TCTGGAAGTT CAATAAAAGC ATCAAACCAT TGCTGGCGTA CTTGTTTGTC TTTGACCAGT     70080
     ATTTCCGTTA AAGTTCCAAT ACGGTATCGA TCGTTCTCCG ACAGCAGCAA CATTTCTCCC     70140
     AACATATCAA AAGCAGCTCT TTGTGGAGGA AATAATTTGC GTAGATCTTT AAAAGCGTTA     70200
     TGGTTTTGTA AATCTTGCGC GAGGTTCTGA GAAGCAATGT ATAGCTGTTC ATGTTCTGCA     70260
     CATATCTTCT GTACTTCTTC CTGAATCACT GGTAGATGGA TAATCTCCTT AAGAGCACAT     70320
     GTGTTGCGTA ACCTCAAATC AGGTTGCAAC GGTAGCCATT TGACTTTAAA TAGGACATTT     70380
     AACTTGCCAC AGTCTTCTGG TGCGTGTTTA AGGGCATTCA GAATGACCCT CCAATAGTCC     70440
     ACTGGATTAT CAAGCTTCAG TAAATAGTGT TCAATTAGTG TCCGTGCACT GATGGGTGGT     70500
     GTGAGTGCTG ATTGTTTTTC GGCAATCTCA ATACGGCTAC TACGGCGCAG TTGTATAATC     70560
     CCTAATTTTT GAGCTAAAGA AGGTTCTATA TAGATGTCAT TACTTTCTCC TTGCAGATAG     70620
     GTATGTTCGT CAATAGCAAC TCGTGAAGAG CTACCATTCG TGTCTACAGG CTCGTGGATT     70680
     CTTAACTTGT TACTAATGTT GGATGGTAAG TTGTAAATTA ACTTTTCACA TTCCTCCCAA     70740
     CTAAAGTCAT CCCACTTTAG AGAATTAAGG GGCGTGCCAG AAGTGGCAAT ACGATTTAAC     70800
     TCTTGCTCTA CACCCTTCGC ATCAACATTG GCAATACCAA GTGCTTGACA TTGTTGAGGA     70860
     GATAAGACTT CTAGCAATTT ACTGTCAATA AAACGCCAAT GCTGATTGGG CTTGATAATC     70920
     TGTTTGAGAA CCTTAGACCA AAATGAGTTT ACATTACTTT TTTGATTAGG GCCTGCGTAA     70980
     AGAAGATCAT CAACATCATC AAAATGATTT GGGTCAGCAT GTAGCAGATA GCGTAAAGCG     71040
     CCTCGATCTG TGAAAAGGTT TACAGAGTAA GCAATTTCTT GAACTAATTT TTGACGAGAT     71100
     TCTGGAGATG TTTGCAGTGC TGGCTTTTGT TTAATTAGAG CGATAGTACT ATTGGCATTA     71160
     CAATGTGGCA AATCAATGAA AGAGCAGAAG CTAAGATAGA TAGAGTCTTT TAAGGTGTGA     71220
     GCTAGTTTTT CGGCAAGTGA TTCAGTGCCT TCCGGGGTGG TGGTACCCCT GAACAGTCTG     71280
     TAGCTCTCTT TGATTTTTCC TAACCAATCA AGAGAATGAA ATTCTCGAAT ATTCCTGCTA     71340
     CCACTGATTC TTGTGACTTC AAACAAATCC AATTGGCAGA TCTTGCGCCA AACTTCTGGT     71400
     TGACGTGAAG CTATCATAGA TATTACTGAG CTTACAAATG ATCTGGCACC TTGTGAGTCC     71460
     CTAACTTCAC TTTCTAGTTC AATTAAGATC AGATATACAT CAAATACCGA TAGCTTTGGT     71520
     GTCGTTGATT TTTCAGATCT CAGACTATTA GGGATAATCA GGCAAGAAGT CTCTAGCTGC     71580
     AACAGTTTTT GCTTCAATCC CTTAGATAAA CCATTTGGTA TTCCAAGGAC TTGCTCTGCA     71640
     GATAGTTTAC CAATCAGGGT ATCTAGGGTA TCGGCAGCTT GAAAATTAGG TGTTGAGAAA     71700
     GCGCTCTTCA GAAATTTTTT CAAAGCATCA GTAACGGCAG ACATTTCGCG ACTGCTAGAT     71760
     GACCACTGGG GAACCGCGTG ATCAAGAAAG CTATTCAGAA CCTGAATTAA ACTATTGCTT     71820
     GCACAAGTAT TTGGTGCAGA TGAGAACCCT CCTTCCAAAA GTTCAATAAT GTCAGTGGTT     71880
     TTCCATTTAG CATAAATTTT GCTTCTCGTT AATCTAGGCC ACTCTTCCAA GGTTACGGCT     71940
     CTATTTAGGC AAACCTGGCT TAGGTTTGGA AAAATCTCGG GTAGCAGTTC TACCGTTGAT     72000
     TCCGGAATAG TAAAAGGTTG CTCCTGGCTC TGTATAAAAC ACCAAGTTAA TTGACTGGAA     72060
     TGACCAAAGT TAATTTTGCA AATCCAAGAT CCCTCTGCAC AAATATGCTG GCGGTAACTG     72120
     TTCCAAAGTC TTGATTTGAG TAAAGTATGA GTCAGTGCTT TGACAGTTTC AGGCGATCGC     72180
     TCTTGTGCAA AACTCTCCAG CATTGGCAGA ATAAGGCGTA AGGTACCCCG CTCCGCCAGA     72240
     GTTTGGTTCC ACTCCTGATA AATATTATTT TCTTGCTGCT GATTGAGCCA ACTACGGATG     72300
     CGACGACGAT CGGACTGCAA GAAGAAAAAT CCGTGTAACG TTAGAACATA GTCCTCGTAG     72360
     TTGTCCTCTT CAGGGTCTAA TGTCAATATT TCTGGTGGGC TTCCATCAGG CATTTCAGCC     72420
     GTTGGGAGGA AGACGGCCCA TTGGATCAAC AATTTGGTAA GTCCTGTTTG AGATGGATAT     72480
     GAATTAAGAA GAACTGCACA ATGAGGCTCA GCCTTTTGCT TCTCAGGAGG GCCTACAAGT     72540
     GGAATATTTT TAGGCCAGTC ATTGCGTTCT TTAAGAGCTT GAAGTTTTGG TTCGTTGAGA     72600
     AGTTGCTGGT AACCGTAATA GGTATAAGAT TCAGAATCAA CAGTATTTAT GACTCCCGTT     72660
     AAAGGCAAAT TTTGAGACGT AGGCGCGGTA TTGAGTACGG ATAAACATTG ACTTGAGTTT     72720
     TCTTGAACAG CGATTCCGTG TAAGTGCTGC CCATCATAGA GATCAATGTT CTGTACATGT     72780
     TTAAGGAGTG GCAACAAGCC TGCTAGTTCT TTGACTAATT CCCCTTGGAA CTCTTGGCAA     72840
     AACTGTTCAG GATCATCACC AGGGTAATTT TCGACAATCG GAGCTGTATA ACCTCCCCGC     72900
     TGGCAATGTT CATGACGGCG AAGGGGTATC CACAATGTAA ATCCATCTTC CAATCCTATG     72960
     CGCTGACCTT CCTTTGCAAT TTGCTGTTGA TCATCGCTGG TAAATGCGAG ACGATCCCAT     73020
     GATGAAGCTG GAATGTCGTC TTCATCTCCG TCTGCTGTCC ACCATAAATT CAACATTGAC     73080
     CTTGGCTCAA CTCCAGGTTC AGCATGGGGC CCAGTTAAGT AGAAGAATGC CTCACAAATC     73140
     AAGAAAACAG TTTTCAGTCC TAAGCCAAAC TTACCAACAG CAGAACTATC ATTCTCTTTT     73200
     GAACTTAAAC CGATCGCCCG GATACTTTTA GCATTTCGTT TAGAGAAGGG GCCATTATTG     73260
     ACTGCCACAA TGGCTGGGCC ACGAAGCAAA GGATGTGCAG CTTTAGGTAA ACCGTCTGAC     73320
     CAGCCAATCC CTAACCGCGT TGATTTACAA TCATCAGCAT TCTGGACAAT CTCCTTCAAA     73380
     ATAAAGATCA AGCCAGTTTG CGATTGTTGC CCTTCTAACA AAATGTTCCT AATGTTGTTA     73440
     ATGTCGCCTC GGGCTGTATG TAAGGCACCG TAGTGATCCA TAAGTGAAAA GCTTCCATGA     73500
     ATAGTGATTG AAAATCAGGT TTGTGGTATG AAACTAACAA GTGCAAGCTC TTTATCGATA     73560
     ACGTTTGGGT TTTAGTTCAA AATAATTCAC GCTGTTGAAT GTTCTCGGTT GGGGTTGCCT     73620
     TTGTCTTCTT CTCTTTCGCC TTTTGTCCTT TGCCTTTTGC CTTCTTTTTA CCCTTATCAT     73680
     GCAAGCCCTG GGCAACTTCC TCTGCATATC GCTGATGGTT CAACTCAAGT AACCTATCCA     73740
     GTATTTCCCG ACGGGCAGAT TCACTGATGG TAAAGCGGAG ACCCTGTTTG GTTTGATGAA     73800
     AGCCGTGATT TAAGTCGAGG TCTTGCCAAC CATAGGCAGC AGCTACAGCT TGATCCATTT     73860
     CAATATGGAG TAACCGCAAT TTCTCAATAT CACTCGCTGA CTCATTAGGA TCATGGAAGC     73920
     GGTTGTAGGT TTTGGTCAGC CCTTCCTGGC GTTCTAGCAT CACTGCTTGA CGTTCGGTGT     73980
     AGTAGGTTTC GCCAATTGTG TCTAGGATTG AGAATTTGAT GCTAAGGGCA GAGGCATCAG     74040
     AAGTAGGAAA AGGAAAAGTT TCAAAACATC TTGTCACGCT ATATCTTGCA TCTGTCCTCA     74100
     TAGGAGTTCC ATACTTTATC ACCCACCAAT AATGTAAAGA TGAAGCAAGG AAACAGAAGA     74160
     AACTAAACTG TTCAGAGGCA AAGACGATTA TTGATTGATC TAAAACAACA TTTGGTGAAA     74220
     CAAAAGTTGG TGAGACGGTT TTGCTGGTCA ATGCAATAAC TAACACCCTC CTAAGTTTCT     74280
     CAATAGCTGG ATATAATGCA GGTCGCTTCT CTGCATAATG CCACCAATAA TCTCGATATA     74340
     CTCTTCGATT GTCACTCTGT CGTATCAGTT TTACTTTGGC TTCCACTATC TCCAAACAAT     74400
     CAGGATAATC TGCTGCATAG GGCTTTCCTT TAGATTTGTT TGGATCATCA TGTTCTAAAT     74460
     CTAAAGCCCA ATCAAAGAAG TTTATAGCCC AACGGCTAGG CTTCTGCTGT GGATGGGAAT     74520
     TTAGATCTTG TCCAGTAATG TAAGGAAATA GGACGTCCTG ATTTTTAAAA TTCTTTACAA     74580
     TAAGTTTTTG TGCTTCATCC GGCGACATGA CAAATCCCAT ACCTAGCAGA ATTGATCCTT     74640
     GAAAACATGT ATTTGAATTT GACAGTAATT GAAAAGGACT ACCAGTTACA CTCCCTTGAG     74700
     GTGCTAGTAG AGATGTAATG CCAGGGACAA GTTTTTCATC CAAGAAAAAG CCTCCCTGCC     74760
     AGTTACCCTT ATGTATCCAG ATATATGCAA CTTCTAAAGT GGCAGAACCA ATCCAGGGGC     74820
     GGCTCGGTAC AGCCCGATGA ATCACACAAC CATTTGCCAC TAATTGGTCT AGCCCCACTT     74880
     CACGGGTATC ACCTTGAGCA ATGGTATTGG TTGCAATTAG TCCAAATCCC CCAAAGCAAT     74940
     TTGTAGCTTG ATTAGCACGT AAAAAGAAGT AGGCACATAG ATCTGCACTA CCCCTTTGAC     75000
     CATTAGCAAG GTAATCTACT AAGAAATTTC GATAATCTGT ACCCAGTGTT CCTGTAATTT     75060
     TTTGTCCCCC TTGAAATGGA GGATTGCCTA CAATTGCCGC AAATCCCTTT GGTGCATCTT     75120
     CCTGCAAAAA CACCTCAGGG AACTCCAACA GCCAGTGAAA GGGCCGGCGC GGGGGTTGAT     75180
     TAACTGGCTT GCCCAGGTTC AGCATCCGTT CGGTTTTAGT CAGAATAAAA TTGATTTTAC     75240
     GATCGCGTTT ATCTAAGTCA TCTTCATCGA TCGCTTCAAT CACGTTTTCA GCTAAAACTT     75300
     GAAGTTCCAC ATCGGTCAGG TTAGTCGTTT TTGCGGAACC GGCTAAGGCT TCGGCAACTA     75360
     AAAAATCCCC AACGTAACGC ACTTTGGCTA AGGCTTCTTC GGCTTCTTGG TGCAGCTGTT     75420
     CTTTCCTTTC AATATCCCTG ATGTCAAGGG CAATAAAGTT TTCCAGTTCC TGCCGTTTAG     75480
     CGATCGCTCT CTGGATCAAG GGTCGCCAGC GATCGGACAC TGTTCTCAGT TGCACCGCCT     75540
     CTTTTTCTGG ATTCAGATGC AGAAATTCAA TCTGTTCTTT GCGCGTAATC CCCATCAGGG     75600
     AATCCCCACA CTTAAGCGCA TGATCCAGAA ACGTAAACGG TCGTCCCTTT GCCAGCGTCA     75660
     CCAACCACAT CGATAGTTTT GCCATCTCCA CGGCTAAGGG GTTCTTATCC ACCCCATACA     75720
     AACAGCGATC CGACACAAGC CGCCTGGCTA CCAGTAACCG CTCCTCCGAG TCTTTCGGCA     75780
     AAATGTGTTC TCCCGGTTCC CCCAGGGATA GGCTGCCATC TGGAAGGATA TGGATTTTTA     75840
     GTTCTGAAGA CTTATCCTCA TGGCCCGAAG CAGGAATTGG TTTTTGCTGG GGAACTTCTG     75900
     CCTGCCATGC CTCTACCAGC CGCTCTGCCA TATACCGACA GGTCTGCACC AGAAATGCGC     75960
     CACTCCCCAT CGCCATATCG CAGATCTTCA GTTGCAGCAA TTCCGCCGCC GATCGCAACC     76020
     GCCACTCTTC CTTCGGCTTG CCCTCTGCCA CTCCCTCATA GACCAGGGGT TCCAGCGTGT     76080
     ACTGGACAAT TTCTTCGGTT AAATTGCGGG GGGTATAGTG TGTGCCTGTC TGTCGGCGAT     76140
     CGGCTCCCTC GGTTACATAC ACAGCCCCTG CCGGAATCAC CACCGGATAG TCCACTGTAT     76200
     CTTTCCGAAT TAAGGGGGCA AAGGGCAGAA TGCGGTTAAA TAACGCCAGA TCATTGTTGC     76260
     AGGCTGTTCG GAGTCGCTGC TCTTCCCGTG GCTCTAGAGC TTTATCTAAC TCTTTTTTCA     76320
     AGGCATTGAG CGAGCGTCCG GTCTTCTCCT TCAAAAACGC CAGAAATTTA TCTTCCCCCT     76380
     CCGCCTGGAA CCGCTCTAAC TCAGACAGCG CAATTTCCGG TTCCTCATAA CGGGATCCCA     76440
     CCAGGCCCAG CACCGGGGTT TTTGCCCGCA CCGCCGTATG ATCCAGCAGC CCCTCATAGA     76500
     CATGCCCGAT CTGTTCAATA TCCAGTGCTC TGAACGATAA CCGTCTCGGT TCTACTACAC     76560
     CCCCCGGCAG CCGAATTTGC AACATTTGCA ATGCCTCTAA CAGGTGCAAC ACAATCCGGT     76620
     TATTGATGCG CAGCGGATCT GCCGCAGTCG ATCGCCACTC TGTTCCCTGT CCCCGCCCCT     76680
     CCAGAAATGG AAACCGATCC GGCTCAAACA AACTGCCCCC ATAGGCTGGA AGCTGCAAGG     76740
     TATCGTGAAA AATGCCCCCA TACACCGCCC GAAAGGTTGC CAGCAATCGA CACCAGGCAT     76800
     CCGATCGTCG CTCCAGAATT TCTTCCCCAT GCTGATCAGC GTGCGATCGT AACTGTTCCC     76860
     GCAGCGTCGA AACGGCATAG TGCTGGTCAT AAATTGGATC CCCTAATAGC AGTAAGCCCC     76920
     GCTCCTCAGC ACAGAAGAGA AACACCAGCC GCATCATCAC GGTCAGAGCC GCCTCATAAA     76980
     GCTGAGTTTC TGGGATGTCC TTCAGCAATG TCCCGTTTTG ATCCTGATCC AACCTCCCGA     77040
     TCGCCTGTAC CAGCACCTCC ACCGCCCGGC GCACCTGATA GCCCAGCTGA TCGGTTACGT     77100
     CCTGCTGATC CGTCAGACTC TGAGTTAGGA GGGCCTCTAA GGTTTCTGCA TCCTCCACCC     77160
     CAAAGAACCG CCGCACCCCC AGCAAACTTC GGAAAGCCCG TAGCGTCAAA TGTTCTTCCA     77220
     CCCAGAGTGT GCTGTACCAG GAGATGAATC CCGTCGTTTC ACCCTTCGGC GCATTCACCA     77280
     GCATCCAGTG TTCGCCATTG GTTAATAGCC CCAACCGCAC TTGGCAGGCA TGGAGTAACT     77340
     CCATCATTCG GGTTGCGGGA CTTGCTGCCC ACCGCGATCC CTTGTAAGGC TTTTCTAATC     77400
     CCTGCTCTGC CGGAACCACC TGTACCAGTA AGCGGGGTTT CCCAGCATCA GCTGTCCCCT     77460
     TTGGATTGAC CACCACCCAA TCTGGCCGCA GCGTTTCATT ATGTTCGGCA ACGGTTACAC     77520
     TCAGGCCCGC TGGAATTTGC TGCCCACCCC ACAGCACCTC CTCTGGTAAC TCCAGGGTTT     77580
     GCTTCAGCAC GAACTCCACC CAGGCCCGAT GGATTGCTGA TTCAGGTTTT AAGCCAAACT     77640
     GACTGTCCTG CCACTCCTCG TGTGCTGATC GCAATAGCTT CAACAGGTCT GGATCATGGG     77700
     CATCCAACCC CGCCGGAAAC GTCTTGAGCA AAACGGGCAA ACTCAAAAAC GGCCCCGATA     77760
     CCTCAACCAG CGATAACCAT TCAGCGTGAT GACGTGCAAT AGACATAACC GTTAAGCAGC     77820
     CAGGGTAGAA GAAACAGTAA GACCAGGTTC GACCTCAGAA ACTGACAATG GCGATCGCTT     77880
     TTGAGCTTCA GCAAAGCTGG CGACAACGGG GTTATGGTCG CTCAACTCCT TCCAGCCTGG     77940
     AGCTGCAAGA ACCTCACACC TGTCCAGATA CCGATACCAG GCAGCAGGCA CAAAGATGCC     78000
     ATCACAGTGG TAGGGCGTTG CCGGGTTCCT ACTCCATCGC AAAGTCTGGG CTAGATTACG     78060
     GTTTGGGGTT GGCCGCCTGC CAGCAACTGA TCAATCCAAA CTCTTGTCTC AATCGCTCCA     78120
     GTAGCCACAA ATCCGCATCC TGCTGCTCTT CACCGGGATG TCGCACACCC ACCGTCAAGT     78180
     TGAAGTCCCC CCCAATAATC AGATCCACAT TAGGGGGAAG GCTGGCAATC CAGTCCAGAA     78240
     TCCGACTGAC TGAGCCTCGA TAGGGAGCAG GTGCATGGAG ACTGAAAATC CGCAACTTCC     78300
     GACCACAACT GGGGGGGCAA TCAAATCCCT CCACTTCCAC CCCAACAACA CTGCCCTCAA     78360
     ACTGGGGAAC ATCGAGCTTC CTAACCATCC CCGATCGCAC CCATACCGCA CTCCCCCAGG     78420
     CATTTGCTTC AACCCTGGCC CAATGCACCC GATCGCGGTG AACATCCCAA AATTGGCTGC     78480
     TAACATACTG TTCGGGTTGG CATGTTTCCT GAACAAGAAA AATATCAGGG TTTGCCACCT     78540
     CAAAAAGTTG AGTCCAGTGA ACTCGTTTGT CAGGTTTTCC ACCGCATCGC AGATTGTAGG     78600
     TTGCAATTTT CATGGGCACT TTTGTCCGTT GGCTAAACAG GGATTTTCAA ACTCAGGGAT     78660
     AGTCGATCAG TAGTGGGCCT TCAGGGATGA ACCTGGCTTG GTAATTGGTT TTCTTACCCA     78720
     TTCCTCGCAA GCTCCCGATC ACAATTGGTG TTTTTAACAG CTCTAACTCC CGCACTTCCC     78780
     AGAACACCGC CCAGGTTGGA CTATCAGTAG CTGTAGATTT GGGCCGGTAA ATCGAATTCC     78840
     CTGGATAACG CCCCCGCCGA GACCCTACAA CCCCCGCGTA CAGTCCCCGC CAGGTCACCT     78900
     CTGGATGTAA GGGTTGGTTT CCTTGGGTAT GGGACGCATA AATGAAGACC TCAACCGCTC     78960
     TATCCCCGCG TAATTCATTT GCTCTAGCAA AAACCTCAAA ATCCATGCTT CCGAAAGCAA     79020
     CTTTGGGAAA TTGGCCGGGT TGGAGAACAT CTGAATCGAG TTGAGCGGCG ATCGCTTCTA     79080
     GTCCAGAAAC TAGGTGCATC TCTGGAACGG GGGCAAGAAT GGCGAAAGCG TGAGTCGTTT     79140
     GCATCAGACA GCTTGAGAAA AAGATCAGGA ATTCAACCGT TGTTCGTACA AAGCCCCAAA     79200
     CTCGGACTTG GATAAAGTAA CTTCTCCCTC CCGTGCCTGA GCCTGAAGAA CTTGCCAGAA     79260
     ATTGGAACCA GTGACTGTAA ACGTGTTATC CGTCCTCGTA CTGCTGATTC GGATAATTCC     79320
     ACCATCAAAG CTAAACTTAA ACCGAGCGAT CGGTTCCTGA CTCTCCGGCT TTTCTGGCTG     79380
     AGATGTGGCT TGAGGTGCTG AACCTTTAGC TAGGATGGGA GCCTGTTCTA AAATCTGTTC     79440
     CCAGGCTTCG TTAAATGCCT TGATATGGGC CTCTGTTTTG GGTGACCAGT AATTACGTGC     79500
     TCCAGAAACC TTAGGAATAT AGCGTTTGAA CGAAACCGGA TTGCGGAGCA GGTGTAAAAA     79560
     GCCGTCATAT TCAGGGTCAG ACTCACACTC ATAAACCTCA GCAGCACCAA TGATGCAAGA     79620
     AATCATCTCC GGGCTTTGAG GCTCTCCCCA GTCCCGTCCG GTAGAAACAT GCAACAGAAA     79680
     GGTTCCCCGG AACTTTGTCG GCCAGGTGCG GAACTCCCAA TCCTTTTCCC CAGTCGCAAT     79740
     CTCATAGGCA AACGGTCCAG CAATGCTCAG GGCGCGAAGG GTATCGGGGT ATTGGGCTTC     79800
     AATTGGCGGC ATAGGTCAAC TGCAAAGATT TAGTTAGTTC CACAAAGCTT TCTGGGCACG     79860
     AGATAGGTTA CAGCCAATGG AAAAAGCCGG GCACTGGGCT CGTTAAACCT TTCCCGGATC     79920
     AGGACAGTCT CCTGTTCAAT TTCCCGAGGA ATTTGCTCAG CTCTAGCTTT CAAACTGTTC     79980
     ATATTTCGTT CAAACTGCTC CTTTTCAGGT GTTGTGAAAA GTTCCAACTG CTCCACCTGG     80040
     GGTTCCTCCA ACTCTTGCAG GATGCTCTGG CGTAGTTCTG TCAGGATGGC GGTAATATCT     80100
     GCCACTTCCT TCTCCGCCCG ATTCTGCAAA TCCCGTTGCA GGCTGGTTGC CCGTTCTGAC     80160
     TTCCTGACCT CCAGGGCTTG CATCAAGGCA TCCGCATACC TGTCCCACAG ATCTGCCAGA     80220
     CGCTGTTGTA AAACTTCTGG TACTGAACCC GGTACTGTAG CTGCCAGGGC TGCTTGCACT     80280
     TGCATCACTC CCAATCGACT GAATCGGCCT TCCTTTAAGA TTCCTCCTGC CGAAATCACC     80340
     TCTTCATGCA GTCGCTGCTG ATCTTTTCCC AGAATGACCA GCCGACCGTA GGCAATCACC     80400
     GCTGGTGTAT CCAAGCCAGA CTGGTCGGCA ACAACCCGTG CCGTGACCCG ATGCAGTTGT     80460
     TTTCGTCCTT CCGTAGACCA CACCTCTGCC CGGAGCAACC GTAAACACAT CTGGACCAGG     80520
     CGGTGGTTTA GGTGGGCCAG CACAACATCA TCTCGACCGT GGGCCAGGGC AGGATCAAAG     80580
     ACTAGGGGCC GAATTGCTTT CGTATGGGGA TGCTCTAACC CCTCCGCACA CACGGCCCAG     80640
     CTATGCTTCA GGGGTGGCAG ATGATAGGCC GGTCCCCCCA ATCCAGGAAC CTTAGTTTCC     80700
     ATCAAAGGAG GCTGATCTGC CAGTTCCAAC CCGATCCGAA CTACCGTGGC AATATTGTCG     80760
     GGAGTTAAGC GCAAATTCTG GCGAGTTTCG TTCAGCTGCT GGCGGAGTTT TTCGATCTGC     80820
     TCCCGCACCT TGCGTTCAAA CTTCAGCATC CGCCGTACCG GTTCCGAGTC CCGTTCTGCC     80880
     CGACTGGTAT CCAGCGTGGT TCGGTAGCCC AGCATCGCCT CTTCCACCTG AGCAGCAATC     80940
     ACTGGTCCCA CTTTCCCCAG GTCCTCGCGA ATGTTATTCA CCTTCAAGGC CGCCCGCATC     81000
     AAAAACTCCA GATCCCCTTC CAGGTCACCG GGCCGAGTTT GAGGGGTGGC TTGTCCCTGG     81060
     TAGCCCTTAC CGACAAAGTG GTAGATCAAG ACTTCCGCTG CCCGTTGCCC ATGGCGATCG     81120
     ACCCGACCAT TCCGCTGCTC CATCCGATTC GGGTTCCAGG GAATTTCGTA GTGGATCAGG     81180
     CGAGAGCAAT AATTTTGCAG ATCCAGCCCT TCCGATGCCG CATCTGTGGC TAGCAAAATC     81240
     CTTACAGGTG AAAGATCAGG ATGGGTTTGA AATGCTGCCT TGACAGCCTC CCGATCGTCC     81300
     GAATTCATTC CCCCATAGAG CATCATCAGC CGGTTATCCT GAACCAACCC CTCCGCCGCC     81360
     ATCAAGTTAA ATAACCACTT CTGGGTGGCC CGGTACTCTG TGAAAATAAT CACCCGTTCA     81420
     TTCGACCACT GTTCCTGGGG GCGAATATAA GTGGCAATCC AGTTCAGTAA CTCCCGCGCT     81480
     TTGGCATCCG GTTGCTGCGA AGCACGTTCT GCCCAATCCA GCATTTGCTG TAGCAGTCTT     81540
     TGTTCTTCCA AGCTGAGGGA GCGAAATAGC CGACTCGAAT TCGTGATCGA CTCCTCCGTT     81600
     GCCACCTCAA ACAGCTCATC ATTACCAAAC TCTTCCTCTA CCTGATCCAG TTGCCGCCGC     81660
     AGAATACCCT CCGTGGGCCG GGCAGAAAGA CTGGCAGTCG ATCGCCGTCG GGCAGTTCTA     81720
     ATCGACTCCT CATGCTGGGT CAGCGTTGTC AAAAATGCAG CCGGAGAAGA GAACAACCGC     81780
     TTTTTCAGCA GCTTCAGCAC AAACTCCGTG GCATACTTCT CCACCCCATC TGTCGCCCCC     81840
     TTCGCCCGCA GCGTCGTGTA TTCCTTCAGC CACTGGTGGG CCTGGCGTTC CGGGTCTGGG     81900
     TAATCCACAG GAATGGCTGC TAACTTCCGG GCCGGGAACA TCGGGGAGCC ATCCCAGTTT     81960
     TCCATCTCCT GCTTTAACCG CCGCACCATC ACCACCTGCA ACTGGTTGCG ATCGGGGGGA     82020
     ACACCACGGG CAAAACGTTG GGTATCCAGT AACTCCAGCA AAGCCGTAAA ACTTTCTGGG     82080
     TAACCGTTAT GGGGAGTAGC GGTCAGAAAC AGCTTGTGTT CAAAGTGGGG TACCAGCAAG     82140
     CGAATCGCAG CTGTCCGCAA AGAATCGATC GCATACCGTC CACCCCCAGG CGGGGCCACA     82200
     TTATGGGCCT CATCCACAAT CAAGAGTTCG AAGCGTCGCG GATAGAGTGA CTCCCCCTCT     82260
     GCCGGCAGCA CTTCTCGAAA TAGACGCAGG GGGCGATCGC GCTTGAGAAA ATCAATGGAT     82320
     GTAATTAGGC GAGGAAAATG TACCCAGGGA TTCACATGAA TTCCCCGTTG CCGACGTAGC     82380
     TCCTTCATCA ACCCACTATC GACAATGCGG AACTCCAGCC CAAACTTGTC ACGCATCTGG     82440
     TCCCGCCACT GGATCTGCAA CGCAGAAGGA CAGACGATTA GTATCCTGCG ACAGCGATGA     82500
     CGAATAATTA GCTCCTGAGC CACCAATCCC GCCTCGATCG TTTTGCCCAG ACCGACATCA     82560
     TCCGCGATCA ACAAATTCAC CCGCGGCATC TGGATCGCCC GCACCACCGG ATCAAGCTGG     82620
     TAGTCCTCAA TATCAATCCC ACTGCGGAAC GGGGCCTGTA AATTTCGTAC ATCCGCCGTT     82680
     GAAGCTGCTC CCCAGCGCAC CGCATCCAGA AACGCTTCAA GACGAGCAGG CTGATCAAAC     82740
     CCCGTAGGTC TGGGTAACTC TACCCGCTCA TGCAAATAAG CTCCAGGTTC TAATTCCCAA     82800
     ATAACCTGTA ACTCTTCACC CAGCGCATCA TCCTCAATCG AAGCAAGAGA GACCAGATTT     82860
     TGAGCCTTAA AGATACCCGT CAGGAGGGGG CTGCTGGGCA GATTTGTACG TTGCAAATTG     82920
     GTCACTACAT ACTGCCGTTG TCTAACTCTG ACCAACTGGC CTTGCTCAGG AACACTCATT     82980
     CAGGGAATCA CCGGCAAAAA AACTTTTATC TATTATTCCC ACCTAAAAGC AATCAATAGC     83040
     AGTTACAAAA TATAATTTTT ATAATCTTAG AAGTATGACT AATGGATGAT GACTTTGGTC     83100
     TCAGTAGTTA CCTAAAAACC CTTCGAGTCT CGATCTCCGC TGCTCTAGAA GCCGGAAAGC     83160
     TACTGCGACA GGAATTCCAT CGCCCAGGGG GTCCCCGAGG AGGAAGTTCT CATGCCCTCA     83220
     TGGATGATGA AGCCGAAGCC TTAATCCGCG ATCGGCTGAC GGAAGCCTTT CCAACCCATG     83280
     GAATGCGGGG AGAAGAACTC AAGCACCTGA ATCGCCCACC TCAAGATCCA GAGCAGCACA     83340
     TCTGGCTGAT TGACCCGAAT GATGGAACCG CCTCCTACCT GAAGGGCTAT CGTGGTGCTG     83400
     CCGTCTCCAT TGCCTTACTG CGATCGGGCA TCCCAGTCTT AGGAGTGGTT TACGCTTACT     83460
     GTGCCCCCAA TGGAGAAGGT GATCTATTTT CCTGGGCAGA GGGATGTGGG CCGTTGCAAC     83520
     GAAATGGTCA ACCTGTGCAG CGAATTTGGG CAGATAAACT TTCCACAGAA CACACCGTCC     83580
     TTGTCTCACA AGCGGGGGAT AATAACTCCC TGGCAAACGC CCAACTGGTT GCTCCAGCCC     83640
     GATTTCGCAC AATTCCCAGC ATTGCCTATC GACTGGCTCT GGTGGCTGCG GGTGAAGCTG     83700
     AAGCTGCGGT CTCCCTCAAT GGTCCCCAGG ATTGGGATTA TGCCGCAGGT CATGCCTTGT     83760
     TACACGGGGT TGGCGGTGAA CTTTTTGATC GCAACGGTCA GCCTGTAACC TATAGCGCCC     83820
     AAGGTGAAAG CTACTGTGGT GGAACCTGTG TGGGTGGCTC AGCCCAGATT GCACCCAAAT     83880
     TAGCGGCTCT TAACTGGCAA CCTGTTTTCC AACGATCGCA CCCCACTTCT GAACCCTATG     83940
     GGCTGGTCAA ACTAGAACCT GGTCAATCGA TCGAAAATAG CGGACTGCTT TCCCGTGCTC     84000
     AGGGTTGTCT GTTGGGACAG TTCGCCGGGG ATTCATTGGG TAGCCTGGTT GAATTTGAAA     84060
     CGGTTGAGAC AATCAGAGTG CATTATCCGG ATGGCGTAAA GTTTCTGGAA GATGGGGGCA     84120
     CCTGGAGTAC GATCGCTGGA CAACCCACCG ATGACTCAGA ACTGGCCCTG ATGCTGGCCC     84180
     GATCCTTAAT TAAGAGCGGA CACTTTGACC TGACAGCGAT CGCTCAGTCC TACGCCTACT     84240
     GGTACAACTC TCATCCTTTT GATATGGGTA ACGCCATCGG TCAGGCTCTT TCAGGAATCT     84300
     CCCATGCAAT AGATTTTGGC ACTGACCCAG TTGAAGCAGC TAGACAACAC AGTAATCAGG     84360
     ATAGCCAGGC GAACGGAGCC TTAATGCGGA TTTCTCCCTT AGCGATTTTT GGACATGCTA     84420
     CGGCTGAAGA AACGTTAGCG GAATGGGCCA GAGCAGATGC CAGGCTTTCC CATCCCCATC     84480
     CAGTCTGCCA GGATGCCAAT GCTGTTTTTG TAATTGCAAT CCGCTATGCC TTAAGAACCG     84540
     GTGCGACCCC TGCAGAGGTT TATCAGTACG CCAGAACCTG GGCAGAATCA ACGGGTATCC     84600
     ACGCGGATAT TTGCCAGACG CTGAATGATG CAGCTCAACA CCCCCCACTC AATTATCAAA     84660
     GACAGATGGG CTGGGTCCGG ATTGCGTTGC AAAACGCCTT TTATCAACTC CTGCATACGG     84720
     ATAGCTTTTC GGCTGGAGTA ATCAATAGCG TGATGCAGGG GGGAGATACC GATACGAATG     84780
     GGGCGATCGC TGGAGCCTTA CTGGGGGCAG TCTATGGCTA TAGTGCCGTT CCCTTGCAGT     84840
     GGCGCGATAG AATTTTGAGC TGCCGGCCCC TTCAAGGCCT TCCAAATGTT TATAAGCCAA     84900
     GACCTAAGCC TTTCTGGCCC GTCGATGCCC TGGAAATTGC TGAAGTTCTC TTAAACGCTC     84960
     TCAAAAGAAA GAATACCTGA ACCGAATTAC TTGACAAAAA TTTAGTAAGA CAAAAGGGCA     85020
     AATAGCTATG AGTGGATTAA TTGTTCTAGT TCCTTACAGT GGCGGGCAGG ATTTTTATGG     85080
     AGAGCCAAAT ACTTATCTAT ATGATTCTGA TGAGGACGAG ATTGATGAAA ACGGTCAAGA     85140
     TGGAGATGAG GAGGAGTTTG ATAAAAATGA TGAAGATGGA GATGAGAACA AGATTGCTTA     85200
     CCTACCCATA TATGTCGCCA CAGAAGATGA AGATTTGGCA TTAATGGCAG TTGCATACAA     85260
     TGCTTGCGTT AGCTGCAATT ACGTTGCCCA GCCTTCAACA AGAGAAACAG AAGAAGCTTG     85320
     GCAGTGGCGG AATTATCCAG GAACATTGGA ATCTCCAGGA GTTGAATTGC CATTCACTGA     85380
     AGAGGCTTAT ATAATCCCTG AGCCAGGAGA TTGTTTTTGT TGTGGTAGTT TAGATGATTA     85440
     TTTGGTTTTA TCGTTAGATG CGATGGCGGA AGATCTACAG GAATCCCCTG GCGACTTTGT     85500
     GTTGAAATCA AGTCCATTCT TCGACTCTAA ATCCATACAA GAGGAATTCA ATTATTGGAT     85560
     CGAGAAATAT ATTGTTTCCT TGCCTAAGTT TTTAAGTAAG GAAGAAGATA AACCTGAAGA     85620
     CTTAATTATC TGCAAAAACC GTATTGTTGC TTTACCTGCA GGATGGCAGG GTTAAGAACT     85680
     ATCTGAGCCC GATCAGCTTT TAAGCCGTAT TCAGACTGAT AATCACTTAC TCAATTTTGT     85740
     TTAATTCGTA TTGTTTGGGA GCTAATAATG TCAAATCAAC TTCCTGAAAT GAGCCGCAAG     85800
     CACAACAAAG TTGTTCCTGA TAACGTCAAA GTTAATGACC TGATGGCGTT TACTTACTAT     85860
     GGAACTATTA AAAGCATTCA GAAGGATGGT AAGCAATTGA TTGTATCAGG TCTTGATAGC     85920
     GGGATGAGCG ATTTTTCTAT TGAAGGTGAG GAGTTGATTA CCAATGCCCA TTCTGCTGAT     85980
     CAGTACACAG AGGAAGAGAA GGTTTCCAAG ACCAAAGCTG CAGAAATTTT AATTACCTCA     86040
     GTCAATCGAC CTTTTACCGT CTGTTTTAAG AAAAAGGATG GATCGGAGCG TATTCTACGG     86100
     GGTCGTCTAG TAGAACCTGA ACCTTTGCTG GGGCGCAGCC ATGTTGAAGA TCTGGATATT     86160
     AAAGATGGTG ATAGACTTCG TCAAGTTGAT CATAGGACTC TCATTTATCT CATCGTTGAT     86220
     GGTGTCAAAT ACATAGTTAA GTAACGCAAT GAATAGCTCT TATTTTATTG AGGTTTAACT     86280
     TCTTGACCCA TTGTTGACCA TGACCGATCG TTCCGACTTT ATTGTTGTTG ACACCGAAGG     86340
     CAGCAGCGAG CTCAGCGAAA TCTCAATCCT TGACAGCCAG GGCACCCTGA TCTACGAGGC     86400
     TTTTAGTGAA GGGCATCCCA GTAACCAGAC CATCAGGCTT AACCTCAAAC CCCTACCTGA     86460
     CATCATCCAC GACTTTATCG AAATTGCCCG TAACCGCCCG ATCGTCTGCC ACCACGCCAA     86520
     CCACGACAAT GAAGTTCTCA AATATAGCTT TGCCAGAGCC GGCTACACCT GGCGGGATTT     86580
     TAGCTTTGTC TGCACCTGGG AACTGTCCAA GCAATTCTTT CCCAACGCCG CGGGCTACTC     86640
     TCTCGAATTT CTTTGCAAAC ACCTTAGCCT GAAAGTTAGG GGCCAGCGGT TTAACCCAGC     86700
     CCAGGCCCAT ACCGCCCGTT ATGATGCCGA ATTTACCCAT CAGCTGTACT TAAAAATCCT     86760
     GGAACAGCAA CAAAGCCAAG TGATGCAAAG CCAGCTCAGC CAGACTCCCA ACCCCTTCGG     86820
     CAGCAGCAGA GTAGATACGC CATTCCAGGA GCACCTTGAC CTGCAAGAGG TCTACCACAG     86880
     CGAATTCGAG AGTCTTAAAT CCATCATTGG CGATATCAAA AATGACCCTA ACCACCAGAG     86940
     CAAGGGAGCG GTGGTCATTG GGGAAGCCGG TTCAGGTAAA ACCCATCTGA TGATGCGCCT     87000
     GGCCAGGGAA CTGCTGCGTT CCAACCGCCT CCTGTTTATC CGTCATCCCA ACCATGCCGA     87060
     TAGCGTTCTC TACCACACCT ACGCCCGTAT CCTGGAATCC TTTGCTGAAA AAGTACCAGG     87120
     TAGCGATCGC ACCCAACTGG AATTACTCAT TGCCCGAAGC TTTATCAAAA TCCTCAGTTC     87180
     TCAAGCCAAT GTCACCACCA CCCAGAAGGG GCAGGAAATC CTTGCAGCTC TGGAAAATGA     87240
     CCAGCTCAGT CTCTACAACC GTTTGGGGAT CGAAGGCACT GATAAGCACC GCAACACCTG     87300
     GCAGTACATA GACCGACAGA TTAATCTATG GTGGACAGGG CAATACACCG CCGCTGGTTA     87360
     TGGGGCAGCC ATCCTCAAAG GCATTATCAA ATTCTGTAGT TACAATTCAC CCCGCTACAA     87420
     AGAACTGGTG AGACGCTGGC TGGCCGGGAA TGAATTAGAG GCAGAAGAGA CCCAACTAAT     87480
     TGGCCTACCC AACTGGCAGG AAGACCTCAG CCGCGAAGAA TTTGCCCTGG CAGCGATCGC     87540
     CGTTTTTGGT CGGCTCTCCA CCCTGGATGA ACCCCTGCTG ATTATTTTTG ACCAGCTTGA     87600
     AAGTCTGGGA CTGGCCCATA ACGAACCGAT CCTGGCCAGT TTTGGTTCCG CTGTCAAAGA     87660
     ACTCCTCACC CATGTTCCCA ATAGCCTGTT TATCCTTAAC CTGTTCCCCG ATCGCTGGCA     87720
     GCAATTTCAG GGTTATTTTG ATGGCTCCGT CATCGATCGC GTTTCCCAGT ACACCATCTA     87780
     CCTCAACCGC CCCCCCGCCG ATAAACTACA ACGAATCCTT AGTTTCAAAG CCGCATCCGT     87840
     AGGGTTAAAT CTGGAGCAGC TCTTTTCACC CGCCGAACTG AACGACATTC TCAGCCAACC     87900
     TTCCATTCGG GCCATCCTGA ATCGAGCCTC TGCCTACTTT CGCGCTAAAG CAACGGGCCA     87960
     TCCCCTCTCC CCATCTCCGC AACCAGCCGG CCCCTCCCTT GAGGAACGAG TGCAACAGCT     88020
     AGAAACGGTA CTGCAACAAA TTGCCAGCTT GATTGTACCG ATTCTGAATA GCTCCCCCAG     88080
     TTCTGCACTA ACCCTCGAGC CCCCGTCTAC CCAGCAACCA CCCGGAACCA GCTTAGAACC     88140
     CCTTCAACCG GGCAGTCCCT TCATTGCTCT CCCCCTCCAC TCCGAACTGG AGTCCTACCT     88200
     GCAACAGCAA CAAGCCGCCC TGGCAGAAGC CTATAACAGA CCCACCGTTC TTTCCGATGC     88260
     CGATGACATT GGTAAACTGG CCACGATCGC CGAAGCCTTC AAAACCATCA CTGCCCTGGA     88320
     AATCGACCAA CTCCGACTGG GCAGAACCAA GCTCCCCGAA CACCTCTGGC TAAAAACCTC     88380
     CCGGCAGGGC CTGGCGATCG CGTTTCTACA AATCCACGGC AGCACTTTTA CCGCCCGGAT     88440
     CAAAAACTTT AATCAGTTGG TGCTGGCTAA CCCAACGATC GAATTTCAAC TCCTCCGAGA     88500
     TGCGCGAGAG CCGCAGGTTA CCGGCCCGGT TGGCAAACAA GAAATTCAAA AGCTAAACCA     88560
     TACCCCAAAC GGAAAATTCG TCATTCTCGA AGCCGACGAT CGGATCAAAT TTGAGCTGAT     88620
     CTATAAACTG ATTACCGACA TTGAGGAAAA AGACCTGGAC ATTGATTTGA AGCAGGCTCT     88680
     CCTCTACCTC CGCTCCTATC TGAAAAACTA CTGGCTAATC TCTTTCTTTA GCGAATAGTT     88740
     TGTCGTTCGC ATAGAGCTTT TGCCCCCCAA TAGGATACTC CCTTACTCTG GTGTTTGCAG     88800
     GAATTTCACC GGGAGGGAGC TACCATGACG TTCACAGCAG ACACTCGTGG AATTCATACC     88860
     CCCGTCGCGA TCGGTCAGAT TTTACACCGA CACGTAGGGC AGCCGTTTCA TGACAGAGCT     88920
     AATTCCCATC GGTTGAATCA TGCCTGGGTG CAGCAAGTTA AGAACCAGCA TAGTAGTTAC     88980
     CATCGGAAAA CCCTTTTGGA GCAAGGAACG GCTGACTTCA CCCGGACCAC CTATGGCTTA     89040
     ACCCCCGACG ACAAAGCCCT GCTTTACAGC TACTACTACT TGCAACGCCA CCTAGCGAGT     89100
     GGTATTTTTG TCCTACAAAG CTGGGAACGT CAGATGGATC AATCCCTACC CTGGTTCAAC     89160
     CGGCACAGTG CCATTATTGA TCTGGGTTGT GGTCCCATGA CCTTTGGTCT CGCCTTGCGG     89220
     GCCCACCAAC TGCTTAAAGG ACGGGGGCTG CAGGGGATGC AATACATTGG GATTGATCGG     89280
     GCCGAGTCCA TGATCCGTAA AGCCTCAGCG ATCGCGACTG ATCTGCAGCA ATGTAGTTCA     89340
     GCTCCCACTT TCCTGTTTGA GCAAAACTTT CAGGAAATTC ACTCACACCT GCGTAGACTG     89400
     GATGGAGTCG TTCAGTCCCG TGGCACTGGC TGGTTAGTGT TTAGCAGCTC TTACCTGTTT     89460
     GCCAGCCCCA CCCTGGATGT CAGCAGTCTG TTTGAAGAGA TTCATAACGT CCTGCAACGG     89520
     CACCCTGACC ATAATTGGTG TTTTATTCAA CAGAACCCAC CTGTATCTTA CCTGAATCAC     89580
     AAATGGCATC AATTCTGTAA CCTTCTCGAC CAGCATTACC CCGACTTTCG TACTCAGGCT     89640
     AGCGAAATTT CGATTCCCTA CGCTGAATAT AGCCTGGAGC CAGAAACTAT TGGGCAACTT     89700
     GTCCCAAAAA CCAGCATCAA ACTCAGTTAC GAAATCCTGA CGCGGGAGGT AACCCCATGA     89760
     CCGCCTATAC CCAGCTCAAC CTACTGGATC TACCCCCTCT CCCTGAGGGC AAGCCCCTCT     89820
     CCTCCGTTCC TGGTTTGCGC TACATCCCGA ACTTTATCAA CCCAGCAGTT GAGAAAACTC     89880
     TGTTAGAGGA GATTGACCAG CAACCCTGGA TAACGGACCT GAAACGACGA GTGCAGCATT     89940
     ACGGCTATCG TTATGACTAC AAAGCCCGAG CCATCTCACC GGAAGCCTAT CTGGGAACCT     90000
     TACCTGAATG GCTAAAACCC CTGACGAATC GTCTCTGGCA GGAGGGCTAC ATCCCAGATT     90060
     TACCCGATCA GGTAATTGTT AATGAATACA TCCCTGGTCA GGGCATCACT GCCCACATTG     90120
     ACTGTATTGA CTGCTTCAGC GATACCATCC TTTCCCTCAG CCTGGGATCT GACTGCATCA     90180
     TGCGATTTAC AGCCCCCTCT CACACAACAG AAGATCTGGT GCTGGAAAGA CGTAGCCTGG     90240
     TGGTTCTCCA GGGAGATGCC CGTTATCAAT GGCAACACAG CATACCTGCC CGTAAGTCCG     90300
     ACCTGATTAA GGGACAAAAA CAGGCTCGCA GCCGCCGGAT CTCTTTAACG TTTCGTAAGG     90360
     TTATGGTTTA AGCCAGCCTT AGGTTCTGAC CCGCTAATTC GCATCAAATT CAAGTCCTGC     90420
     CCTCCTTAAG CACCTAAAGT ACGAATGACC ATAATATGCT GGTGAATCCA CAAGGGATAT     90480
     GGACAGGCTA GGATTTATAC ACAACTTAGA AAATTGCAAC TCCAAACTAC TTGAGCTTGA     90540
     TTCGGTCAAG GTTCAGCCGC CCCCTTTGCC TGGAGAACCA TTCATGACGA TCTGCCACCT     90600
     GCTGGTTGGT CCCCCCTCTA GTGGTAAAAC CACCTTTGCC CGCCACTTTC AAGAAATTCT     90660
     TCCAGGTGCC GTTATCATCA ACACCGATCG CATCCGGGCT GAACTTTTTG GGGATGAAGA     90720
     GATTCAGGGG CCCTGGCCAG CGGTGGAAGC GATCGTGGTT GAACGGATTC GATCGGCAGT     90780
     CCAGGCCGGT AAACCAGTCA TCTACGATGC TACGAATGTC CGGCGGTGCT GGCGGATGGG     90840
     CCTGTTAAAA AAGCTGGCCT TACCCGAAGC ACAGTGGGTA GCCTGGGTCT TAAAAACACC     90900
     CCTGGAAACC AGCCTGCAAT GGAACCAACA ACGCGATCGT AAAGTTCCCG AAAAAATTAT     90960
     CCAGGATTAT TATCAGAACC TGAAACAATT TGCTGTTGAA CCAGCAGAAG GTTTTTTGAC     91020
     CACTATTGAG GTTGACCCCT CCAAAACCAC CGACCTGGCC GCAACCCTCC AGCAGGAACT     91080
     CAAAAAAATT GAATCGAGCC ACCGCAATCA CAAAAATCGT TACAAGCACT TTGAACTCCA     91140
     TCGTTACTCC CGCCTGCTCG ACTTCGATCG CCTCATGCAC CTCATTTCTC TCCTCGGCCG     91200
     TTATCCGGGA TTAGGGGAAT TGCATGAACA GGAACCCCTG GAACTACTCA AATTGCTCAA     91260
     TGCCGAACAC CTGCCCACCT TTCTGGAGCC CATTGATGAA ATTGCCGCGA TCATGCAGGC     91320
     ACAGCATGGT TGGATCTATG CCGACCCCGA AGCCCTGGCC AGAGATTTGA TGTGGCTGGA     91380
     AGATAATGGT TTTTTAGGGA AGGAGGTATC AGCTCAGGAG CTACATATCC CACCACTGGA     91440
     AGGAGAACCG GACTTTCTTT GCCACACCTA CAGCGATCGG GATGCCTTCC AACGCTTGAT     91500
     GGGCACAATC CATTACATCA TCAATAATCC CCTCAGCCAG AAATTAGAGA ACGATGACCC     91560
     GAAAAATGAC GAGGATGAAA CTGGGCCCAA CTCTGAAAAG GGGAAGCAAC ACCGCACCAC     91620
     CCTGAAGCAG GTCAACCAGC TAGCAGAACA GCTCCAGAAC GCCAAAATTG TCTTAGTCGA     91680
     TCCGCTGCCG ATGCTGCGTA AGGATATTGA ATGGGTACTG AACCCCTATC GGATATTGCC     91740
     AGACTACAAG CTGCGTAAAG GCTACTTCCT GGGCACTGGC ATTCTGAACC GTACCGACCT     91800
     GCTTTGCATT TATGACATTG CCAGAAAACA TGTCCAGGGC TTAGATGATG TCCAGGCCAA     91860
     AAAAACTGTG GCGGAGTTTG AACAACGGTT GCGCTGGGCC CAGATTGATC CAGGTAAGCA     91920
     CTACCCCGTC CGTTCGATCT CCAGTAGCAG CATCGTCGAT CCCCAATTGC TCGGCAATGA     91980
     AGCCTTTATT ACTGAACACC AATCCAATGA ACTCGAAACA GATATTCGCC AGGGAAACCT     92040
     GGTGCAGATT TGCCGCCGTA AAGGGGTAGC CTCCTATGGC GATCGACCTC CGTCAGAAAA     92100
     TGTCTGGCCC CTCCAGATTC TGTTCCACAA CATTGGCTGG TATCTGGGCT ATGAGGTTGC     92160
     AGACGGGGAA CGGCAAGGGC TCTTTTGCTT TGAACGGCTC GATCGACTGT ATCGCGGTGA     92220
     CGGCCCAACT AAAAAACGTA AAGTTCAGGC ACAATGGCAG GCCCTGGCTC AACTAGAAAC     92280
     CCTTTGTAAA CATAGCTTTG GTATTTTTTT CGGTCACGAT GTCACCCAGC AGAAGTGCTT     92340
     TCTGGCAGCC ACCAGCCGGG AACGCCAAAA GCTGATGGAA CCCCTGCAGT TACGCTTTAC     92400
     GGAGACCCTG TTTAGCTTTG TCAGTGAAGG AACGCAAAAG TTTCCCAGAA CCCAGGTTCA     92460
     AATGACTCCT CCCAAAAACC GGGATATTCA TCATCTGGAC AAGAATACGA GAGAGGGTCT     92520
     CTATGGTTTG AAACTGGATC AAAACTTTCC CAGTCATCCC TACTGTATGA AAATCAAGTT     92580
     GCCCATCTGG TCCTTTGAAG ATGTCACCCT TAAAGCCTGG ATTCTGGGGA TGGGACCGGG     92640
     GGTGAGAGTG GTGGGCCCGG AAAGGTTCAA AACCTGGGTC AGCCATGAAC TTACCGCAGC     92700
     GGCAGAACTT TATCGCTCAA CCTGAACTGA AGTTGTCATT CGCATGGAAT TTAACTACGC     92760
     TTTCCTGGGA TTGAATACAT TGAGATTGTT CCCAGCAATT TCACGAATTT CCCAGGGAGT     92820
     GTACGGCAAT GACGAATGCA GCTCCAGCCC AAGTTCTGGA CCAGTTACGC GGCAATCTTC     92880
     CTCCGCAATC TCTGAACGTT CGTTCACTGG CCCAGTTTTC AGAAATCAGC AATTGTAACG     92940
     TTGCCGGTTT AGGGATGGCA GCGGGTGTAA ACTTCAGCAC CTTACTCAAA GGCACCCCCT     93000
     TTACCCGTAC CTACACCCAA TCTCCCTTTG CCTTTATGCG GGGCAACCAG TTTGAAAAGC     93060
     GGTTGACGGA CAACAATTGC CAAAGCCTGC TTTCGCTCTG TCAGCAACAC CTCAACTTCC     93120
     TACCTCAGGA TAACCAGGTG ATTGATCTGC GGGCCCAATT TCCCAGTAGC TATCAAAGCC     93180
     TCTGGCCCCG GGCCCAACGC ACTCGCCAAT TGGTGCAGCA GATTCTGCAA GGGCAGTCCC     93240
     AAGCCCCCAA CCTGATTATT GGTGCCGTCT TTGCCTATTC CCTGGGGGGT CAAAACGTCT     93300
     ACTTTGAAGC CGATCTGCTG GGAGCCAACC ATCAACAAAT TTTGCGCCCA ATCGAAGTCA     93360
     AATCCTTTCC CATCCTGGAT GAGCGGGCCA TTGATCCCCG CAGCTTAGGG GCAGCCTTTG     93420
     ATCAGGCGGC AGTTTATATC CTCATGGTGC GTGAACTGGT CAGTTCCTTA GGGGGCAACC     93480
     TGTCTCTGGT GCCTGGGGAG GCCGTGTTGA TCAATCCCTT CAATGCCACG TCCCAACCCC     93540
     ATCTGTCCTG TCAGTCCATT ACTCAACGAA TTAACCAGGC CCAGCAACGC CTGAATCAAG     93600
     TCCAGAACCT CTCCCCCATT CTCAGTAACC TGCCTGCCAA CCTTAGCTTT GCCACCATTG     93660
     CCGATCGCCA GCGTCCCATT CAGGACCGTC TCCAGACCCT CGATACCCTC ACTCAGCAGG     93720
     TGGGCACCTG TTATACCCCT TCCTGCCAGC GGGCCTGTGG GTTAGCCAAT TACTGTCGCC     93780
     ATCATGCCCA CAACCAGGGG TTGACTACCG TTTCTGGCCA GGTGGTCCAG CACCAATTAC     93840
     CGGGAGTAAC GACTTTGAAC CGGGCGGCAG CTTTAGCGGG GGGAGCTTTA CCTAACACCC     93900
     AGGAGCAGGC GATTGCATCC CAATTGCAAC GGGCAGAACA GCTTTATAAC CAACTATCGG     93960
     CTTAGGAGGA GGAACCATGA CCCTGTTAGG ATACTTTGCG GCTCGCAGTC ATAGCCTTGG     94020
     CCAAGCGGTC CCCACAGCCA AATACCGCCA TCGTCATCTC TGCCCAAAGC CATTGATGCT     94080
     GGTGGGCTGG ACCCTGGGTT CTGATCCCTT CAGTGTGTCA GCACTCGCCT GGGGACACCA     94140
     TCCTGATGAC TTTCGCTTTG CTGTAGCCGG AGATCCGCGC GACTTTGACC TCGAAGTTGA     94200
     CCTGCTTCGT ACCCTGGCTC AGGACTTTAA TCCGTGGTTT GAGTCATTTA AAGAACGGGG     94260
     AGAAGCCCCT CAGGTGATTG TGGCCAACCG GGCAACGATC GAAGTGCTCT GGCGGCTGGG     94320
     ACGACGGTTT GCCTACCTGG AAGGGCGAAT TGATGACGCT GTGGTTCGCC TGGCCCGTTA     94380
     TCTACAACTG CTCACCCATC ATGCCGACTT TCCCGGCCAG CAACTGATTG TTTCCCTCAC     94440
     CGATCTGATC AATGAGCACT GGGCGATCGA GCTGAGCGGA GAAGAAAGCC AGTCCCTTCC     94500
     CGTGCTGGAT GCCTACCTCA ACCCACCCCC AGGCAGTACC GGTTTTGCTG TTGTTGAATC     94560
     CCTGGAACAA AGCCAGCTAC ATACCATTGG TCCCCATCCC ACCAGCCTGG AGGATGATCC     94620
     GCTGCAAACC CTGCTGGAGC AATTTAAGCA AGTCCGGCAA CAAGCCCCTA CCTCACTGGC     94680
     CCTGGCTCCG ATCGCTGCCC ATTATCGACC CCTACTGGAA CGCACCTGGG AACTGAACTG     94740
     GCGGTGTTTT CACCGGGAAC ATCAGCGACC CCCAGCCCGT TATGTCGATC GCCGCTGGCA     94800
     GGAAGATCTT CGTTACTACC GGCAACAGGC TCAGCATCTG ATGGATGGTG GACGGATGAG     94860
     GACTCGCCCC ACGGTCAAAG CGGCTGCCTC CGACTTGAAC AAGCGGGAAT CGGCCCTGCA     94920
     ACAACTGGTT ACCGAACAGG CGCTGTCCGA TCCCCTGCGG ATGTTACCCC ATCTGCTCAA     94980
     GCATGAAGCG GTACTGGGAC TGGTTGAATC TCTCGACCTC ACGTACATTC CAGCGGGCCA     95040
     AAATAAACGC CAACCTCGGC TGGTGCTGAT TTCCCCCGAG CCCTGCCTGA TCCCAATTGG     95100
     TACCGCACTG TGGTGGACCG AGGCACCTAC GGGTCTTCCC TGGCTTTTGG ATGAAATTCT     95160
     AACCACCGCA CCGGGTCTGC CCCATCGTCT GGTCTTACTG CATCAAAATA ACCAGTCCAC     95220
     ATTTCGCCGT CCCACTCCCG GTCAAACGGC CTGCTTTTCT GTCCTCACCC ACAGGTCTCC     95280
     CTACCAGATG CAGCTTCCCC CACAAACCCC CTGGACCCAC TGCTAAAGGA ATTTTCTGAG     95340
     GTATTTTTAT GACGAACCTA ACTGCCTACA ATCAAACCGC CTATAATCAA ATCGCTTGTC     95400
     AACAAGCCGA TCAGGTGATC CATTCCGTTT GCGGTGCTCT CCTGGGTAGC TTATCCCATC     95460
     AACAAGCCGA TGTTCTCAAG GCTCCTGCAG GTGCAGGCAA GTCCTATGCG GTCTGTACAG     95520
     TGGTGCAACA AATCATGCAA ATGGATGCAC GGGTGGCTGT GGTGACCCCT ACCAATGAAC     95580
     AGGCATTTAG TTTGGTGGCA AACCTTGCCG ATCGCTTACC TGGGCAAAAC ATTGGTTATT     95640
     TACCTGCCAG TAGCGTACAG TTACCTGCCT GGGCCCATCG CCCGAATGTT CGTGTCCTGG     95700
     ATGCTAATCA TGCCAATTCA GTCAATATTC TGGTCGGCAC CTTAAATAAG CTGGGAGATG     95760
     CCCATTGCCG GGGTAAGCTG CAACGTTTTG ATTTGTTGGT GATGGATGAA GCTTATCAGG     95820
     CGGATTCAAT TCGCTATTTT GCGGTGGCAG ACCTGGCCGA TCGCCATTTG TTAGTCGGAG     95880
     ATCCAGGTCA GCTCGATCCA TTTACCACCC TCCCGGACCC CGATCGCTGG CGGGGGTGGC     95940
     AGGAAGATCC ACTCCAAACG GCAGTGGGTG CGCTGCTCCG CTATCATCCC CAAACCCCTG     96000
     TCTATCAATT GCCGATTACC CGTCGTCTCG ATCCCCGGGC CATTTCCCTG GTGCAGTCCT     96060
     TCTATCCGGG GCATCCCTTT CAAGCCGCTG TTCAGACCGG GATTCGATCG CTACAGCTTC     96120
     AGCCTGCCCT TCACTCCACG ATCGTGGATA TGGCTCTGGA TCATGGTTGC CAGCACGGAT     96180
     GGGCTTATTT AGAACTCCCC GCTGCGAATG TTCTGCCCGC CGACCCAGAG ACGATTCAAT     96240
     TAATTTCAAC CCTGGCTGAT CGTCTCCTTC AGCGTCAGCC CACTGTGTTT TGTGAACAGG     96300
     TTCCCCATGG TCGTCCCCTC AGAGCCACGG ATATTGCGAT CGCAGTTTCC CATAATGATC     96360
     AAAAAAATCA TCTCCGCTAT CAGTTACAAT CCCTTGGACT TGCTGATGTT ATTGTGGATA     96420
     CAGCTAATAA ATTACAGGGA CGCACGTTTG AGGTGGTAAT TGCCTGGCAT CCCCTCGCTG     96480
     GTCTGGTGGA AGCTGATAAT TTTCACCTCG AAGCTGGCCG CCTTTGTGTG ATGCTAACCC     96540
     GTCATCGTCA GGCTTGTTTT GTTGTTGGAA GATCAGGCGA TCGTCATTTG CTCTCTGGAC     96600
     CTCCCCCTGC AGCACCAGCT TATTTAAATT ATGATCAAGA ACCATTACTA GATGGTTGGC     96660
     AGCTTCATCA GGCAATTTTT AACCATCTCA TCCCCCACCA AATCATTGTT TAGAAATATA     96720
     TTATACTCAG ACTATGATTA GGTTCACAGA TGCTCTTCGG AAAGTATTCT GGAATTAGAG     96780
     CGTAGACTAT AGAGGTATGT ATCCTTACTT CCTAGGAAAA TCAATTGAAT GGAAATACTT     96840
     TGATGTTCTT GATTGCCCCA CATTTTTTTG TGAAGTATCT ACTTGTTAGG AAAACCAATT     96900
     GAATGGAAAT GTGTCAACCT CAAATGTTCC CCAACCAATA CCGTAGCTTT CCCTACTTGA     96960
     TAGGGACACC AATTGAATGG AAACTGGTGA ACCAGACCAT CATAGTCGTG AGGGAGTTTG     97020
     GTCTCTACTT GTTAGGAAAA CCAATTGAAT GGAAACTAAA GATGCCAGCA GCTATCGCCC     97080
     CGGAACACAT AAAGTCCCTA CTTGTTAGGG AAACCAATTG AGTGGAAACT GGCCTGTGCG     97140
     GGGAACATAA CGGCTGATGG AGTAGACTAG TCCCTACTTG TTAGGGAAAC CAATTGAATG     97200
     GAAACGCCTC CTAAAACCGA TCGCTCGGTA CAAACGTGTA CGTCCCTACT TCTTAGAACT     97260
     TGTTTGAAAA GTCAGAGGAT AGGCTATCTA GCTTGATTTT TGGGTTTTAA TCGACGAACC     97320
     ATCAAATGTA CCATAGCGGC AAAGAGCATC ATTTCACTTG TCGTGGTCAA AAATTCATAG     97380
     TCTTTACTCA AGCGGCGATA ATGCCCAAAC CAGGCATAGG TTCGTTCCAC CACCCATCGT     97440
     TTCGGAATGA CCTGGAAACC CGGCTCAGTC TTTGTGGGTT TGAGATGTTC GAGCGACCAG     97500
     CCAAAGTGCT GAGCGATGGT GGCGATAAAG TTTTTTCCTG CAAAGGTGCT GTCTACCCAA     97560
     ATCACCTTGA GACAAGACCA AAAGGCAGCC CAAAAGGTGG CAAGTAAAAC CATTCCCTGA     97620
     TGGTCAGAGC GTTTGGCACT GTGGACACAC ACACCGAGTA ACAGTCCCAT TGTATCGACC     97680
     AGGATGGTGC GCTTGCGTCC CTTGACTTTC TTGCCGCCAT CAAAGCCGAT GTCCTCCCCT     97740
     CCCCTCGCAG TTTTGACCGA TTGGCTGTCT ACACTCCCGG CACTTGGTTG AGCCTTGCGT     97800
     CCCGCTGCCA CTCTCACTTC GGTGCGTAAT GTCTGATTCA GCCGTTTCCA CGTCCCATCC     97860
     GCTTCCCACG CTCGAAAGTA GGTGTAAATG CTGTGCCAGT TGGGGAAATC ATGGGGCATC     97920
     GACCGCCATT TAATCCCATT GCTGAGCAAG TAAAATATCC CATTCAAGAC TTCACGGATG     97980
     TCGAGGCACC GAGGACGGCC ACCGGGGCGG GGCGGAGGGA TTAAGGGTTT GAGCAGTTCC     98040
     CACTGTTCAT CTGTCAGATC GGTATCGTAA GATTGTCGTA TCATTTGGGG GTCTCGCTGA     98100
     AGACCCTTTT ACTTTATTTC AGCCTTGTGA ACCTCTGAGC GGACAGCTAT CCAACTTTTC     98160
     AAACAGTTTC TTAGGGAAAC CAATTGAATG GAAACATCCG AGACAGCGGC CGCGGCAGCG     98220
     GGTTAGGCTC TCGTCCCTAC TTGTTAGGGA AACCAATTGA ATGAAAACTC GGAGGAGTCT     98280
     TCGTCCCGAT CACCGAACAT GACAGTCCCT ACTTGTTAGG GAAACCAATT GAATGGAAAC     98340
     TACAGGTACC AGCGGTCCAT GTTGATCGGG TTCTTCGGTC CCTACTTGTT AGGGAAACCA     98400
     ATTGAATGGA AACAGCCAGA AGTGGGCAAG TGCCTCAATC CGCTTCAGGT GTCTCTACTT     98460
     GTTAGGGAAA TCAATTGAAT AGAAACTGGG CGATCGCTTC AATCTGCTCC TCTAGTTCTG     98520
     CAGTCCCTAC TTGTTAGGGA AATCAATTGA ATGGAAACGG TAAAATACTC GCCATGAAAA     98580
     GAATAGGATA TGCCAGGGTC CCTACTTGTT AGGGAAATCA ATTGAATGGA AACGTTATGT     98640
     AGCCATGAGC GATCATGTAG TTTACGCTAT AGTCTCTACT TGTTAGGGAA ACTAATTGAA     98700
     TGGAAACATC GCGGCCTCGT TTTCTGTTCC ACGCCGGGCC ATCTCCAAGT CCCTACTTGT     98760
     TAGGGAAATC AATTGAATGG AAACCGGTAC TTGCCTTCGC TGGACTCCTC GATGATGTCG     98820
     TCCCTACTTG TTAGGGAAAT CAACTGAATG GAAACGATCA TGGGTCCGCC CAGGCACACA     98880
     TAGAAATGGT CATCGAGTCC CTACTTGTTA GGGAAATCAA TTGAATGGAA ACGCCTGGAG     98940
     GATCTGGGCC TGGGATTCCC CATCGTAAGT CCCTACTTGT TAGGGAAATC AATTGAATAG     99000
     AAACTCTTTT GTCACTTCAA ACAGTTTCTC CATCAGTCCT AGCAGTCCCT ACTTGTTAGG     99060
     GAAACCAATT GAATGGAAAC GAGTCCTGCC GATAGCATTG ACCCCAGAAG CCATCACCCG     99120
     TCCCTACTTG TTAGGGAAAC CAATTGAATG GACATCCCCC GTTAACCTGA AAATTCCAGT     99180
     CAGGGGACAT TGCCTTGCTC TATATATCAG ATAAAATAAT AATTTCTTTC TTGCCTCTAT     99240
     CATCGATGCT AACTACTATT GGTACTTGAG CATAGAAGTA AATTTTATTT ACAAGAGAAT     99300
     GATTATGGCT AAGAGTTTTC GGATTGCCAC TTTCAATGTC GAGAATCTAC TCCATCCGGG     99360
     TGTGTTTTTT GCTGGTCGTC CTAATGATCG ACCGTATCAG CCAGAATTAT ACAAGGAAAA     99420
     AATTGACTGG ATTGTTCGCA TTCTCAAAGA AGGTAATGTT GACCTGGTTG GTCTTCAGGA     99480
     ACTCTTTAGC GAAACGGCCC TCAAAGACAT TGCCGAGCAG GCTGGGTTTC CCCACAGCTA     99540
     TGCGCCAGAC CTCTTGAATG GGGCGAACAT CGCGACCAGA GAGGATGGAA AACAAGAAGC     99600
     CAGGGGTCCA TTTGTTGGTT TGCTTTCCAA GTTTCCCATC GTCGACCGGA AGAGCATTGT     99660
     AGATTTTCCG GGAGAAACGA AAGGAATTGA GATTGAAGCC GGGGAATCGA CAACGGAAGT     99720
     CAAAAAACTA CCCATTATCC GGTTTCTGCG CCCAGTCATT CAAGCTAATG TGCAGCTCAA     99780
     TAGCGATGTC ATAGCTACGG TCTTCGTTGC CCACTTAAAA TCAAAAAATC CCCAATTTTT     99840
     AGACAGCGAA GATGGTAGAA GAAACGATCC AATTGTTAAA GCCGCCGGTA AAACCCGTTC     99900
     GCTAATTATC CGGGCTGCTG AATCCGTAGC CCTGCGTAAA ATGGTGGTCG ATGCTACGCA     99960
     AAACAACAAC CAGCCTGTAC TCTTATTTGG CGACTTGAAC GACGATCTGC CAGCGGTGAC    100020
     AACCGAAATT ATTGTTGGGG ACGAACCCTA TCGCTTTGCC AAACCTGAAG ACAAAAAGAT    100080
     CGAGTGGGAC CGATTGCTCT ATAGCGTTCA CGATCTGGAA GAGCAGGAAA GCTACCGCAA    100140
     TGTTAGCTAC ACGCACATCT TTAATGGGCG TTATGAACTC CTCGACCATA TCTTTGTCAG    100200
     CCAGGAGTTT TTCCATCGCA ACCCGGAAAG TATTGCCGTT GTCCGTAGCA CCCGCATATT    100260
     CAATGACCAT CTTCAGGATG AGCGTCGGGT TGTTAACCCC GATCGCGGTC TTTCAAGCCG    100320
     CAGTGACCAT GGTATCCCCG TGACCGAAAT TGAATGGCGA TGACAGTAAA CTCCTTTCTT    100380
     ATCCCTACTT GTTAGGGAAA CTAATTGAAT GGAAACTTGT TAAGCATAAT GTCATAACAT    100440
     GGTTTGTGAA TCTCACATCT CTACTTGTTA GGGAAACTTC GGCAATGGGA ACTCCTGGCA    100500
     GGCTGGTAGT GCGATATCTT CTCAAACTCC TGGGCTACAT CTGGACACCT CGATTAATTG    100560
     CCTTATTGCG AAAATCAACC ACGGTATATC AAGCCATTCT CAATAAGCCA CCCTATTTTT    100620
     CGAGGTGCCC TTCTATAAAT CAATCAGTTA TGGGCATTCT GGGTTTGGAT AACCTTTTCC    100680
     CTGTCAGGAG ATTCCTTCAA TGAGTATGAT TTGCTGCCTC TATTCGATCG CCGCCTCTAC    100740
     CGCGAATGAA TTACTGAATG ATCCTGAGCA GATGGAAGTC CTTCTTGATC AGATGGAAGA    100800
     AGATAATTCA GATTTAATCT TGTCTCTAGA AAAAAGCTGG CATGGCCTGC ATTACGTTCT    100860
     CACAGGTTCA GCCGAAGATG GAGAAGCGCC CCTCAACTTT ATCTTGCACG GTCGCGAAGT    100920
     TGGCGAAGAT TTGGGTTAAG GTCCACCCCG TCTTTTTTTG CCAGAGGAAG TCCAACAGAT    100980
     TGACAATATC TTAACTGCCT GGACAGAAAC TGATTTCCTG CAGCGCTTTG ATCCAGTCAC    101040
     GATGGATAGG GCTGAACTTT ATCCCGGTAT CTGGGATGAA CCTGTTGATG AGTTACAGGA    101100
     GGAGTATTTA GCCTATTTTA AGGAGATGAA AGATTTTATC CAGCAGGCTG CTAAACAGCA    101160
     ACAGGCGATC GTCGTCACCA TTGTCTAAAA ATCAGTTCAA TTCCGCCTGT CTGGCCACCT    101220
     GTCTGGTGAG TTGCAGATTC TCGATGAGCT GATCCGCCTG ATCCTCATAA TCCTCTGCCA    101280
     TTGCTTCAAG CTCATCCCCG ATCGCCAGCA ATTCCGAACT AATTTCTTCT ATTTCACTAA    101340
     CTTTTTCACT ATACGCTTTT GTCACCCCAT CAATTTCAGC AAAAAGTTCC TTATATTCAT    101400
     CCGGGGGATT TGCCAACCAG TCTTGGAACT CCTGTTGATG TTTTTCGATG ATGACAATCG    101460
     CAGCCTCCCA GGAAGACTTT CGGCGCATAT CTAGAGCACG GATATCCTCA TATTTATCTT    101520
     TCAACTGCCG CACATTGCTC GTCCCAGATA AAGCATAAGC TTTTGATTTT AGTTCATCAA    101580
     GTTTCATAAT CTAAAAATCT ATTTAATTGA CTTTTGCTTT AGCTTCTCAA CTTGCTGTCG    101640
     GAGCTTCTCA TTTTCAGCTT TGAGCTTAAC ATTCTCCTTC TCTAACGTAG CAATTTGTTT    101700
     GGATTGTTCT TTAACCGTTG CTCTGGCTAG ATCCCGTTGC TCCTGAAACC GCATTGTATG    101760
     GGCTACTCTT CCACCTAAAC TCTGATTCTT TTTAGCTAGC TTTTCCCGAT GCTTTTGTAA    101820
     ATCTGCATAC TTTTTCTCCA GCTCACCGAA TTCCTTTAAA AGTTCGGTAT ATGCATTTGC    101880
     TTTATCAGCG TCAGCTCGGA GCGCCTCATT TTCTGCCTCC ACAAGAGCTA TACGAGTTTC    101940
     AAGCTCCTTA ATAACTTTAC CATTGCCAAA TAGCTTTTCC TGCAACTCCT TGATGAGTTT    102000
     TAATAGCTTA GACCTTTGCT GATTAATCTC CTCTTTTTCA GTTTTATATT GATTAGATTT    102060
     TTCTTTTAAA TAACTAGCCT TTTCTCGAAA ATATCCTGCA CGAACTTGTA ATACTCGAGC    102120
     TGTACATTGA TATTTAATGA TTACAATAAC CTTATCCTTT TCTTCAGCTT CCAGAGCTTG    102180
     GACTTCCTGA CTGAATCGAA GCTGATCATA GTTTGTGCAT TCGTGGCGAA GTTGTTGGGT    102240
     AGGAAGATGT TCTGCAGACT TAACCAGTTC TATATTAAAT ATTTCGACTT TATTAAACCA    102300
     GTAGTCAAAT AAATCCTTGT TGTTTCCCAT CTTTCTGCCG TTTATACGCT CCTATTGGTT    102360
     CATGTTTCAG GTAGTGGCAT CTGCTGTTAC AGCGTAATTA ACTTTCTCCT TTGCAGAACT    102420
     GCTAATCTTC AGATATTTAT TTAGGTTGCC CAGCTCCTAC CCGGTCGATC GCATTTGTAT    102480
     CAATACTTGC TGATTATCCT TTATCACTAA AGCCATAGAC TCACCTCAAT CTTGAAAAAA    102540
     CCTGTATCCG TCCTCAGTAC AGGACAGAAT ACTTGAAAAG GAGGCAGAGG TAGGGTTTCA    102600
     TCAAAAATGT AACCTCTCAA TGAAACCCTA TGAACCAGCA TAAACGACTC GTTGCTCTTC    102660
     TGAAGCCGCA TCTGGGGTGG CATGGCGCTC GGTTAAACTT TCTCGCTCTG TTTCTACTAG    102720
     CCCTGGTGCG GGTGAAGACG GTCAATCTGA GTGCGTTGGC AGTGGGGTTG AGTGGGCAGG    102780
     TGGAGAAAGA CTCGAACTAC AAGCGGTTGC AACGGTTCTT CCGGCTGTTT GAGATGGACT    102840
     ATACCGTCGT GGCTCACGCG GTGGTGGCCT TGATGCGGAT TCCGCAGCCC TGGGTGTTGA    102900
     GTTTAGACCG GACGGAATGG GAATTCGGCT CCCATCACTA CAACATTTTG ATGCTGGGAA    102960
     TTGTGCATGA AGGGGTTGCC TTCCCCGTGG TTTGGACGAT GCTGGACAAG CAAGGGAATT    103020
     CCAATACGGA AGAGCGCATT GATTTGTTGG AGCGGTTGAC GCGGATTTTC CCCCACGCCG    103080
     AGATTACCTA CCTGACGGGC GACCGGGAGT TTATTGGTCA GGTCTGGGTG AGTTATTTAC    103140
     GCTTATCCCC TGCGGTGCCG TTCCGCTTAC GTCTGCGGTG CAGTGACCGG ATTGCCCGGG    103200
     AGGCAGAAAG CCTCAAAGCC AGCGTCCTGT TTGCTCATCT CCCAGTGGGA GAGTCTCAGG    103260
     TGCTCAAGGG GCGGTGCCGG GTCTGGGGGT ATGAGGTCGG CGTTGCGGCG TTGCGTCTCC    103320
     AAGATGGCGA ACTGCTAGTG GTGATTGGAC CTCAAGCTCA GGAGGAATCA CTGATTGCCG    103380
     ATTATGCAGC GCGGTGGGGC ATTGAAACCT TATTTGGAAT TCTGAAAACC CGGGGCTTTT    103440
     GTCTAGAATC GACTCACTTT ACCGAAGCGC AGCGCTTGAG TAAACTGCTG GCCCTGTTAG    103500
     CTTTAGCCTT ATGTTGGACC ATGCTGACCG GGCTGTGGCT CCATCAACAC AAACCGTTAT    103560
     CAATCAAAAA ACATGATCGT CGAGCGAAAA GCCTTTTTCG TTATGGCTTT GACCATCTTC    103620
     GCCACATTAT TCTCCATCTA GATAGCCAAA CCTCGCAATT CTTTGAGGTT CTACAACTTC    103680
     TGTCCTGTAC TTAGGTATCC GTCAATCAAC CCACAACAAA CCATGATTTG ACCAACGACA    103740
     ACCCTGGCGA CACCTCTTCC ATGTCCCAAC CGACAACCAC AATCCAGAAG AGCTAAGCTA    103800
     TGGGGGATCT GCAAAGCGCA GGCGACCGAT ACAGGCTGCG GCTGTCAACA GCAGGGCTAT    103860
     CAACTTTAGG CAAAGCCAGG GCACACCACG GCACCCATCG GTTCAACTTC CCCCTCCCAC    103920
     GAGTTCTAAA GCGGCTGCAC TCAACTCAAT CTCCAGCGTT TCCCTGTTAT TCAGGTTGGC    103980
     AATCTCATCC TCCGATCGAT CCTCGCTGTT AAGTCCTGCA TTTGCTGGCC AATTTCCTCG    104040
     ATCCCAACGA CCTGGATCGC CAATTCCGTG ATCCCATCCA TGTGCTTCAA ATCTTCCCGC    104100
     AGTTGTTCTG GGTCAATATC CTCCACTCGC AAAGGAACCG TTGACCCGCT GCTAAAAGAT    104160
     CCACGAATAC TCTGGTAAAG GTTGAGTAAT TCCCGGCATT TTTCGACCTC ACTCAGCCGC    104220
     TGAGACACCC CAGATCGCTG ATTAGCTGCA AATAAAGCTT CCTTCAAAAG ATAATAGTCC    104280
     TCACAAATCT GGATGCGCTG GTCTAAGCTT TGCTGGCGGC GTTGTTGCTG ATCTTCCAGA    104340
     GTCGCTTTCA GATTATTGTT ACAGTCACTC AACCGCACCT CTAATTTAAA TGTGGTCTGG    104400
     GTAGCCAGGT AATCGATGTG CCGTAGCGTT CGTCGATTTT TCAATTGTTG TAATAGCCGA    104460
     TTGGCCTTGT TTAGCGTCAT CCTCATAGGT CTCCATCCCA ATCATCCAGA TCAAAGTCTT    104520
     CAATTTTTGT TAACCGTAAA TTACTTTTTC GGGTCTCTAA CCGTTCGTTA TCCCTGTACC    104580
     GCTGCTCAAA ATAGGACTCG ATCGCGTACA CCCACCTGGG CTTAAAACGT CCTTTTGGGA    104640
     GCGATCGCAG TAATAGCCAA TCCGGTTCAA AGCTAAGGGG CAGGTCCGGC CATTGTTGCA    104700
     GCACCCCCTG AATCGCAGCC TCGGGACTTC TTAGCCAGTA GGCATATAAC ACCAGAGCCA    104760
     GGGTGGCCGC ACAGATTCCT TGATCGCAAC TGTAAATGGC AAAACCAGAA TCATAGCCAT    104820
     AACGATTAAT CCTGTTCTCA ATAAATTGCA AGCATTCACA CACCCGCTCC TTGGGGGCAA    104880
     CCGTCTGCCA GTACCAGGAG AACGGACAGT ACTCAATCCC AAACCACCGA TCGCAAGACC    104940
     AGCGTTGCCA GTGCTCGATC GGAAGTGGAA CCTGAGTAGG ATGCCTATCA CAGGTAATCG    105000
     TGATCAGCGC AACCGCCTCC TGTAACACCC GATTCGTGTT CTGTTCCCTA CAGATCAGAA    105060
     AAACTGGCAT GGGTAGTGGC TCACCTCGTC AACCATTTAT CCCGGTCAGC TCACCAACTT    105120
     TATGCAACGA GTTTGAGAAT CAACTTTAAC CACCCGCCTA TCCACCATGT CGGTCAGATC    105180
     CCGGAAGTCA TCCGCAGCCC TGATCAGATC CTGACTGGTT CTAGAGCGGA AACTAATTAC    105240
     CTCCACCCGC GCCCCCTTTT GACGAGCAGC CCTCACCGCA CAGGCCAGGT CCCCATCCCC    105300
     ACTCAGCAGC AGGATATCAG AGTAGCGTTC CGCGAGTTTG ACCATTTCCA GAGCCAGCTC    105360
     CACATCCAGA TTGGCCTTTT CCTTCCCATC CTCATGGCGC ACCACCCGCT TCGTCACCAC    105420
     CTGATAGCCC TGTTGCCGGA GTGATGCCAG AAACCGCTGC TGCCTGAAAT CTCCAGACTT    105480
     AAGACCGGTA TAGAACCAGA CCTGAGAACT TTCAAATCCC GCCTGCAAGC CTGGAATCAA    105540
     CTGATCATAG TTAACCTTTA CCCCCAGCTC ATTGCCGCAG TGGTAAATAT TAGCAGCATC    105600
     CACCAGAATA GCCAGATGAT TGTTCTGCCG AGTTTGATCC ACTCTCATTG TCTTAACAGA    105660
     CCCACCGCCC CCCTTGCCCT CGTTAGAGTG TTGCTTTAAA CCAGCCACCG TCTCAGCCAT    105720
     TGCCTGGAGC CTTAACTTCA TCTGGGCCAG CTCCTGCCGT TGACCCTCCA GTTCAACTAA    105780
     CTCCAGTTGC TTATACTTTT TCTGCAGCTT ATGGATTTGT TGCGTGACGG GCAGCAGATG    105840
     TTGCCGAGTG AGGGGGCTGG CTTGGATCTG AGCTGGCTTA GCGATCTCCT CCTGGAGAGC    105900
     GACGATAGAC TCCTGCAGAT CCTGCATTTC TTCGCCCATC TGGCCCGCAA CCTGCTGATG    105960
     AGCCCCCAGC GTCCGTTCAA TCCGTTCCTC CGATCGCCTG CGGTTTGCCT CAGCCATGAG    106020
     TACCGATAAA CCCAACGGCA CAGAGCTGTA GAGAGCTTGC TGAAATACAC TTCCCGCAAC    106080
     TACCCCCACG ATCGCCGTTG CCACAACCCA CCCCTGCTGC ACCTGCAATC CCTTAGACTT    106140
     AGACTTGAGA GTGAGGTTAT CCTGTTGACC AGCCATAATT TCCTCTCCTT CCACCCAACA    106200
     AGCCCCAATT TAAGCTAAGG AAAGGTTTGT TTTAAGAGCT TTTATGCGAA TAACAAAGGA    106260
     CGGCTTTTAA GCCCCCAGCT TGTGCCCGAT CCAGACCACC CGCCCCAGCA CCGCAAAATC    106320
     CGTAGACTCA TCTGCCAGGT TGACTAAAAA TGGGTCATAA GCGGGATCGT CAGAGGTTAC    106380
     CCGAATGATG CCTTTTGGTT GCCGTTGTAA TCGCTTTACC ATCAACACCC CATCAAACCG    106440
     CAGCACATAA ATGCCATCGC GGATCTGATC CAGGCGGGAA CTGATCAGCA GGGGGTCGTG    106500
     TTAGACCAAG CCAGGCAATC ACTCACCCGC TTCATCACCA CCTGATAGCT CTGGGTGCTC    106560
     AGCTAGCAGT GACATTATCA CTATCAGGGA TATAAATCAG AACATCCCCG GGTTGAACTC    106620
     CGTAAGCCCT ACAAATGCCT TCAAGCACGT TTTCTCTGGG GATATAGCTA GGATCTTTTA    106680
     CCAGTCGATA AGCAACATCA CGACTGCACC CTACATCCTT CCAGAACCTA TAAGGCGTTA    106740
     TACCCCTACT GGTAACAAGT TCTTTTACTC GGTTTTGCAT TGGCATACCT CAATATTACA    106800
     TCTATAGACA TCATGGCATT TAGACTAGTA TTCATTGTTT ACTCTTATTC ATAGTATACT    106860
     TGACATATTT GATATTCCTA GTCTACTATG AATATGCAAA GAGAGAGCGA TCGCCGACCA    106920
     AAGCTTACCG CTCTCCCAAG TGCCGAAAAC AAAAGTCAAC ACTCAAGGAG AATTCTAACA    106980
     ATGTCTACCC CTATCAACCT CGACAACTGT GCCGCTGACC TGGAAAACCT GGCTTACGAG    107040
     ATTTGCCAAT ACTTGCAGAT GAAAGATATC TGCGATGAAC AGGAGCAGGT CAACCGGCAG    107100
     TTTGCTATCG TCCTCCGTAA CCTCAAGAAC ACCAGCATCA TCTATACCGA TGTGGTGGCT    107160
     CAGGCAATGG CAGCTAAGCC TGTTTTGCCC ATCGTGGCTT AGTGAGAGAA AGAATGGGAG    107220
     TCTTGGCTTA CTGCTGGGAC TCCCCCAGAG GTAATAACAA TGGACGATGA GGTTTGAGAT    107280
     TTCTATTTAC CATGCATCCA AAATGCAATT CAGTCTGCCC TGTGCCTATG GTTTACTCAA    107340
     CGCCATCACG CGCACAGCTC AGGATGTGTC CTCCTACGAT CGCGCCACGG AACTGGAGGC    107400
     GATCGGGAGT AAAGTTCTGT CCCTCCCTCA ATCCGTTTGG CATGAAATCG CTCTAGCCCG    107460
     GTAACTATCC TCAAGCCTCG GCCCTGACAA CTGCTAGGGC TTGAAACACA ATCATTTATT    107520
     CTCCTTTTGC ATAAGGTCAC ATTAATGGAC AACGAAGTCT ACGATCTACA CTTGCCTAAC    107580
     TGTTGGAATG CGGTTCAATC TGCTCTCTAT CAGCTTCAGC AAGGCAATCC TGACCGCGCT    107640
     AAAGTCTTCC TTGAAGCGGC ACAACGCTCC CTGATCAAGG TACGGGAGAG AGCACCTCGA    107700
     TAAAGAGGGG TTATCCGAAG CTCAGTTCAG CCCTCCTTCC CCTCAGTCCG ATTTCAACCT    107760
     GAGAAAGGGA GGAAGGAAGG ATCTCCGCAG TCCCCTGTTG GGACGGACAG CAACTCGCGA    107820
     AACAGCCAGG CGGTTAAGTT TAGTCGTCTT TTCAACCACC CTTCTGAATC GGAGGTCCGG    107880
     CCGGAGTGGA CCCTTTTTAG AAGAAAGACT TCGGCTGACG AAAGCGCATC CCCTGGCAAA    107940
     GAAAATTAGA GTGATGACAG ACGGCTCCTT CCGGGATATT CGCCCCGGCA ATCAGCCCTA    108000
     AACCCAGACC AATAAAAAAC ACACTAGCCA CAACCGCGAT CGACCCCAGG ATCAGTAGAG    108060
     CTTCCAACCG AAGTAAGCGA CGCTGGCGCA ATTGCTCCTC AAACACCTGC TGTCGGCTTT    108120
     CCTGCTCCCG CCGCGCCTGT GCCAACGTCT CCTGATAGGT TTTTTGTTGC TGCTGGCGAA    108180
     ACTCCTGCAA CCGTTTCTCT TCTTTGACCA ACAGCACTTC AAGTTGCTGA TAGACGAGGA    108240
     CATTCAGGAA GGTGATTTCG TTGCGGAGGT GTTCCGGGAC TTTCCCGCTG CCATGGCCTG    108300
     ACGAACGGCT TCCAGAAACT GAGGATCTTG CAGCCCTTTG GCAATATGGT CTTGATAACT    108360
     GGCGGTCACA AAACCCACCA CCCCCTCGGT CAGGTGTTGC TCATTTGTAT TCGTGGTTTG    108420
     AGCAATTAGT TGCGGGAGCT GCTTTAAGGT CAATTGAGCT GCTTCAGCAG AAATGCTATC    108480
     CAGCCCTGCC TTTACGCCCT GGGGAACGTC CTGACCTAAG GTCGCAATTG CAGCCTGATT    108540
     CGTCTGGGCT AAGGCTGCCT CCGTGGGACT GGGGGAAGGG GCCGCTTTCG TACCCTGGGT    108600
     CTTATGGGTC TTGGCTTCCT CATGAAGGGA CTGCACCGCT TGATCCAGGG GCATCCCCGA    108660
     TTTGAGCATC GTACAAACTT TCTCGAACCC CTTCAGTTGC TCTTCGGAGG GAACTTCCGC    108720
     AGTCTTGATT TTGATCCGCT CCAGGATCGG CCCAATCTGC TCCTCAGACA CCGAAAAGCG    108780
     GTGGGCAATG TCCTTGAAAC TTTGATGAAT ATTGGTGGTG GACATCTCTA AAGCCTCTCA    108840
     TTTTCCAGAT CGAGCATTTC ATCCTCTTCG ATCCAATTCC CCTTGGCCAG GGAGGGAACC    108900
     GGTTTGAGGT GGTTCTCTGG GGGAGCAGCG GGCGATCGAC CGAACTGAGG ATCATCCACT    108960
     GTATTTACCT GGCAGCGTCC CTGGGCGAGG GCCATAAAAA TTTCAAATTG GGACCGGGAG    109020
     ATAGCGATCG CACTTTCAAC CTCCGCGGCG GATCCTCCCG TCAAAGCGAT GCCCAAGGGA    109080
     CCAAATAAGC AACTGTAAGC CGTCTGGCAG GCGGTTAACG GACTCACTTC GCCTGAGAAA    109140
     AGATAACTTT CTGCGGCAGC GATCGTGTGG TGGGGGTGGG GCGGGTGGTG CTGAACAACT    109200
     CGAAAGCTCT TCGGTATTTT ACGAGGCTTA GCCATGGGTC CCTCCTTCGA TCACGTCCAC    109260
     TGCCTTGACT GCATATCGTT CTACCCCTGG CAGCGATCGG GCATAGGCAT AGGGATCGGC    109320
     AAAGCGGTAC AGTAAAGCTT CATTCTCCTC ATCCACATTG AAACGATTGC GAAACTCCTG    109380
     GTGGAGGTCC TCACACCAGT GCAGCTGCAC CCGGAATGTT TTATGGAACA GTTGGTTCAA    109440
     TTCTTCTGAG AAGTAGTGGG CTGCACCCCC GGATACCGGC ACCACCTGCC CCTCTTGCCA    109500
     AGACAACGTG TTGAACTGCG ATCTCCGCTC CATCCAATAC TGAGCCTGAG CCTGCCGAAT    109560
     TGCCTGCTGG AGTTGTTCCA GTTCAGCCGC CGTACGGGTC TGGGTGAGCT CCAGTAGGGG    109620
     TTTGGGCTTG AGCTTTCGCC CGGAGAGGCT GAGGGCTTGA GCAGCCAGCA ATTCATGGGT    109680
     CATCGGGAAA CGAATTGAAC GGATAAAATC GTGCATCCCT GTTTCCGGCA AGGTGCGAGA    109740
     GAGCTTGGTG TTGAGCTTGC CGCCGTTGAA GCAGAGCCAG GTGGAGTCCC GATGACCGAC    109800
     CAGCAACACC CGTTCCGCTC CATAGGCCCG AAACAACCCA TAGCCTTCTG GTTTGCAATC    109860
     AAAGGAGGAG AGGGAGAGAT TACGGAGAGA CACCCCATTG AACTGAAAAT CCCCGATCGT    109920
     CTGCCGTAGC CAGCGGGACA GCAGGTGCCG ATCGTCCAAT TCGTTCAGGG GCAGCAAAAC    109980
     ACCCAGATGC AGCGCGATCC GATCAGTGGT CTGTAATTCT TGAGTGACCA AATAACCGAG    110040
     TAAGCCCAGG ACTTTCGCTA GGCAGGACTC AAACTTGCGG CACTCCACGG GTAATAACCC    110100
     CGGTCGGGCT GCCGTTTCTC CCAACTCCCA GAAGACCCGC TCCCCCGATT CAGGATGAGC    110160
     AAAGGAAATA AAGGTTGCCG CTAAGCCTCC CTGACGATCG TCCATCTCCT CCAGGGCTTC    110220
     GTTATAACTG GAAGCCGTTA AGGCCCGCAC ATGCGGTGCA ACTAGAAAAA ATCGCTCCAG    110280
     GGTTCTGAAG GGGTATTCGG GAGATTCACC AAAGAAACAG GACTTGGTTC CACTGGTGCC    110340
     GACATCAACC GCCCCTGTCC AGGTCAAGAC ATTCGCGGTA ACTCCATGCC CCCTGCCGCG    110400
     ATCGAGCCGC TCTACCGGCT CCTCGATGAG CAATCCATTG GCGTCCGACA TCTGACCCTC    110460
     CTATGTATCT GACTTCAGAT AGCCTTTCCA CCCGAGAAGC GCACACACCC AAGTTGCGAT    110520
     CGCTCAGCCA TTTACAAAAA TTCACAATGC AAGCAGATGT TAAAAGTGCT GATTTCGAGC    110580
     TGAGCAGGAG CGTATTTCAC TCAAAATCTG CAGAGAGTTG CCCAACTTTT TTTCATTCAG    110640
     TCAATTAAAG ATTAGATTTT GCACGCATCT CAACCGTGAT GCTCAGGAGC CAGATGGGGT    110700
     AAGGATTTTA AGGATTTGAG GGTGGTATTT TGAAGAAGGT TCGCCGGCCA CACCCATCGC    110760
     CACGGCGTGG CAGCACAGGA AAAGTGGAGC CGAACCCGTT TTTCGACCCT TTTGAATTAT    110820
     ATTGCAACTT TTTGTAGTAC GCGGGGCGCA GCGCCAGGTT CAGGGGTTTC TCCTAGTTCA    110880
     GTTAAAAAGC AAGGGGGTGG GAAGCAGGGT GAGAAGTCTC CACACAATTA CGTCAGGTCA    110940
     TCAAGAAAAA GAAGACTATT ACACCCAGGA TGAATCGCTC TGCGATGGGC AAGCGGATTA    111000
     CTACGGTCAG TCAGCCCAGT CAACCACGGA GTCTTCTGTT CAATCCCTTA CTCAAGCCCT    111060
     CTGGTACGGC AAAGGTGCAG CTCGTCTGGG ATTGGTCGGG ATCGTCCAGC GGCAGGACTT    111120
     CCAGTCCGTG TTTTATGGCG ACCAACCGGG CGGCCAGGAA CGAATTCGGG GTGAGCGCCC    111180
     TAACCCAGAC ACAAAGGAAC GGTTGGCTCA CGACCTCACC CTCTCAGCCC CTAAATCCGT    111240
     TTCCATGACC CTGCACCTGG GTGGAGACGA ACGGCTTTTT CAAGCTCATT TAGAAGCCGT    111300
     TCAGGAAACC TTAGACCTGG TGGAATCAAG GTATGCCCAG ACTCGAGTTC AGATCGACGG    111360
     TGAACGTCGA GTGATGCGGA CGGGTCATCT CATTGCCGCG ATCCTCCCCC ACCACACTTC    111420
     TCGAGAAGGA GACCTGCAAC TCCACTGCCA CTGTGTGCTC ATGAACGGAA CGTTCTGCCC    111480
     GGATGGGAAC TGGCGATCGC TTTGGCACGA GGGGATGGTG AATGCCGAAT GGTTGGGCAG    111540
     TTACTACCGG CTGCGTCTGG CCCAAAAGGT GCAAGACCTC GGATACGCCA TTGATGAAAC    111600
     CCGACTGGAG CAGGGGGGAG CATTTGAGAT TCAGGGATAT AGTCGGGAGG CGATCGAAGC    111660
     ATTCAGTAAG CGATCCAGGC AGATTGTGGC GTATCTGGAA CAGCACAGAC AATGCGTTAA    111720
     TTCGGCCACG CGAGATGGAG CCGTTCTGAC AACCCGCAAA GCAAAACAGA TGGAAGGAAC    111780
     CCTGGAGGAC TATCAGGCTC GCTGGCGGCT TGAAGCGAAC GTTTTGGGAA TTAATGCTGT    111840
     CCTCCCTCAA GCCCAACCTG TAACGCTCTA TGGCTATGGG ACCGCCCGGG AGGAATTGGC    111900
     CAGCGCCATT CGACACTTGT CAGAACGATC CGTCAGCTTC AGCCGGGAAG ACCTTTATAG    111960
     CTCTGTCTTT GACCGCATTC AGGCTTTTGA CATTGCTCAG CTAGACGCAG TGATCGCTGA    112020
     GCAGAAAGAC CTGATTCCGG TTCAGGGCGG ACGCTTTACC ACAGTTACTG CCCTGGAGCG    112080
     AGAAATTACG ACCCTTCGGG ACTGGATGCA GGGACAAGGA AAGACCACTC CCCTGATGGA    112140
     CGAAACCACT GCCCAGGCAT TACTTGAGCG GTCGGCTCTG AATTCTGGAC AGGCCACCGC    112200
     GATCGCCGGA ATCGTCAGCG CAGGGGATCA GCACCTGATC CTGCACGGCT TATCGGGCGT    112260
     TGGTAAAACA ACTGCACTGC GAGAATTGAA GCGGTTGATC CAGGAATCGG ATTCAAAACC    112320
     GGACATCAGG GGGTATAGCC CGACGATCGC TGCTGCTGCA ACCCTTGCCC AGTCACTCCA    112380
     GATCTCAACC AGCACTGTTG AAAGTCTGGT GCTCAAACCT CCTGAACCCC TGGCTGATCA    112440
     ACTCTGGATC ATTGACGAAG CTGGCATGAT CAGTGCCCGG CAGATGGCCA TCATTCTGAA    112500
     GAAAGCCAAT GCTGTTGGGG CAAGGCTGCT CCTGGTGGGC GATCCTCGAC AGAACCCTGC    112560
     CATTGAAGCT GGGAGTCCGA TGCGGAGCTT AATTCAGCAC GGGGCCACGA CGTTTAGCCT    112620
     TCGGGAGATT ATCCGCCAGC AAAATGCTGT CCAGCGACGG GCCGTCGAAC TGATGGCTAC    112680
     AGGACATCCG GTCCATGCGC TCAGTCTGCT CACTGAACAC GGGTATGTGC AGGAGATCAG    112740
     CGATCCCCAA GCACGGAGTC AGGCGATCGC CCACCAGTGG TTAACCCTTT CAGATAGTGA    112800
     GCGGCAAAAC ACGCTCATTG TCACAGGCAC AAACGCGGAA CGACGGGCAA TCCATCAGCA    112860
     GTTGCGGCGG GGACTGCGGG ATGAGGAAGG ACTGGGGGAG GATCAGCTGT TCCGCCAACT    112920
     GATTAACCGC CAGTTGACCA CCGAGCAGAA ATTGCGGTGG GAGAACTATC GGGTTGGAGA    112980
     TTATATCCGG TTGCACCGGA ACTATGAAAG TACGCTCCTG GGGAAAGGTC GCCTCTATCA    113040
     AGTCGTTGGA ATACGGGACA GGCAGTTACT GGTTGAAAGT GAAGGTGGCC GGCTCCTCTG    113100
     GTTTGACCCA GCCCGGTATC GAGATAAGGA GGTGTTTAAG ACCGGTGAAA TCGCGATCGC    113160
     CCCTGGAGAG CAGCTGCGCT GGACATTGAC CGATCGCAAG ACAGGGCAGA TCAATGGCTC    113220
     TCAGGTCTCA GTCAGGGAGA TCAACGACGA TCATCTAACC GTTGTAGATG ACCAGGGACA    113280
     GGAATGGAGG ATTAATGGTC GGTTACCTCT GACCCTGGAC TATGCTCATG TCACCACAGC    113340
     TTATTCTGCC CAGGGACTGA CTGCTGAGCG AGTGATTGTG TCTGCAACGA ACAATCCAAC    113400
     CTCTGCCCAA GAACCCTTTT ATGTCAAGAT TTCTCGCCAG GTTAGAGAGC TTCAAATTTA    113460
     TGTTGAAGAC CTGGAGGGAT TGCGCGAGTG GGTGGGGCGC AGTGTCGCCC AGATGAATCC    113520
     TTTAGAACTT ATCGGAGGGC ATGATGTCAA ACGAGAACGC CAATTTGGAG CAACTGGTGC    113580
     TCACGATGAA CCAGAAGCTG GACAGCCTGA TCGCCCAGAA CAGAATTTAT CAGGAGGAGA    113640
     ACACAGCCTT AAAGTCGATG CTGGACTTGA GCCTCAGTAC CGTCCCCCTC ACCATGCGAC    113700
     AGGAACTTCA GACGTTTCTA GACCAGTTCC GCGAGGCTCT GGAGAAGCGG AAGCCTTCGG    113760
     AGATGTCCGA TGCGATTCAT CAACTGGCTT TGGCAGTGAA GGGATTGAAG GACCAGATCG    113820
     ACCGTTCAGC ATTGACCGAT ACCCAGATCA GCTTGTCCCT CAACCAGACC CTAGCCGAAA    113880
     TCAATGCGTT AACCCATTGC TTATCCAACA GCGATTTGAT CAAATTGCTC AGCAAATGGG    113940
     AGCAGTCTTC CCCGGAAACC CTGAAACTTC CTTAAACGCT ACCTTTGGGC AATCTCATTA    114000
     CCGGGGCTTG GCAGAGTTCG CTCAGGAACT GGAGTATCTC GGTGAAGAAG ACCTGTGCCA    114060
     GACCCTGCAA GACATTACCC ACGCCCTGGT GGAGGTAGAA CGCTGTCTGG AACGATCGCT    114120
     GCAACAGGTC AAACTGGACA CGATCACTGA TGCTCTCCAG TCGTGGCGCT CAGAACAAGC    114180
     TCTCTCGGAA GCGATCGCCC AAATCGCGAC TGTCCAGGCT CAGGCAGAAG AGCCAGATTC    114240
     TTTAATCCTG GGAACGGTCC TTCAGGAGGT GAGGAAACTT CCCTACCGTC GGGAAGAGGT    114300
     CGATCACCTG GTTGAACGGG TCGAGGAGTG GCAGGCCGAG CAGGATCTCT CTGCTGTTTT    114360
     GGAGCAACTG GGCAGGACGA TCAATGAACT CAAACCGTCC TTCTTTTCAC CGGGCTACCA    114420
     GGCGATGGCT GAACTGGCTG AGGCCGTGGG CGATCGTCCT GCCGAAGCTG TCATTAGGGA    114480
     GCACCTGCAA GCCCTTCAGG ACGCTACTCT ACAGATCCAG CAGAGGTTAC TCCAGAATCC    114540
     AGGATTGGAG CAACTGGCGG TTGCTGTGAG ATCTTTGAGA GAAAACCCTG TTATTGCCGA    114600
     GGGAGCTGCA GCAGAGCCAC TCCAGCAGGT GGCTGAACAC CTGACAGCCT ATGGACTGAA    114660
     TCCCACTCCA CCACCGCAGA AACTCCAACC CTTCTGGCAA CCCCAGTACC TGGAGGAGCC    114720
     ACCCGCAGGC TTTGACCCCG TCCACTGGCA GGAATTCCAA CGCAGTGCGA TCCACCCCGA    114780
     CCTAATTGTG GCTAACGCTG AGAGTATCGA TGGCTGGAGA GTGTATGAAC GATTGCTATC    114840
     CGAGAAATTG GCAGAAATGG GCTCAGGGCA ATACGTCACC GCTGCCATGG CCAGGGAAAT    114900
     GCGACGTTAC GAGCAGGTTG CTGAGGGAGG CTGGTGGGGC AAGGCTGGAA TTGATCCTCA    114960
     GTCACTGCCA GGTCTGCAAC CCGGTGAGCA ACCTACTCTC AGCACCTGGG GTTGTTTCAA    115020
     ACCTGATCAT CCCCGCATGG ATGTCAGCAA GAGCGATCGC ACAGGGCAAC CCAAAACCAT    115080
     CAAGTATGAG CATCCCGTTG GCGTCCAGCG AGGTCTTTAC CTACCGATTG TTCCGGATAG    115140
     CTTGGCAAAG CGAATTTATC AGAAATATCA GATTCAGCCC ACCTCAACTG AGCAGCAAAG    115200
     CGGCTTCTGG TTTGTCGTGC TGCACTATAA CCTGCCGATC ACAATTACAG AGGGGGTGAA    115260
     GAAAACCTGG GCGAGCCTCA GTCAGGGGGA GGTGACGATC GGGGTCTCCG GCGTAAATGG    115320
     TCTTTACCGC ACAACGGATG TAGGGGGTCA TCGGCTTCCC CAGCGGCAAC TGCACCCGGA    115380
     CATTGCCATT TTTGTCACGC CAGGGCGGGA GTTCCGGTTT GCCTACGACC ACGACACTAA    115440
     ACCTGCCACC GTCTACAATG TACAGCGCGA TCGCGTGCGG GGGATTGAGC TACTGGAGGC    115500
     GCGGGGCTGT CTCTGCAAGA TTGTGCAATG GTCAGGGGAT AAGGGGCTGG ATGATCTGAT    115560
     TGCTCACCAG GGGGCGAACG CTTACACAAG GGCACAACTT CAGGCCATTT CGGCTGAGCC    115620
     AGAGAAACAA AATTACTATC GTAGTCAGTA CCGGGTCATC GCTCGACAGG TGCAGCAGGA    115680
     GTTGGGGTCA CTCACGGCCG AACAACTGGA CAGGGAAGTG TACCGCCGGG CGATCACTCG    115740
     GGGAGATTTG CTGGATGGAG AACGCTTCCT TCGATTCAGA GAGGATGAAC AGGCAGAAAT    115800
     TTCGGCACAA CCCGTTCGGC AAAAGCCTGA AATCGGGGTC AAAACACCGA AGGAATCGAC    115860
     TCAATTTCAC CAGCATCAAG TTCAGGAGAA TGATTTTGAG CTTTAAGAGT GTAACCTTGC    115920
     TCTACAATCT AATTTGATTA GGAAAAGAGT TTTGGTTTCA GGTATTACGC CAATATCTGT    115980
     AAATCGTGCA AGCACCTCTT GCACAAACTC CCTAAATTAT GCAACAGCTT GTTGCACAAA    116040
     TTCTTAGAGG GCAATGTGCG TGTCTACTCA TAACCTATTG CTGGGTCAGC CAGGCTTGTA    116100
     AATCCGACAA ACTGTTAAAG TCCAGCAGAT CTTCCGCTAG AGTCTCCAGT TGAGGTGTTG    116160
     TCAGGGCTTC GATTTGTAAC CGCTCCGGGT CAGGTAAGGA ACCCAACTTG CGATTCAGTT    116220
     GACGCAGAAC CAAGGTGCGG GCTTCTTGCA GCATACCGTC TCGCATCCAA CTCGTGACAA    116280
     TTTGCATAAC TTCTTCCCGT TCAGTTCCTT AAAGTTCATT TTCACACTGG GTAACGTGAA    116340
     AATGGGCAAT CTTTTGAGTT TTGAGGCTAT TGGTAGTGTC TGTAATCAAT AACTTAAAGT    116400
     GACTTTGGGC TTTACTGTAA CCCATTTGCT CCTGCAACTG CTTGAACTGG GGAGACGTTT    116460
     CCAGAATCTC AAGCGCTTGG ACTTGAGTTT TACCTGCTCT GAGCGTATTA GCTGCAACTC    116520
     CTTTCAAGTA ATGAGACGGG TCTTCTTCCT GCACTCCCTG GGAATACGTT AGCCAATCTG    116580
     CATAGCGAAA ATCGGTGTTC ATGGCAGCGA TCGCCTGCTC AGACAGAGGT TCCCCATTTT    116640
     TAAACCCTTC GCCAACAGAC TGAATTCGGG AGAGATAGGG TTGTGACTTT CCCAGGCGGA    116700
     TTGCCGTGCG ATACCATTCC CGCACCTGGT TTAACTGGGC CGTGTGGCCC TGCCAATCAC    116760
     TCTCCAGTGC CGTCACTGCT TTATCGGAAA GGGTTTGAGT CTGCCGGTAC ATCTCAACCA    116820
     CGGTGTTGAT TCGGGCAACG TAACCCTCTG GTTTGGATAG GGAACGGGAG ATCGTCGCCC    116880
     AACCTTCCAG TTTGTTAATC AGTTGGCCCT CTGGCTTTGG GGCAAGGTTC CCCTCTGACT    116940
     GACCAGGAAG TTGAGCAGTA GAGCCAGAAG GGACTGGATT AACAATGTCC CTGGTCGTTT    117000
     CAGCCATCAT CTTTCCTCCG GCTTGAGGGG CGGGTGGGGT TATTGGGGGT TCGGAGAAGG    117060
     AGCGGTCTTG ATTCTGGTGT AACACAACTG TTTCAGCTTC AGTAGTTATG GATTTTTGAT    117120
     TCAAAGTATG GGTGATCCCC GCAGCAAAGC CCTGCTCCAG CAAATTTTTA GAAAACAGGT    117180
     TGGCAAAGCT GGCAGAAAGC GATCGTAGTT CCCCACCCCG GATCGGATCT TGCACCGCGG    117240
     TTTCTGTAAG TTTCAACTGA CCTGTGGAGT CAATGGCAAA TACCATTTCG GCATCAATGC    117300
     AAAGGTCGCC CTGTTGTTCC CGGTAATGGG TGAGATAAAG CTGGGTATCG TGCCGTTCAA    117360
     TCACCAGAGG TAAATAGGGA GGGTTATCCA CACGCAGATG GAAGTCCTCC CCCTGTAGGA    117420
     TGGCTTCCGT AAGTCTGCCC TGGTGCAATA ATCGGGCCAC GTTTTGCTCA GCAATACCGC    117480
     TTTGGAGTGC TGGTTCGGCA ATTGCATGGA AAGCAGAATT TTCTGATGGG GGTTCCGTGG    117540
     CTTCTTTGCC ATTAACTGAT GGCGTAACAG CAGGCTCTAT CCCATTTGCC AGATAAAGCA    117600
     GTTCCAGTTG TTGGATACTG CTCTGTGTCG GCTCAGGAAC AAAGGGAACA TAGTCTCCCT    117660
     GAGCTTCAAA TTGATTGGCT GCAATCAGTT CCATCTGGGG CAGCATTTCT CCCAGGTAAC    117720
     TTCGGGCTAA ATCTTTGTGG TCAAACGTGA CCAGGGTAAT CTGCTGCTCA ACCATCAATA    117780
     CCTGCAATAC TGCCTCCAGC TTCTCAGCCG GGATGGTCAT CTCCATGCGA TCGGACACGG    117840
     AGAAGAATTC GGCATCGGCA GCCCTCAGGA GATCTTCATT CAGAAAATAC CTGCCACCGA    117900
     CACGGGTAGC CACTGGAGTC TGGACCAGAA AGGCAGTTGC CGTTTCCCCC GTGTACTTTG    117960
     CCTGCCCCGC TGTTTTGATC GCCAGAATTT TGTCCAGGTC ATGCACCACC CCCTGGTTGC    118020
     GGGTTACTTC GGTCAAAAAT GCCTGAACCT GATGAGGTGC TTTGAAGGCA ACAGGTTCTT    118080
     TCCGTAATTC CTCCTGGATG TCAAAACCAT CGGGCATCAT CAGCCCTTGA CGCACCTGCC    118140
     CCCGCCGATC AGTGAAATTA ACGAATTTCC CACGCGGGTA CTTTTCGTAA GCCTTGAGCA    118200
     GATTGCCGGT TATGATCTGC ATCTCCAGAC GGCGATCGGC TTGCTTCAAG TCAAAGGTTG    118260
     CGTAGATCGG GGTGCCATCC CAGCGGGCCT CCTGATGGAT CATGATCAGG CTGGACTCTC    118320
     TCCCGGTGTT GACTTTGGAA AGGGGAACCG TAATCTGTTT TGCCCGGTTA TCCGTCAGAA    118380
     TTTGAATCCG CCAGTTGGTT GCCGCCGCTG GACTGCCGAT CACTTTGGGT TTCTGCCAGA    118440
     CCCGACCAAT AACGCCATAA ACAAGGCTTC CTTCCTGGGT AGCGACCTGG ACAGGCGTCC    118500
     CCTCTGGAAA TTGGTTCAGG AGCGTTGTCA ACTGTTCCGT CTGCCGCTCC AGGTGCAGGT    118560
     TGAGTTTGCT GCGGGACTCC GGTTCAACCA AGCGGGACAG GACATCACTG CGGTAAACTT    118620
     CTACTGCCTG TTTCAGTTCG GACAACCGAC GTTCCGCAAA GGACTGAGCG ATCGCGGTTG    118680
     TGGTTGCAGC ATCATGCTCC TCTACAGTAC GCACTGGTGT AAGTTCCAGG GTTTCACGCA    118740
     CAATGTTAAT CACCTGAAGC TGGGTCATGG GTTTATCGAT CGCCCGCGCA TCCACCACTT    118800
     CCAGATAGGC CGGCCCCGTA AACTCACTGC GAACCTGTCC AGTATCGGGC AGAATTTCCA    118860
     TACGGGCGAT CGTCCGGGCT TGCAGGTCAA GCTTATCGGC TTCCAGAACG TTCTCACCCA    118920
     TAGCGGCTTT TTGTTCAATC AGGGACTGGG TTTCGGTTTC AATCAGTGTG TAGAGGGCTT    118980
     CCTGGTCTTC GATTGAGAGC AGGGGAATAC GTCCGGTCAC CCGGCTGATC AACTCGGTGC    119040
     CCGAATTGCC CTGTATATTT CGGGCCGGGA AGGAAAGCAA GGCATCCAGT TCCGGGTTAT    119100
     CACTCAGCAG TTCACTCACC ACCTCCTCAC CAGCGGCATT CATAAAGTCC ACCACGTTAC    119160
     TGACACTCAG GTTAGAGTCA CGGGCAGCCG TGGTATTGGC ATTGAGGGAG GCCATTTTCT    119220
     GGGAAAGCAG GGCCCCCAAT CGCTTCTCCG CTGGCACATC CGCCATCAGC AACGTAAACG    119280
     TGGGTTCAAC AACCTGCCCG AACCGGTTCA CCCGACCCAG CATTTGCATC ACTTGATTAA    119340
     TATCCCGTTC GGCTTGAACG ACGATCATGT GCCGTGGCCG TTGGTCCACA AACTTTTCAG    119400
     AGGCGTGTAG ATTAATTCCC GTGGAACCGG AGCGGTTGAG AATCACCACA TCCAGATCAC    119460
     CGGCGTTAAA GCGATTGACG ATATTGATCT TGGCCTGGGG ACTGGTTTCC CGTGCCGATC    119520
     GGATTCCGAG CCGCATGGAG CCATCCGGTT GATAGTCAAT CACATTGGAT CGTCCGGTAA    119580
     TCTCATCTAC CCGATAGCCA GCCCTGTCCA GCCGCCATTT GATGTAGTCA ATTGAACTGA    119640
     GGGGAATCCC GGACAGATCG GTGGCAGCAA GAATCGCTTG GGCTTCCAGA AACGCAGCCA    119700
     TTCCCCTTGG TCCCAGTTCG GCATCTGTCA TCGGACGGCG GGTTTGATTC CCCTCGTAGT    119760
     CCTTCAGAAC CACATCACGG GAGCGCTCCA GATAACGATC CAGCAGATCG GCAAAGGTGA    119820
     TTGCGATCGG TTCCCCTGGC TCAATTCCCT GGGCCTCAGC ATAGTCCTGA ATAAAGGCAT    119880
     CCATCGTTGA AGCAACCGCA ATCAGAGGCT TTTCTCCCCG TTGCAGCGCA ACGATCGCTT    119940
     CTTGAACCGT GGCTTCAGCT TTCTGGCAGA GCAAGCCCTG GTCGATGGCA TTGTGCATCA    120000
     GAGAGGTAAA GTTTGCTGAC TTTGCCCCCG CCTGACCGAT CGCATTATCT TCCCCAGCCT    120060
     GCTTGGCCTC AGCCTTGACC TGCTCTTTCA AGTCTTTGAG GGCTTCTGCC TTAGCCCGGT    120120
     CAAACCGATC CACTGCCCGC ATAATTGCGG AAATGCCATC AGCAATCTGC CGATCCACAG    120180
     CCACTACTTT GGCATTAAAC GCAATACTCT CAAAGGAGCG TTCTCGTCGC AGTAAGTTAC    120240
     CAGAAGCAAC AAATTTAGTT GCCATCATCT GTTGCAACGG AATCCCCCCA GCTTTGAGGG    120300
     TCTGTTCTAG ATTATTCATA CTGGAGACGG CATGAACCGC ATCTGTGCGG CGGGCATAGA    120360
     GATCCATCAC TGCCGGGTCT TTTGTTGCAG TGGCGGACAT AAACACGGCT CCCGCACTAC    120420
     TATCCACCAG TTCCCGCACA AACGCCGCCC GATCACCCGC TTCACTGCCC GATTTCCAAC    120480
     CCTGCTGTCC AGTGCTACCT CCGGCTTCGT GGGACTCATC AAAAATGAAA ATAGCCTGGG    120540
     GAGCGATCGC CTTCAAGAAC TCCCGCCGCA GCGTCTCCTT ACCTCGTACT GTCTGCATCT    120600
     GGCTGTAGGT TGTGAAGATG GCATCATAAC CCCCCAATCC AGTACGGGCA ATCCGGGTCA    120660
     TTTCCTCATT CTGATCCGCC TGGTGACCGC TTTTGAGCTT ACGACCATCA TCCAGAACAA    120720
     GAGAGACATC ATTGTTGGTG AGAAAAGGAC GAATATTCTG ATACCCCAGG TCTGCCAAAT    120780
     CGTTCAGCAT TGAATTGTAA AGATTGGGCT TCTGGGTGAC AAAAACCGGA ATATAGCCCT    120840
     GCCGCCGGGC ATCAATAAGG TTGGCCGCTC CAAACCGTCC TTTACCATTT CCGGTCTGAT    120900
     CGCCATTGAG AAAAATTTGC CCTTTGCTGC GCTGGTCAAA GGCTAAAGCA AGGGAGTCAA    120960
     TTTGTTCAGC ATAAAGGACT GCCCAGAGTT GTTCTTTGGT ATCCAATCCC AACCGACTCA    121020
     TGACAAACTC GTCAATATTG CCGCGCTCTT TCTCCAACCG ATCCAGAGCA ATCTGGGCTG    121080
     AAACCGCCAT ATTTGTCGGA ATGAGCGTAC CGGGAGAGGG CCCCTGACTG CGGGGAACGT    121140
     AGGCAGTATT GAGGGGTGTA GGGGGTTGAG CCTCTGCAGA AGTGTCAGCC ATAGGAACCT    121200
     GTGGGGTTGA AGCGATCGGT TGCTGAGAGA GATTTGTTAA AGTCCGTAGG CGAGGTCTGC    121260
     CAGGAATTGA TCCAGCTTCA CTTCGTCGTG TAACTCCATC AGGGTGGCTT GGGAGGATGT    121320
     CGCCTCTGGT AAGGTCACGG GAAATTCCTG CTCTGTGCTG CCCTGGAAGA GAATCCCCCA    121380
     GGTTTCGTTG TTCAGAATCA GGGCTTCCCC CCAGTCCATT GCCCACCCCC AGAGAGGGTC    121440
     CTCCGTTAAG TCCGGGGGAA TTTCGTTGGA ACTGAGCCGG TAGAGCGTTT CCACCAATCG    121500
     CTGATGGGTC TGACTCTGAT CCTCGATTTC CGTCGTCATC CACTGATCGA TCAGCCATTG    121560
     CACCCGTGCC ACCATCAGTT CCCGGTAAAA CGTCCACGTC ATCTGCGTTA GAGCCGGGGG    121620
     GATTCTGACC AGAAACAGGC TTTGATTCTC CTCCGTCCGG GGTAACCAGA CCTGCTGGAA    121680
     CCTCTGATAA TCCTGAAGGC TTGTGACTTT GACCATCGCT CAATAACTCC TTCAGCGTAA    121740
     TAAATGAGGT GTAAATCAGG GGGGGTTGGA CTGCTGGTAA GGGTCTGGAT GATCTGCCTC    121800
     GCCCCTGAAT GACGATGAGA TCGATGGGCC AGGCGGCTCC TTGCTTGCGA TATAGCTCCC    121860
     CTGCAACTGT AAAGTGTGCA GTGACGTTGT ACTGCTGATA AAGGATATAG AAAAAGCGAC    121920
     GGCTTTCTAG CGTGTTGTAA CTTTCGGAAC GATCAGGCTC TTCTTTTTCC GGTTTGCCTC    121980
     CTAGAATCAA CACTGCCCTG CCGTCGGGTT TCATTGCCCG TAAAGCCTGT AGCGCGATCG    122040
     CCTGATCAAT CTGAGCTGTA CCCCTGCGAT TACCCTCAAG GGTGAACTGT CTCGCCCGTC    122100
     CAGCTTCACC CTTTACCCGC CCAAATGGAG GATTAGCAAT GACAACATCA TGGGACTCTT    122160
     GAGGGAAGTA CTCAGCCGCA TCGTATTGAG TGACGCTAAA ACCTTGAGCG CGTAAGTCAG    122220
     CTGCTCGCTC CGGGTTGAGC TCATTAACCG TTGTTTTGGC TGGATCAGTG CAAAGGAGTA    122280
     ATGCTCCATG CCCGGCAGTG GGTTCATAGA CGGTTGTGTT AGCATCAATC CCCGCTAGAG    122340
     TTGCTGCCAG GTAAGCGATC GGGAGAACGG TGCTATAGGC CTGTTGGCGC ACACTGGTAG    122400
     AAGACCGAAC CGAGAGGTTG GGCTGGCGAT CGTGGAGATC AACAAGCAAC TCATAGGTTT    122460
     GAGAGGGAGG GAATCCCTGG GCAACAATTT CCCGTGCAGC CCGTACCAGT CCTGCTTCCA    122520
     CGGCTTCATC CACCCGTTTG GCCAAGGCAG AACCTGGGGG AACGGGCTGA TTCAGTCGCA    122580
     CCTGTACCTG CTGCCGGGCT TCAACAATGG CGCGATAGCG ATGTCCCTGG ATAAATTGAG    122640
     CGGCGAAGAA TTGAGCTAAT TCCTCCTGCC CTAACATCAT TGCCCTGCTC GATAACCACC    122700
     CAGGACCAGT AGACGATCAA CCGTCTGACG GGAAATACGG GTAGACTGGA CTGCTCGTTC    122760
     AAGCGTATTG CCTCGGCGTA GATAGCGGAC AACATTCTGA ACTTGAAAGC TCAAATCATC    122820
     TCTGTAGCCA ATTTCACCCG TGCGATTTGC CACTGCCAGT CCCCGAACAA GGGCATTGGC    122880
     AAGGGTATGG GCGTTTGCTG ATGGCTTCCC CATCACCTGT CCCTTCTGGG CAGGAAGTTG    122940
     GGTTAAAACG GCTTGCTGGA AAGGCTTATT CTTTTGCTGT ATTTTAGAAT TGACGGGCTG    123000
     AGATTTTCCG GCAGACATAG GCAAAAGCGC TTTTCCCTGT TGCGCCAACT GGGAAGCAAC    123060
     CTCAACGAAT AGTCCAGATG CTTGAGCTGC CGTTTCTAGG GAAGCACCCT GAGCGAGCTG    123120
     GGAGAGCAGC GCTTTAACAG CCAGATGCAA AGCACTTTGT TCTTTAATCC GCCCTTCTTG    123180
     AAGTGCCTGT TGTAAGCCCG CCTCAATGTT CTGTGTCAAT GGAGCTTGTT GATCCGAAGC    123240
     TGCACTGGAC GGAACCGCAG GAGCAACGAT CGAGATAGTA AACGTAAGCG CAAGCAGAGC    123300
     TGGAAAACAG GGGAATCGGG TTCCATGGCA GCGTTTAACT TGGTCCACCC TTACCTCCCC    123360
     AGCATGGTTT TGAACAGGGG GTCAGGTTCC ACCCGCCAGC GGGAGCGGTC TTCACTGGAG    123420
     GCTTTGAGCG CAAACTTGGA ATGGTTACGA ATCGATTGGA TCTGGCCCGG GTTAGCAATA    123480
     TTCGCAGGAG TAAATTGTTT GCGCTGGTAA AGCAGATCTT CAACGGTAAT GTGCCGGGGT    123540
     CGTCCCTGCC GGTAGGAGCG CACTGCAGCC AGGTAAACCG CTTTCCCAAT TTCGTCCGGG    123600
     GTACATTCGC CGTACTCCGA GATCAGGATC TTCCAATCGC GATCACTCCA GTCGGGAAGC    123660
     TCGCAATATT TCTCCAGATG GGTACAGAAG ATCTCGTACC GGGCTCCCTC ATGGGGAAGA    123720
     TCAACAAAAA TGGTGCGGTC AAAGCGGCGG CGCAGCTCTG GGGGAATTTG ATTGATCCGA    123780
     TTGAGCGTAA CGATCGTGTA GACGGATGCC GTGCGCTCCT GTAACCAGGT CAGCAGCATC    123840
     CCAGCCAGCT TTTTCTCGAT CCCAGTATCT CTGGAGAGAT CGGCAGATGC AAAAGCTTTA    123900
     TCGTAGTCAT CCCAGAAGAG GACACAGGGA GCTGAAACTT CAGCGGCGTG GAGCAAGGCC    123960
     CTTAAATTAG CCTCACTCTC CCCCGGCAGG GGTGAAATTA ACCCCGTCCA GTCGGCACAG    124020
     AGCAGGGGCA GCCCCAGACG AGCGGCCGTA TTTTTGGCAA ACAAACTTTT GCCTGTTCCT    124080
     GGTGGCCCAA TCAGGATCAC CCCTCTGGGA AAGGGTAAGC CCGCAGCAAA AGCTTCTGGC    124140
     TTCAAGAGAT CACTGATCTC AGAGAGAAGG CTATCCAGAA TATCCATCCC CACTGCTCGA    124200
     CAATCGGGTT GGGGAACCAG GGTAATGCCC CGTCCTTGCA ATTTGCTGAT TTTGTAATGG    124260
     GTGATCGCTT CTGCAAGCCT ATCTTCGTTT AAGCCTGCAT GCCTGGATAG CAGGTTAGCC    124320
     AATTCACCAC AGTACAATCC CAGGACTGCC CGATAGAGCG CTTCTGAGTG CAGCCCTCTG    124380
     GCTTGCAAAA ACTGGGAGAG CGCCACCGAA TCAGGACGCG GCCAGTCTTG GACTTGAACA    124440
     AAGGGAAACA GATTTTCAGG ACAGTGGATC CGCTCACCCA CCAGGTAGAG CGTTTGAGAC    124500
     CGATTTGCCC GAAAGGTATT GATCAATTGA TGACAGAGGC GGGTAGACAG GCCTTGTTCC    124560
     AGCAACCCTT CCAGCACAAT CTCACCCGTT AGTGCTGCAA TTCGATCGAG CGGATCTGCT    124620
     TCGACTCGAA GATCAGTCTG TGTCCAGTGT CCTTCCCAAC GCATCAGGTA GGGATGAGCC    124680
     GGGTTCCAGT AGTAAGGCGA TTGCAGTTGT CGCAATAGAA ACTCAATTTC ACTGGTAGGA    124740
     ATTTGATAGA GAATAATTTG TGTCAAGCTC CCACCTCCAT CTGTTGCCCC CTCTGAGGTT    124800
     GCCTGGCTTG AATCTGGTCC AGGAGTCCAG GCAGACTATT GAGCTTGAGG ATGTCACGGG    124860
     CATCTGCTGC TTGGGTCAAT TCTCCATTCG CAAAAATGAT CCTGCCATCC GATCGCCGTG    124920
     TCACCGAGAA TTCGCCACCA CTGCTGAGGT GAAAGGCATG GGTCGCTGCG CGCTCATAGG    124980
     TTCTGCCATC TCCATAGGTT TGGACAATAT GCCGGCCGAC CCGTTCAACG TCCTGGGCAT    125040
     TGACCGGACT GAGGAACTCA TTTACCCCAG TTCTGATCCC CTCTTTCAGG GCGATCGCCC    125100
     CTAACTGTGC CGCTGTTTTC AGTCCTTCCA CTGTTTCAGC TGCAGCCACC TTGGCGCCAT    125160
     CAATTTTCTC CTGTGTAACG GTCTTTAGCT CAGTCACTTT TTCAGTCATG ACCTCTTTCA    125220
     CCTGCTCAGT TTTGACCTGC ATCCATTGCA TTAAACGAGT TTTGGCCTGC TCAGCAATGA    125280
     GCTTGGAGGT GTGGCTAATG TCCTGAACTT TGCTCTGGGC CCAGTGCTGT AGGCCCTGTT    125340
     CCTGAACCTC CTTCGCCAGT GTTGAAAGCT TGACCTGAGT TTGCTCCAAT TGAGCTTGAA    125400
     GAGCATCAAT ACGAGCATTG GCAGCGACAA GGGCCTGCTC CAGAGAGGCA TAATTAGTAG    125460
     CTTCGGGGGG ATTAAGGATC TGCCACATTT GCTGATCCAG TTGGGGTTCA GTCGGCTGAA    125520
     GGGGAAAGGG AACCAGGTCC TTGCGCGAGT CCACCAGCAC GATCGCACCC GGTGGAGAGG    125580
     AGAGGGAACT GCTTATCTGT GTGGGTTCGG ATTCAGACTG GGAGTGCAGA CGCTCGATGA    125640
     GCTGGGGTTC GATCACCGCC CAAGCGATGG ATTCTGGTAA ATGGGACGCA TTAACAACCT    125700
     GTTGAGGGTA AAGAGAGGGG GAGAGAGAGG GAATTCGGTC CGTTAGATGG CTTGCAGCAG    125760
     GCTCTGCATT CAAACCTGTT TTTTCGCTCT CGCTGCTGGC TTCAAGTTCT GGCGCTGGCT    125820
     GAGCTTGCCA ATGAGAACCC ATTCCTTTGG CATCAAGGGT CACCTCCCCT TTAGCACTGC    125880
     GGTAAATTAA CTCCTTCCCT TCCATCACTC GTAAGACCAA GGATTCAGAA GCCGGCGATC    125940
     GTAAGGCTAC TTCCAGCCGT TCCAGGGTGG CCTCGCTAAT CGCTTTCCCT GAATACAGCT    126000
     TGTCCCGCCC CAGGAAAATA CTGATCTTGT CTTTATCGCC AAATTGGGTG GCGATCTGCT    126060
     CCAGGCGTTG TTGAATCTCA GCCATACTAG AGCTCCACGA GAATGGATGT AACCTGGGGT    126120
     AAATGACCCC CCAGCCGGTT AAGGATGACC GTGCCCTTGA CCTGAATGAA AACAAAGCTG    126180
     GTTTCATCCA TGACTTCGAT AATGGTCGGG ATGACAGCAG CAGCCGGATG AGAAGACAGA    126240
     ACGCCGTTCT CGATCGTCAG GATGGGCAAC TCGGCACAGT CGTAATAAAA TTCCAGCAAC    126300
     CGGCACTCAT GATTCTGGGG GAGCGGTGGC AGGTCTTTAT TGTCCAGATA ATTTTCGGCA    126360
     ACAGAGGGGT AGTCTTTGAG GGTCAGGACA ACCTCCCTGG GAAGCTTAGC GAGTTGGGCC    126420
     TGTTGGTCCA GGGTCAACAT AAATGCCTCC GTTCAAATCG GTTTGATCCA GATAGGGAAT    126480
     GCTGTCTAAA AGCGCACAGT TAATACCCTG ACAGGGCTTC GTCTGCGATC TGCCGCTCCA    126540
     GGTCTGCTGT TGAGGGCAAG GACAGAACGG CTTCAGCCAG TTTTACGCCT GCTTTCAAAT    126600
     ACGCCGGATC TACAGGCCGC TGGGGCGAAC GCTGAATGAA AACCTTACGG GCATGAGTCC    126660
     ACTGGGAGGC TGACCAACGG GTGAGCTGTT TGTATTCCTC AAAGACTCGA ATTTTACAGC    126720
     GATAGGGAAT ATACTCGCTA GATCCATCCC TGGCGCGAAA ACCAGCATTG AGAATAATTG    126780
     CCCAACCCTG GCCCATCATC CGCACCTGAT GGGGTGGAAT GAGCGGACGC TCTTTCACCT    126840
     GGGAGGACGT GGAGTTTGAG ACTTTACCAC CAGACACCGA GCGGGAGCGC TGGGATTCCC    126900
     GATATTTCTG CGTCCCGACA ATCTTGGAGA TCAGTTCTGC CGTCTGCTGC TCCCGAGGGT    126960
     TAAACAGGAT TTGTGTCCCG CAGGCTCCAA GGATAGCTGT AGTCAAGTTT TTGCCATACT    127020
     TCTCTTCCAA CTGAGACAAG TTCTGGAAGG CAAGGTTGAA GTAAACCCCG TACTTGCGGT    127080
     TTTCGTTGAT CCGGCTGGGT AAACTGCGGT AGGTCGCCGC CGCTAATTCA TCAAAGCAGA    127140
     TTTGCAATGG TTTTTTACGA GTGGGAACGG AATTAATATC GACCAGCAGG GACAACAATG    127200
     CCATCTGGAT CGGCATGATC ACTTCCCGCA GGTCCGAGCG TACGCCCAGG ATCAGCAGTT    127260
     TGGCACCATC CAGGAACAAC GGAAAGCTGG TTTGTCCTAC GAGGGCGGGT GCAATATCTT    127320
     GCTCAGTAAA CCGTTTGAAC AGGTTGGACG CAATTCCGGC GATCGAGGCA GCGGTTTTCT    127380
     CTGATTTCTC GGTACTGAGC AATTGCATGA AGGCCCGATA CACCCAGGGG TCAATTCTGT    127440
     CCTCGTTCAG TCGCACTCGC TTGGGCAACT CACTCAATCC CAGAATCGCT TGAGCCCCCA    127500
     CGACATCATT CAATCCGGGA ATCGTTCGGG CCAGTTGCAA TACAGCAGAG ATCAGGGCTT    127560
     CTCCGGCAGG ATCAAAAAAG CGATCGCCCC CCTGGCTGCC GGATGTGGCA AAGTTATCGT    127620
     TGAGCATTTT GGCTAAATTG GCGGCATGGG AACCCTGGGC ATACTCGCAG ATATTCCAAA    127680
     TCCCAGACTC AGGACATCCT GGTGCAAAGA TATGGATATC CTCTGCCGCA TAACCTAGCT    127740
     GTCGGGCCAG GCACACCATT TGCTCAGTCT GAACAGGGTA CTGGACATCC ACAAGGATGG    127800
     CAGGATAGTT TAGCTTCAGG TGGGCGTAGA GGGCTGAGAG AACGGCGCTG AACGACTTTC    127860
     CCGTTTTGGG GGCACCGATC GAGATCAGGG AGGTCACGGC ATCATAGAGG GGAAGATTGC    127920
     TTCCTAATTC CAGACCCACA TTGTCCTTGC CACCGATGAT GTTCTGCTTT GCAACCAGAT    127980
     ATCGGCACCG ACGGACATGG TCTCGGGTGG CCCAGGCAGC GCTATCCTTC AACTTGGGTT    128040
     TGCCCCGGTA AGCCAGCACT AACCAGACAA TCCCCAGCAC AGCAACCAGC ACCAGTGGCT    128100
     TGGCATACTT GGACTGCATT AACCCATCGA GAGCAGCTCC CCAGTTATGC GGATCGTTGG    128160
     GATCAATTTG CAGCACTGGT TTCACCATTC CACCTCCGAT TCTGGGCTAG CCGAGCGTTG    128220
     CGCTTGCTGG GCATAGGCAT GGCTGAGGCT TTTCATCGCC TCCACATCTT TCTCACGGGC    128280
     AATGCCGGTA ATCGTCTCCC CTTCCTGGCG AATGGTTGAG CCGGTTTCAG CAATATAGAC    128340
     AGTTCTGACG CCTTCGTTTT CGGCGATCGA GTACTTGGGA TGCACCCAAC TGCGATTCCC    128400
     TTGCGGTTGT CCCGGACGAA GGATGTCCAG GGCCTTCCCC GCCTGGACCA TCAGTTCGCG    128460
     ATTTAAACTC TCTTGCTGCG GGTTGGCTGT GGCTGTTTCA CCGCTAGAGA TAGATTGGGT    128520
     TGACCTCTGA GGACTGGGTT CATCCTCTGT GGGAACCGAT GAAAATTCTT CTCTGGATGA    128580
     TTGCAGGTCT AGTGAAGGGG GTGAGGGAGA TGAACTGTTA GGAGATTCAA GTTGTTGTGT    128640
     TAGAGAAGAT GGATGCTCAG GCAGCTTTGA GCTCACGGAT AGGTCAACAG GTTGAGACTG    128700
     GATTTTGGGA ACGATCGCTC TAGTGAATTC CAGGGGCAAG TCGTTTTGAA GTACTTTTCC    128760
     ATCTCGCATC TCAAACAGAA CTTCACCATT GACCAGAACA CGCATGTTGC GGAACTGGGG    128820
     AATATCAACC TGCTCTCCCT TTTGTTTAGC AAGGGCATTT TTAAAATAGT GAGCTTCAGG    128880
     CTCAGTGATT GCATCAACCT GAGTATTCTT TATACTGCCA TCAGCTCTCA GGTTGGCACC    128940
     ATAAACTGTT TCACCGCCAA TCGTAATTTC CACTCTCGTA TCAGCTCTGG GATCTGAGAG    129000
     AGCAGTTTGT AATTTTTTGG GATAAAGATT TGCATTTTTG CGTAGGGACT GAACTAGCAA    129060
     AACCATAATT TGTTCAGCTT GACGGAGATT AGCCCGTTCT GCAGCGGACA TATCACCCTT    129120
     TTCCAATGGG GGAGTAGATG CACTCATACC TAAACCAAGC AACTTGTTCT AGATATGGTT    129180
     CATAACAGGA AAGCGCACTT TAGAAATCAG ATAGAGCTTT ATCAGCAATC GCCTCATTGA    129240
     TCTTTTGATA AATACGTTCC AAAATATTTT TAGGTAAGGG TGGAAGTTGA TTAAAATCAG    129300
     GCTTTAATTT TTTAGAAAAA TAGGTATTAT GAATGACCTT GCCAATAATC TGATAGATCT    129360
     CCTCATCGGT CAGTAGTGTG TTGGCTACTT TTGAAGAACT ATCCTGAGTT TCAATAACTG    129420
     CGTCTTCAAG TTCTTCCGTC TTAAAGGGAC ACCAATCAAC TTCTAATTTT TGGGCATCTT    129480
     CTGCCTGGGA AGCATACTGA TAGTTGTTCC CAAGCTCAGT TTCAAAGTTG ACGTCAAAAT    129540
     TCTCCGGTAT ACGATTCACA TGAATTTTAC CAGCGCACCA AGCCCAAACA ACTTCTTGAT    129600
     TAAAGTAAAT CATTGCTGTA GTGAACTTAG CCTCTGGTGG TAGATTAGTG CTAAATCGGT    129660
     AATCCTGCTT ATAAGTGTCG CAGGGAACAT CATCAAGACA GGTGTAGATG ACATCAATTT    129720
     GGTAGCCCTC AGGAAGGCGA GGCCGGTTCT GATTTTCCCT AACTAAGCGG CAGAAATTGG    129780
     GAAATCTGTT CTGGATAGCA ATGGGGATAT CTTCAACAGT CATCGGGCTG TACTTATCTT    129840
     GGGCCGAAGG TTTTCCAACT CTTGGACCGA TCGCACGACC AACACTCTAT CCGTTTTAAT    129900
     CCCCAGTTCC TTCAGGGCAA GGGCATCATC AGGGAAGAGG TAGTTTATTT GCGCGGCTGT    129960
     CCAATCTGGA GGTTGATTAA TTTCTGATTC TAACTGCTCG GTACAGCTAC CAAAGCCAGA    130020
     GCCTTGGGTC AGGGATGCGC GACACTGGTC GAGAAGTTCT GAATATTGCA GTTTGGCCAG    130080
     AGCGATCGCT ACCGGTTCAG GCATAAAAGT TAACCGTCCA CTAGCCAGGT CATTTCGGTT    130140
     CAGCCACTTA CAAGTCTGTC CACTTGTACG AATGTAGAGC GTTGCATAGG GACCAGAAGT    130200
     CTCGAACCGG GGTTGAGCGA TCGCCTCATA ATATCGGTAC CCATTACCAG CATCTACGTA    130260
     TCGCACCTGT TGGGGTGAGT AAAAAGTGGT GGGATAACAG GAATTCATTG CCTCTCCCTG    130320
     TAAAGGGGAT GGAGATAGGG CATAGGAAAC TTCAGCTTTG CGGACGTTGG CGAGGATAGA    130380
     GTACGTTCCA CTCAAGACGA TGATGGTCCC TATCCCAGTT CCAGCTAGGA AGAATATTTT    130440
     CGACATAACA GTCCCCAACA CTATTTCAGA TAGAAGGAGT ACTGAAAAAG CGAACCTTAC    130500
     CAGGAAAACC TGCAAGACCA GGTTTTATGC TCCGATCGAG AGGTAATTGA AGCGAGCGTG    130560
     TCACCAGGTG CAATTACGTT TCATTTGAAC CCTGAAATAA CGTAAACTCG TTAGCCGGAG    130620
     AGGCAAATTA GAACGACAAC AGAGTCTTTT AGTACATAGA AACTTCTCTC AATTCTTTGT    130680
     CCCATAAGGG TTTCAAGCTA ACTGCATCTC ATAACAGCTT CGCTTCAATC ACCCCTATTA    130740
     AGTGGAAGCT GAACGACAAG ACCGGCAAGA CCGCCTAGCA ACGCTCATAA AATCCCTCCC    130800
     GAGGTGACAG ACTTCCGCAC GCTGAAACGG TACACCCCTT GCGTGTGCCG AATGGCGGGA    130860
     TTGACCCGTC GCAAAGTTCT CCACGCTGAA ACGGTACACC CCCGCACGCT GAAACGGTAC    130920
     ACCCTTATAT ACACCTTTAG TTTTTAAACT TTTACAGACG AGCATGCTGC TCTGTGGAAA    130980
     ACGTGTAGCT GCGTCTCAGC CTCAATGGTC AAGGGCTTCG CCCTCACTGC TGTCTAAACA    131040
     GGAGGGTCAG CCAGGGGGCT GCCCCTCGAA TTCAACAGGG GAAGGAAGAA TCTCTCAACC    131100
     ATTGGGAAGA AGGATAAAAG CCAAGTTCCA GATCCGGATC AATGTGCATG TGTCGAAAAC    131160
     TTCTGGTGGT ATGAAATGCT TGATTTCGAA CCATCTCCTA TAATTTTGCA TACGCAAAAA    131220
     AGCAGAATTC CGGTTGAGTT TTATGATGCA GCTGGTGTCT GGTTCCCTTC CAGCATGCGG    131280
     TTCCTGAGGT CGCACAGCCT GGGCACCAGT TGCTTGAGGT GAGGAAACTT GGCGCGGAGG    131340
     TGTGGTGGTA CTGGAACCGT GGCAGGGATC CGCAAGAAAA TCTGGTCCCC CTTCTCCCAG    131400
     GTGGTCAGGT CAATGAATTC CCCGAACTGC AAGAGTTCCC GCAGCAAACT AAGCTTGTTG    131460
     TCCCCCTCAA AGTGTCCCAT CACGTAGACC ACCACAACGC GGTCAGCATC CCGCGTGACA    131520
     TCAAAGCGAT CCGCCTCCCC GATCTCGGCG TTCAGGACCT ACTGGGCAGC GTGCAGCAGG    131580
     GCAGCCATCT GTCCTGGGTC AAGGGCTTTC AAGAACTGAC TCATCGCTGT CGGTCTCCTC    131640
     TTCTCGGGGA ACTGTCACTG TCTCCAGCTC CTGCTGCAGT TGCTCAGCCG TCGGTAGGCA    131700
     GGCTTGCAGC TGTTCCGGCA GCGGCTCACC CAGGTGATAG GTTGACACCC CAATTGCCTG    131760
     ATTCATATCG CGCAATGCAT ACTCAATCAC GGTTTTGTTG CGGGATTTGC AGAGGATGAT    131820
     GCCGATGGTC GGCTGATCCT GTGGATGGCG CAGCTGGTCA TCAACAACAG CAACGTAGAA    131880
     ATTCATCTTG CCGGAGTACT CCGGTTTGAA CTCCGTCATC TTGAGTTCGA TGACGATATA    131940
     GCAGCGCAGC CGGACATGGT AGAACAAGAG GTCGATGTAG AAATCCTCGC CGCCGACTTC    132000
     CAGGTGATAC TGGTTGCCCA TAAACGAGAA GCCGACCCCC AACTCCAGCA GAAAGTCCCG    132060
     CATGTGCCGT AGCAGCGCCT GTTCAAGGTC ACGTTCCTTG GCTTCCTCGC CAATCCCCAG    132120
     GAACTCAAAA TTGTAGGGAT CCTTGACAAG CTGCTGCGCC AGGTCCGACT GCGGTTTGGG    132180
     CAGGGTCCGT TCAAAATTGG TGATCGCGGT GCCGGTCCGC TCCAGCAGGC GGCTCTCGAT    132240
     CTGATGCTCT AGAACTGCCC GGCTCCAGCC ATTCTGAATC GTTTTCTCGA TGTACCAGCG    132300
     CCGGTGTTGC GGGTCTTTCA CCTTGTCCAG CAGGACGCAG TTATGAAACC AGGGAATTTG    132360
     TCCAGCAAGC TGCTGGACAA TTTGCAGATC GGGATAGGCT TCGGCAAAAG CCCGCATGTA    132420
     CAGCAGGTTT GTGCGAGAGA AGCCTTTCAC CTGCGGGAAT TCCCGGCGCA GATCCCTGGA    132480
     TAGCTGGTCG ATGACCTTCG CTCCCCAGCC CTGTTGCTGC TGGCGGGTCA GAATCTCCCG    132540
     TCCGATGTGC CAGTAAAGCA GGATCAGTTC CTGATTCACG GCGAGGGCTG CTTTGACCTG    132600
     AGCCGTGCGG ATACGGTTTT TGATATCCGT CAGGAAAACA TCGTAGCCAT CGAAACCAGA    132660
     CAGGGGTGCA GACATAAAAT TCCTTTACTC ACTCTGTCTT TTGTACGGCC GATGCAGGAC    132720
     CATGACAATC CGGGGTAATT GAAGCGAGCG TGTCACCAGG TGCAATTACG TTTCATTTGA    132780
     ACCTTGAAAT AACGTAAACT CGTTAGCCGT AGAGGCAAAT TAGAACGACA ACAGAGTCTT    132840
     TTAGTACATA GAAACTTCTC TCAATTCTTT GCCCCATAAG GGTTGCAGGC TAACTGCATC    132900
     TCATAATAGC TTCGCTTCAA TCACCCCATC GATCAATGTC AAGGCCCGAT CGCAACTATC    132960
     TGAGCAAAGT GACGTTCTGT TTGACGATAA CCGGTTGGAT ATGGATTTAC CTTGGAACGG    133020
     TGAATATAAT TCTTAGCGGA GTAATGGAAA GCTTTTTTAT TATCTTATGG CTTATATTTA    133080
     CTTAGGCTAT AAATAGGCCT ATAGAAAAAC ATAAGAGCCA AATCAATAAA TCTCATTTCT    133140
     GGCTTCTGGC ACAAACTAAT TTACGATCTA GAAAGGAAGA GAGCGCCATA AACTTCTAAC    133200
     CAATTCATTC TGCCTTTAGC ACTTTACGAA ACACAACTTT ATCATCACCT GCTGCGTAGA    133260
     AATCTCGGAT GCGCGCCTCC TCTTCATAGC CACATTTCGT GTAGAAAGCT CGTGCTAGAT    133320
     CGAAGCTTGC TAACGTTTCT ACCAGCAGCA TGCGACCACC GCGTCCCTTC AATGTTTCTT    133380
     CCACGTAATG CAGCAATTTT CCACCCCGTC CTTGTCCTTG ATAATCAGGG CGAATAGCGA    133440
     TTAATTGTAG GTTCCACGTT TGATCGGTCA TCCGTTCCGG TTCACAATAG GCAACGCCCA    133500
     CCACCCCATC TTTGTCTTCG TCATCTGCGA GCCAGAAGCG TTCAGCTTGA CCGTCTCGTA    133560
     GAGAATTGCT ATTACTGTTG TCTCCAAAGT AATCAACTAG TAGTTTTCTC AATACCTCAA    133620
     GCTCATTTAA TTGGAAGCCG ATAGCTTCGG CTAGAGCAAT GATTGCAATC GTGTCATCAG    133680
     ATGTACTCGG TCTAATCATA GTGAACTCCA TCAGGGTGTC AAACTAGTCA CAAACATGAT    133740
     CGAAGCTGGG GTTGGGGTAT AGACAGTCTC ATAAATGAGG GTTCCAACAC CCAAGTCTCG    133800
     ATCCAAGCTC AACCCAAAGT TAAGTTAGCC AATGGGGATC AACATTACAA CAGTTGTTAT    133860
     GCTGCATGGA ATATAACAGC TGTTATGATG AGATGTCAAA GGAATTGCTT AACAGGACTG    133920
     CAAACTGAGG AGAGTGATGA GTTCTGACGA TCGGCGAATT GAAGTGACTC AAGCGGCATG    133980
     GCGGGTGATT ATCCGTGAAG GATTGGATCG CACCAGTATG CGGGCGATCG CGCAAGAACT    134040
     GGGTTCTTCA ACTGGGGTTA TCACTCACTA CTTCCGAGAT AAAGAAGAGC TGATTCTATT    134100
     TGCCCTAGAA CAAGTATTTG AAAACGCTCT AGAGCACATG CAAGAGGTTG CCAAGGGGCG    134160
     ACAAGGAATT GACAGATTAG AACAGATGAT CTTTACAGCG CTACCTTTAG AGGAAATTGA    134220
     CAAAGCTGAT TGGAAAGTTT GGATTGCTTT TTTGGGGTAT TCGATTGGAC GCAAATACCT    134280
     GATCCAGAAA CACCGAAGAC GCTATGAGCG CTTACGGCAG ATCCTTCACC AAGAGTTCAC    134340
     TGATTTACAA GCAGCTAAGT TGATTCGAGT TGATCTTGAT CTAAACCTCG AAGTTAATGC    134400
     ACTCATCGCT CTAGTAGATG GCATTGCCAC TGGAGCTGTC ATCTGCCCTG AACAGTTCTC    134460
     AGCAGAACAA CAACAATATC TTGTGCATCG ACATATTAAT GCTTTATTAG CATAATCTTG    134520
     AATGCCAATG CTCAAACCCA TCAATCATGT GAGGACAATA GTGAATTTTT GCGTTGGCAA    134580
     GTAAGCTTGA ACTACCGTCT ATAAGTTGTA TGTCGCTGCC ATTTTCACGA TTGTACACCT    134640
     CATATCGCTA ATATCCCAGG CCAGACAGGT TGCCTCATTG ATGCCCTGAG GATGCAAGAT    134700
     AATTTGCGGC GGCAGCTTTT GCTTACCCTA ACAAAGCTCT ATAAGTCTGT ATTTAAAGAT    134760
     TTTCTGTAAT TGGTCAGCGC AATAAGAAAG GTTAAATGGG AATCGCGCAA TTGAAGCGGA    134820
     TGGGTTAGGT TGAGCGGTAT GGAACCCAGT GATGCCCACT TAGCAGCCAT GATGGTAGCC    134880
     CCCGAGTTTG ACCCAGAAGA GATGGGGGTT CGGTTTTGGT ATGAGCAGTA TTTGCGGCAA    134940
     CGGGCAGAGA ATGCGGAATT GCGAAGACAG TTAACCCAAT TAGAGGGGGA AGTAGAACAG    135000
     TTAAAAGAAA CCCTGCGGCA GTTGAAGGAA CGCGATAGTG GGAATAGCTC CCAACCCCCA    135060
     TCGTCGGATG GATACAAACG CAAAAGCAAA GGGTTGATGC CCCGTCAACG CAAGCAAGGA    135120
     CCGAAATACG GACATGAGGG CAAAACGCGC CATGGATTTG AGACCGTAGA CCATCGCTTG    135180
     GTGCTTCCCC TAGCGGAGTG TCTGGTCTGT GGCAGTGCAT TAGAACGAGA CGAAACCACC    135240
     CCCGCCCAAC GGCAGCAGAT CGCTGAACTG GTCGAGCGTC CGGTTGAGGT GTGGGAGTAT    135300
     GAACGCCCGG TCTACACCTG TCCCCTTTGT GGCTGGCACG GTTCCGCTAC CCTGCCGTTG    135360
     GGCTGTCGAG AGGACTTTAG CTATGGCGCA CGGTTGAGTA GTTTGGTCGG CTGGCTGGGC    135420
     TACGGTGGAC ATTTGAGTTG GGCAAAGCAA CGGGATTTGA TTGCGATCAT CTTTGGGATT    135480
     CCCTTGTCGC AAGGGAGCCT TGCCAAGATG CATCGCTGGT TCTGCGAAAG TTTATATCCG    135540
     AGTTATGAGT CCTGGTGGAG CCTGATTCAG CAGCCTGGAG TGCGCTGTGT AGACGAGACG    135600
     AGCTATCGCA TCGATGGGGT CAACTATTGG ATGTGGGTGG CGACTTCGAG GGAGGTTTGT    135660
     GTTTTGTTTC TCGCTCCCAG TCGTAGTTCT GCCGAAGTGG CATCCTTGTT GGGTAAAAGT    135720
     TTTGAGGGCA TTCTCAGCAG TGATTGTTGG TCTGCTTATA GTCCCCAGCA AGCCACGGCG    135780
     AAACAGAAAT GTTTGGCGCA CATTCAACGA GAACTCGAAG CCCTTAGCGG TTCACGCTTT    135840
     GAGTCGAATC GGCAGTTCGC AAGCCAAGTC AGTGCGATCT TCGAGCGAGC ACGGCAAGCC    135900
     TATCGAGGCT ATCAGGCGGG CAACTTAACC GTAGAACAAC TCCAGACCCA ACGACTGATT    135960
     TTGGAAGCGG CGCTCACAGA CGTGCTCAAC CATCCACCGA AAGCGGGGTG GGCGGCGGAT    136020
     GCCCAAGCTT TGGCCAATCG CTTCCACCGC TATTGGTCGG ATTGGTTCAC CTTCCTGAGG    136080
     ATGCCAGAGG TCAAACCTGA CAATAACGAT GCCGAACGTG CCCTGCGTCC AGTGGTGATT    136140
     CATCGTAAGA CCAGTGGCGG TGCTAGAAGT GCTTGGGGCG GACAGTTAGT GTCACTGATG    136200
     TTCAGTTTTC TGGAAACGAT GCGACTGCAA GGCAAGAATG CGGTGAGTGA ACTGTTTAAC    136260
     CTACTGGCAG GGGTTGAACG TGCTCCCCCT CAATTGCTGC CATCCACTGC TGAATAAAAG    136320
     CTGAGGTCGG GCTTTTGGGC TTTCTCAATT AGCCCTGCTT CTTGCTGTGA CTAATTACGA    136380
     TTTTCTAAAC AACAAATCTA TTAAACATAA CGCTTGATAT AGCAGGACTC TCCATCCCAC    136440
     TCATGGCGTT GTTCCGTGAT TTTAGCTTCA AAACGGTTTC CGAACGTGCC TACTTTATAG    136500
     TAAGGCTTCT TATAAGATGC GCGACAGAAG ACAATATAGT AATCATCGCG GGTACCCGCA    136560
     GAAGCCTGAA GCGGAACTAG TGTAGGCAAT ACTAGAGTTG AGAAGAAAAG CATACCAGCG    136620
     ACAAGTTTCT TATTCATTGT AGTGACTCCT TAAAGCTTGA TACTCCATAA TGTCGCATTC    136680
     CTGTAAAGAA CGCGATGTAA TCAAGCTCAT AGGCTGATGT GATTTTGATC TCTTCAGAGT    136740
     AGGTATAACT GAAAAAAATG GGGTGATTGG GATCATTACA CCACCATAGT CAGCGAGAAA    136800
     AGGATCGGCT GCAAAAGCTG ATCCTTGTTG AAGTAAAGGG TTATTTGGCT ATGCTCTACA    136860
     CTTCCCGTTC AGTCTTCTAG GCAATCTTAA GGAAAATGAA GCTTAATAAC TTTAACGTGA    136920
     ACTTAGTAGC TAACAGTGAA AGCAACATAA AATGAATCGG AAAAAGCGAT AAGCCTTTAG    136980
     ATCTAATTCC GCCCAAACCT CAACTGGCAC AGCCGTTTCA GAGCGTTTTA GACAAGAACC    137040
     ATAATTTTAT TTCTAAAGTT ATTTAGAATA AGGATTATAG TGATTTCTTG GCGGCAATCA    137100
     TACCCTCACC AATGTGGACA CCAATAAACA TAATTTATTT GCCGCTGCGA TTAAAATAAC    137160
     TGGTACTTGA AGCTGAGTGT TCGGTTAGAA AACTGTCACA ATACAGACTG ATACCTTTAA    137220
     ACGAAGGTGG CAATATTGGG ATTGTGAGGA GTAAGCTTGA AACGCAAAGC CTTTGGAGTC    137280
     GAAACACGGA CAGACGCCCA AAGGCTTTTG CAATTGGATA ATTTCATAGA TCTATAAAGA    137340
     ATCTTAAGGC AGGTATCACT CTCGCTTTTG GCGAAAGATA AAAAGATAAA TGAGCTAGAG    137400
     CTGCCTCCGT ATTAACTTTT CTTCCACCTA TTACATTTAA ATCAAGGTTT CTTATTTCGC    137460
     CTAATCTTTT TCAACCACAG CTCTTGTAAG TCTTTTTCTG TTTTAATCAC AAACACTTGA    137520
     TCGGCTTTAA TACCCATCTG CCGAAGAGCT TCTACATCTT CAGGGTAAAG AAACTCTATC    137580
     CCCTCAGCCT TCACATCTCC AGGTACATTA ATCAAGCTCT CGAGTTTCCT TTGACAGTGT    137640
     TCTCCGGCAT TGATCTGCCC TACCCTCTCC TGTAAGCATT GATCTAAAAG CGTCTGGAAC    137700
     CTGAGCCTGG CAAAATGTAG GGCAACTGGT TCAGGCATGT AGAGCAGACG AGAACCAATG    137760
     ACAGTATTGG GATTGAGTAG CTCACAACCT TTAATGGAGG TACGGAAATA GAGAATGCTC    137820
     AGGTAAGTGC TATTAGGATC GTTTTTCGGG GGAGCATAGA CCTCGTAGTA GGTTGAGCCT    137880
     TTGAAGGTGA ATTGATTGAT TATCCTTGCT TTGGCAAAGG TGTTGGGATA ACAGGGTAAT    137940
     TCAGATTTTT GGCCTGCTAA AAGGGTATGC GCCGCTGGTT GCTGAGTGGC TCCCTCTAGG    138000
     AAGAGATAGA TAGCTATACT CAGCATTGAA CCCAGTGCGA TGAGTAAAAA CGCAACTCTT    138060
     CGTCTTCTCA ACCTTCCCCC TTATATCGGC ACGTAACGTC TGGGATCGAC TGGAGAACCA    138120
     TTTATCCGAT ATTCAAAGTG CAGGTGCGGG CCAGTTGAGT TTCCGGTACT GCCAACCGTA    138180
     CCAATCACCT GTCCCCGCTT CACTGATGCT CCCACTCGGG CGCTGATACT ATTCTGGTGG    138240
     GCATAACAGG TTTCCACTCC ACTCCCGTGG CTGATACAGG TGTAGTTGCC ATAGCCACTC    138300
     ACCCAGCTGG CATAGGTGAC AACGCCACAG TTTGCCGCAG CGATCGGTGT TCCGCTTCCA    138360
     TCACCTAAAT CTATACCGGC ATGAAGCCGA TAAACTCCCG TCACTGGGTT TACGCGCATC    138420
     CCAAATTCGG AAGTAACGGG ACCGGGGGTG GGACGGATAT AGGGCAGTTT CTTCCCGCCA    138480
     CAGTCCACAG GTTGAGGTGG CGGTGAACCA TGCCCAGGCG GCTTCCCCGT TCCCCCAGAC    138540
     AGAGGTGGGG GCTGAATAAA ACTGGAAAGG GGACTGGTCG CACTCAATTT ATCGGGGCCA    138600
     AACAGGATCA GTTCCCCTTC ACGACGAGTT TCCCAGAACG GCAGGGGGAA TGGTCCAAAA    138660
     CAGTGAGCGG ATTCCAAACC GAAGGGACCG CCCACAGAGA AGTAAAGCGC AAAGTCCACT    138720
     TCCCCGGGGT CTTCCTTCAT TTGCTCCACC ACCACCTTCG GATTTTTCCC AAAGGGAAAC    138780
     CGGCCTGTCG GTTCTTCATC GCAGAGAAAT CCATTACCGC CCGGAACCTG TTGTTCTTTA    138840
     GATACCCAGC GAATTCGATT CGTGTCCCCA GCCCAGCGGG TAACTTCAAT ATGAGAGCAG    138900
     GGTCCACCGG TACAGGGAAT ACTCATATTC TTCCAGTTGC CGGAAGCAGT GTTGTCAATG    138960
     TTGAACTCCC GGCACTCGCC GCCGAGCTTG CATGGACTCA TGCCAAAGGG AATATCGAAG    139020
     GGGACAAAAT AATCCTTCAA ACTGAGCGGG TTGATCAGAG GGATCTGGCT GAGGCCGGGG    139080
     ATCTGAGCGA TTTGAGCCTG AGCCCAGTCC GGTAATTCTC CAAGCGGCAA CGTACTGAGG    139140
     CCAGGGATCT GAGAAATGTC AAAATTCACC AGTTCTGGGC CAATCTGTCC AAGTACGCCA    139200
     CCCATCACCG GGGCAAGGTT AGCGATCGTC ACCCACCCGC CATCGGTATT CATTCCCTGT    139260
     ACCTCAGCTA GACGAGCGAT CGGGGGAACG GCATTCACTG GCAACTCTCC TAAACCTGGA    139320
     ATTGCCTCCA CCAGCTGCAG CACTGAAAGA TGATGAACCA GGCTAAAGTC AGCCAGGGGA    139380
     GTATTCATCA CAGGCTGTCC TATCAGTTGC TCAATGTTGG CGATCGAGAG ATTTTGGTAA    139440
     CCAAAGGAGG ATCGCAGCAT TCCCAGGGTA AAGAGGTTTT CTGGGCGAAT TCCGGGTACC    139500
     CAGGACACCG TTCCCCCTTC AGGGGCAGAA AGGGAACCAG AGGATTGAAT GGGTGGAATG    139560
     TCATTCCAGG TGAAGGTAGG AGACCGATCA GCGGAGGGAG CATCCTCAGC ATCAGTGGAA    139620
     AGGGGAAAAA TTGCCCAGGT GATTGTGATT GCCAGACCAA TCAGTGCGGC AAAAATTCTT    139680
     AGATAGCAGC GTCGCATTTA TCCCCCTGCC AGGAAGAGCA ACTGCTCGAT CACCAGCGTT    139740
     GATACCCCAG ATCTGTGCAT ACTCTCCGCC AAGGAGCCCC CCTGCCGCAC TCGCCGGATC    139800
     AAGTCCTGAA CCTGCTCAAC GGTATTACGT TTCAAGCTTT CACGTTTTTG AGCGATCGCC    139860
     AGTCCCCGCT CCAGAGCTTG CACCTGGGGA TTGTCCCCCA CTGGTTTGGT GTTGGGTGAA    139920
     AGTGTTGCTG TGGTTGCAGG GCTGGTGGGG GCGGCTGGTG GGTCGGGGAG GGGAGGAGGG    139980
     GCAGGGGCAG AGGGGGGTTG AGTTTTAGCA CTGGCAGAAT CTCTAAACTG ACCGAGTTGT    140040
     TCGAGTCGAT TCACCAAAGC CATTGAAATT CCCGCTTTTT GAGCAGCTTT CGATCGATTC    140100
     ATTCCACTAT TCAAAAGCTG AAGATACTGG CGCACTCGCC CCTTGAGGAC CGGATCGACG    140160
     AGTAAGGAAC GAGCTTCAGC CTCTTTTGCC CCCTGAGCAG CAGTAACTGC AGCAGGGCGG    140220
     GGAGGCGGGC CGGCAATCCG GTGCTGGGGA ACAGGATCGA CCGCACCAAT CAGAACCTTG    140280
     CTGACCGTGC CACGTCCCTT GCCAATAGAG ATAGGAAAAA TGTAGGAATG GTAGTCTCCC    140340
     TGTGCATCCG TCGTTTCAAC CGAGAGCATT GTCATGGATG CAGTCGGAAT ATCTTGAAAC    140400
     GTGATCCCCG TGGAGCGAAA CAGACGAATA ATCGGACTGG GATTGGGGGG ACAGGATCTG    140460
     GTTGCCAGAC AGTGATCAAC AACAATACGG CTGGGATCAT CGATCGCAAT CTTTTGAATC    140520
     CGTTCCCCAG TGGGGGAGAA ATCAAGAAGT ACTCCACCGC CATCGACGTA GACCGTGATC    140580
     GGCACTTTGC CTTCTTGAGC TGCCTCTGTC GTCACCCGCA AGACTCGCCC AGCCCACGCG    140640
     GGTCCTAGCA TGAAGATCAC TATCCAACAG GAGAGCGAGA TGATTCTGTG GCTAAGGTTG    140700
     AGTGGCACCC GCTGGTCCTC CTTGCTCTTC CTGGGCAGCG ATTGCCGTCC AACGGGCATC    140760
     CGTCTGTTGC GGATCCTGCA ACCAACTTTG TTCGTTTCCT GTAGGAATTG GGTTGGCTTT    140820
     TGAAAGATCT GGTAGGGCAA AGGGCTTGAG GACAGAAACT CGAATTTCAG TTCCCGCTTT    140880
     CAAAACCCAA ACCTCACTCT GCCCGCTTTG CTGAAGCTGC TGAGCTGCAT TGCCCACTAA    140940
     GTTCGTGGCC GCATTTGTCC CGATCGCGGT CAGGTAGCTG GCATTGCCAA ACTGAACATT    141000
     TTGAGATGCA CCTAAGTTCG TCAAGGCTGC ACCGCTGATC AGACTTCCAG CTAACCCACC    141060
     CATCAGGCGC AGGAAAGCAC TGCCTCCCCG CTGGGCAATC AGGGGTGAAC CGTTCGCCCG    141120
     TGAAACTAGA AGTACACCGG GGTCAATCGG GGACTCTGCA TCTCCCAAAA CGATCGCAGT    141180
     TGGCTTTAAC CGAACGACTG CACTGATCCC GGTTGAATCG CGATTGTTGC CCTCTACAAC    141240
     GGTGATGATA CGGGCACCTG TAGGGAGTTG ACCTAGGGGC TGCAGTAACT GAATTTCTAC    141300
     GGGCTGTCCC ACCAGTGCTG CATAATCATT GGCCGTAAAG GCAATGCCAT TGACCAATTT    141360
     TCCCTTGGCT GATTGAGTTC TACGAATAAG GGTTTGTGGT TGGTTATCCA AAATAGCGTC    141420
     TTCCGCTGGC AGGTAGGCCG AGTTCTGGGA CTGGTCAGAT GGGGAAGTTG CAGCCGTAAC    141480
     TGAGCCGGAA GTGGTGTTAG TCGGGGTAGC GGTGACCGCA AGGATGGCAG CAATCCGCTC    141540
     CTGGGGAGAT CGCTCCGTTT GGGCGACCAT GCCTGGTTCA GGATGAGGAT AGGCACGGTA    141600
     AATCCGAGGA GCAGGTGCAA TACCTGGGGG GACGACCGGT CGATAAGGGA CGATCGCTGG    141660
     TGCTGGTGGA CTGTAGGAGC GAACGACGGG CGGGTAGGGA GACGGAGAAT TATCTCGACC    141720
     GACAATGGAG GGTGCAGAGT TTGCCTGGCG GGAAGCGCTG ATCTTTTTCT GGACGGGAGG    141780
     TACGGGTTGG GGGTTAAGTA AGGGATCGGG GGTATCTCTG GCAGCAGCGG CAAATTGCTG    141840
     GCGCATTCCA TTGGTTGCGG CATAGCTGGC CCACTCTCCA TCCGTAGCAG GTCGGGGTTG    141900
     GTCATTTTCA GCCAGATTTG TTCCCAGAGG TTGAGGGGCT TTTGTGGTTA ACTTTGGTCT    141960
     GGGAATGCCA TCTTTGAAGA TCCAGATTGC TCCCAGCGTA AACGGTAAAA CACATAGACT    142020
     AACCATTGCC ATCTTTAACC CCGGTTGCTC CCATGGTTTC ACCTTTGTGC GATCGGTATA    142080
     GGAGTCCTTA AACAGTTCCC CAGCTGCTTC TGTACCCGGG AGTTCACTAT CGAGTTGAAT    142140
     TTCAATTTGA TCAGGGGGTT GAGGCTCCAC GCCTGGGACT TCTGCACCTG TCTGGGCCGC    142200
     AAATTTTTGC AGCAATTCTT GTTTAGACAT CGATCACTCC TGACATAAAC TCAATTGCGG    142260
     GGTACGCCCG GAACTTCCTG AGCCGGACCA ACGGGGAGCA TCGCATCAAT GACAAAACCG    142320
     TCTTTGCGTC CGTACCAGAC CAGATCCTGT CGTTGCTGAT CGTGAAGGAA GAGCCGGGGA    142380
     ATCGGAGAGG CTTTGCGCAC GTAAACGTCC TGGACAAATT CAGCAATTGG CTGTTGTCGG    142440
     GTTCCCAGGG TTTCCGTGGA TGAGAACAGG ACAATATCAG CAGCAACCCG CACCTTCCAG    142500
     CGATCGCGGC TCACTTCCTG GGGATACTGG ATCTTGCCCC GTAGAATAAA TCGATAAACT    142560
     GAGGCCAGAG CGGGTCGGCT GGGATCATTC GCAAAAATCC TTCGCCCCAC ATCGCCATCT    142620
     TTGATCATCT GCGCCAGGTT TCGCAGCATA TTTTCCCGCA GGGGTTCATC AAAAATAAAT    142680
     TGCTCATTGT AGAGGGGGGT TGGAATCTGC ACACTCTCCC CGGTCGAATC GGGAACCGTT    142740
     ATACCGGGAT CACGGAGATA GCTCAGCCCA GTCGGATCAT CAGAATTAAC CAGTAAACCG    142800
     CTCCAGGTAT AGAGGCGGGG AAGCCGATCT TCCAAAAAAT CCACCACCTG ATCTGGAACT    142860
     GCATCAATGT GGCTATCTAA AGGACGCACT CGGGCCATGA CCCCGTTATC CTGCTGGACC    142920
     AGATCGGGGG CAGGCTTGGT TGCTAGAAAA ACCAGGGCTA TCACACCCAC CGTTTGCAAC    142980
     AGCAGCATCG CGGCAACGGC CAATCCAAAC CGGAGCAAGT AGCTGGAGAG TTGAGGTGGC    143040
     AACACAGGCA CCCGTTCTGA AGCAGGCGAA TCGTCCCCCT CCAGGTGGAT TGGAGACAGT    143100
     TCCTCTGGTA GCACCGCTCG GTTTGCCTCA GTGGACTTGC GTTGGTTCAG GTGAGTAAAA    143160
     AACATGGCAA TTACTGCTGA AAACTTGTGC CTGTTTCAGA TAGAGCAAGG GTGGTAAAAG    143220
     CGCACATCAG TAACGGGTTT CTACCTGTAC CTCATTGCTA CGAGACCCAG AGGCAGTGAC    143280
     TCTGGTTGCG GCTCCAGTAG CAGCGGCTCC TGCGGGCCCA GCGATTGCTC CCCCGGCCAG    143340
     CATTGCTCCA GCAGAAACCG TTGCGACTGA AGTTTCGACA AAGCTGGCCC AGATTCCCGC    143400
     AGCACTCCCC CGGGCGATCG CAAATACACA GAACGGAATG ACGATCGCCA TCAACACGCC    143460
     AAACCAGATC GTGTCCGTTG AGGCATCCGC AGACACCACC AGATCACTGG CTAGGCCGTA    143520
     ACCCACGTAG AGCAGCAACC GGGCCAGAAA GATCGTGAAC AAAGAGGTAA GCCAGAGGGC    143580
     AAAAGCAGAG GCGAGAAATT GACTACCCGT GAACAGGCTG GCTGTAACTG CCATGGGTGC    143640
     TGCAATTCCG GCAAAAACGA AGGCAATCCC ATAGAGGGCC TGCCACGCCT CCATCACCTT    143700
     CAGCAAAATC AGAACCAGAA TTCCTTCCCA GATCGGTGAG GTGAAGGTCC AGAAGGTCGT    143760
     GCGGAGCTTA TCCCCGACAT TTGCGCTGGG GTCAAGCCAC TGACCAGCCA AATCGCTCAG    143820
     GCGTGTAATC CAGTCCTGCA ACCAGGAGGC ATTGTAAAAA TCCTGTTTGT ACTCATTCGC    143880
     TAAATTTAGG GCTTGTTGAG AGATATTTTG AAAACAGACC GCCTGTTCCG CCCCAATTAA    143940
     CGCTTCACAC TGTTTGAACA GGGGTGAAAT ACTGGGTCCA ATCAGGGTTC TGGCCTTGCC    144000
     CTCTTTGATC AGGGCATAGA AGTTGGTATA GCTGTCGAAG GTGTTGATAA TGCCATCAAA    144060
     GATTTTGTAG AGAGCCAGAA TAATCTGTCC AATCAGGTAG CCCCCGTTGA ACAAGGCCAC    144120
     CAGAACCAGG ACGGGAGCCA CCAGTCCCAG CCAGATATTC AGATCGTCAT CATCTTTGAG    144180
     CCAGCGCAGA AATCCACTGG CGGCCGGGAA AACGGCAAAG CCCTGAGCAC AGTAGCAGAG    144240
     GTAGGCAAAG GCTGGGTTAT AACTCCCAAA GTATCGCTCG ACAATTTTCT GCTGGTTCTG    144300
     GGCAATCTTC TCAGCCGCCT CTCTACCCCA TTGGGCCAGG TCATTAAACA CGATCGCTTC    144360
     AGCCGGCTGA GGAATACTGA TAAAGGCAAA AAATAGCAGA ACGACGAACA GGTAAAAGAC    144420
     CAGCCGTTTC TGTCGGCGAG GCCTGTGGCG AATCCAACCC GCCGTTTTGC TCCATAGGAG    144480
     CATGGAAAGC CCTGAAGTGC AAGTCATAGT GTAATTCGTG TGTTAAAGAA TAATGAACTA    144540
     CCAGCGGGTT GGGGTTGTCC AGATTGCTTT GAGGGTGCTG ATTGACAGTC CGGCATTTTC    144600
     AATATCCCGT TGCCGACGGG CGGCATCCAT TGAGGCAGAA ATATTGCCGA GCTGAATTTT    144660
     TTGAAACTGG TCATCGACCT GCATCTGCAT TAACACTGAC AGTTGAGCGG CATCGAAGGA    144720
     GGGCGCAATT CCATTCACGA GCAGATTGCA ACGGATGAGT TCCTGAGAAC TCCGGGCTTT    144780
     TTGAGCACAG TTTTTGACCA GGTCTCCCAG GGACTGAACC GTTTGTTGAG CGTTATTCCG    144840
     GATCTGCCTC TGGAGCGCCT GGCCGGCTTT ACTCAAAACG GTTTCCGTCG TTGCCCGGTT    144900
     GATGTCGCGA TCGCTCTGGT TCCCAGCATA GTAGGCCCCC ATATAGGGAT TGGAAGCATA    144960
     AACATCGGCC AGCAACTTGT TTGAGGTGGC TGCTTCATAG ACTTTCCCGC GCACCTCGTT    145020
     CGGGTTAGGA TAGCCTCCGA CTCCCGTTGC CTGTTTGAAA ACCGACTGGT AGGGATTGGG    145080
     ATTGGGACGA CAGGTAGAAG CATAGAGACA GGTTGTAGAG CCGGTTCCCA GCACTCCCCC    145140
     ACCGCCGACC GTAGCACCTG GAAGCGTACC CCCGTTACCA TTCCCGCCGC CAGGGGGAAG    145200
     ATGGGCCAGC AAATGGTCCA GAATCTTTTG AAGCAAACCA CTATTGAGTA GGGTTTGGGG    145260
     ATTAAAGCTC CCATTTAGCA GTCCTGTGAG GATGGAGAGA ATCTGGCTGC CCCCCGGAAT    145320
     CTGGGAGAGG AGCGGGTCAA GCGCCCCCCC AACTGTATTG AGTAACCAGC CAAAACTCAG    145380
     TCCACTACTC CCCAGTACAC CACCGGAATT GAACACAGCG CTCATGACCA GATTGGAGAG    145440
     GTCAATCCCG CCGATGTTCA ACCCGCCCAG TAGATGGGCA GAATAGCTTT GAAAAAAGGG    145500
     AGCAGCGATC GTGAACAGCT CCCCCAACAC GCCACCCAAA CCGCCCAGTT GAGCCATGGG    145560
     GAGGGGCTGC ACCACGGGCA TCGCGCTGGC AGGAAGGGTG AGAAGCTGCA AACCCAAAGC    145620
     AACGCTCAGT CCAGTTCGTC GGATTAGTTG CCCCGCCATC ACAGCCTCCC TGCAGCCTGG    145680
     GACTTCTTAC CCTGGGGTGG TGGGCCCATT GACGCTAGAC TTCCCAAGTT ATTTGAACGT    145740
     TTTCTATTTT TGCGGCTAGA TAGATAGGCA ATTGCCAGTC CCGCCAGAAA GGGGAGAGTG    145800
     GTCGCCCCTG GTAGGATCAG CAGTTGCCAA CCGTAGGTTT TGCCAGTGCA GGCAGTGCGA    145860
     TCGCAGGGGA TCGGTTTCCC AGCTATAGCT ATAACCAGCA ACAGGCTGAT CACGATCGGC    145920
     GTGAGCCCGG TGGTCCAGAG GGCGGAAAGA ACGATTAAAC GGAACATGGA GATTGGGGCA    145980
     TAAACGTCTG AAGGTGGTCC AGAGAAAGAG GAATAACCAG ATCCTGCTCG CTCTGCCAGT    146040
     GATAACGGAA ATAACGGGTA CAGGCAGACA GGGCTTCGTG CTTGTCTGTA AAGTGATCAA    146100
     AGAACCACTG TTTGACGAGG CGCTCGTTGG CATTGGAGGC ACTGAGAACG ACCGACTCCC    146160
     AGGGGGCATA CCATCGCCCA AAGGTATGTT TCTTGTAATC CTGGATCAGC CAGTTCGAAT    146220
     AGCCTTCTTT ACGATTCATA TAGAATTGCT CTGAGGCACA CTGGTTTAGC AGTTGCACTG    146280
     GAATACCGAG GGATTCCGCC AGGGGATCAA CGCTGCCTGC TTCAATCCGA CCCACAAACT    146340
     TGGTGTTCAG GTTGGCCAGC AAATCTGCAC CCGCAACCGA CTGGGCCACT TTTGTAAAGC    146400
     TGTTTGTAAT TAAACCCATC CGGATTCCGG CTTTGCCCCC TGTGGTTGCC AGGTTTGAAG    146460
     CCAACTTCAA CACACCAGCA TGAGTGGCCA GGTTCTGTGC TTCGTCAATC AGGACATGGC    146520
     TGATCGGATG GCTAAGGGAT TTCTGGATCG CCGAGCTGTA AGCAGCCAGA GAGTAGGCCA    146580
     GGGACTCCTG CCCTTCATTC ATATTGCGTA GGGAAAAAAC AGTCAGCAGG TTATCCAGGC    146640
     GCACGGTTGA GGGCAATGAA ATAGCTCGCC CAATGGTCGT TCGCGTATCG GTAATCCGCC    146700
     CCAAATTGAA TTGCAGCAGC TCCAGTGCTT CCTGGACCCG ATCGCCCAGA TTCGCCAGCC    146760
     GAGATTCCAG CTTTTCACGA CTGACAAAGC GGGCAAAGTC TTTCAGGGTC GGAGTCGATT    146820
     GCCAGGCCTG GGACCCAAAG CCTTCCCGGA TCGCTGTGCC ATAGCGGGTC TGGATCAAGG    146880
     GATCTTCGAG GTAGGTGGCG ATCGAGAGTT CCAGGATGGT TCGGGCCAGT TGTTCCAGCT    146940
     GCAGATCCTG ACCGGTGGGT CCCGCCAGGA TCATCAATTG TTGGATCCAG TAGCCGGTGA    147000
     GAGAACGGAG GCGGTCCTGC TGGATCTCCG CCGCCAAGCC TGAGAAATCG GGAATCTGCA    147060
     GCAGATTGAA GCTCTCCAGT TGAATATCAA TGTGGGTACC GCCCATGTAC TGGCAACGAT    147120
     CCCGCAGGGT TGAACTACCG TCTGCTGGCG GATAGTCCAA CCAGGTGACG GGTTGGCCCA    147180
     TGGCGAGGGC ATGGTCAGCC ATGTTGTTGG CCAGCACTGA TTTTGAGCTG CGATGGGCCG    147240
     CCACAATACA CCAGTGCTTT TCCATACCGG GGTGAAAGAA ATCCACGCGA ACGGGTTGCT    147300
     TGTCGGGAGC AATAAACTCA ATCCCCTGCT CATCGTTGGC CAGGGTACGG GCAATTGGGA    147360
     AGAAGGCGAT CACTTCTTTG CTGCCGTAAT AGATGCGACG ATCAAACTGG GCACCAGTGC    147420
     GCTTCACCCG GGCATAGTCA TAGCCAAAGA TCTTGTATTG CAACAACGCA TCGTCATTAC    147480
     AGGGCAGGGT TTGCAGCCAC AGCCGGTGGG TAACGACATA CTCCCGTACC AATTCCAGCC    147540
     AGCGGCAGCG GGAGATGAAA TCCCGGCAGG CCAGATCCAG ATCGGCAAGA CTGCGGCGGT    147600
     GAATCAGAAC ACAGAACCCA ACCCGTAGCG GCGAATCTCC CAGGTACAGC GACCGCAATG    147660
     CGTCCCTGGC CTGTCGAGCA CTCTCATCAG ACGCTGCATC GTAGTAGCGT TTGGATGCCG    147720
     TGGCTTCAAA CTGCTTGATC GACTGGCGAT ATAACTCCGA AGCAGCAGCT CGAGCAATCC    147780
     GGGTATCACT GGGGGTGAGT TGAATGAAAA ACTCGGTGTC CTTACAGGAC TCATTGGCTA    147840
     GCAAATCCCA GAAGACACGA CACTGGTGAT ATTCATGCGC CAGGCTTTTA TATTGCCCGG    147900
     TCGCCCGGAG AATGCCTGTA TAGCGATCGC GGATGTCTCC GGATTCCGGG TCAAACCGCC    147960
     GCGTGTAAAC CCATTCCGGG TCACACTTGA CTGGGTAGTC TTTGATTAAG TGTCCGGTAA    148020
     TATGCAGCTC CCCAGTCAAT TCGGATCGGA GCCTTACCCC CCGCTCATCC ATTCGACAGC    148080
     TGACTCGATT GGGCGAGTGA CCCGCAGGTT CGCCACTGAA ACGATGGCGC AGGTTGGTCC    148140
     AGAGGGCCGC TTCACTCATA GGGCGAACAG CCAGTCCAAA TGTGCCACTG AGGAGGGTGG    148200
     CCGCGGAACG GTAGCCTCTT AAAAAAGCCG TGCGGAACTG TTCCTCCACC GCCGCCAACT    148260
     GCTTTTGAGT TTTCTGACCA GAAATCCAAT CCCTGAGGGT AGACCAGATT TCGTAGACCT    148320
     CTTTACCAAA GGCTTCCACC CGGTCCGCCC GTTTGCGTCC CTGTTGATCC GCCTGAGGTT    148380
     TGTAGGTGAC ATACAGCCGG GCAAATTTGG GTTCCCGCAA GCCGGAACGG GCTAAGTGCT    148440
     GCACGCGTCC AATCTCTGAA ACAAGGAGCT GGTCAATTTC CGGGTTGTCG TTTCGCTCAA    148500
     TCAGTTCCAG CAGTTGCCGG GTTCGATCCT CACTCGTGGC TTCCCCGCCA ATATGCAAAC    148560
     TCCAGACCTG GTAGTAGGGA ATATTCAGTA ATCCTTCCTG CAGCGCGTCA TAGAGACTGA    148620
     TCAGGTTTTG GGCCAGGTCA TAAACATGCG TCCCCTGGAT CTCCCAACCC CAGACAAAGG    148680
     TCCGCGCCGC TGTTCCCCGT TGGAGAATTA AAGCCCCAAC CTTTTCGCCA AACACATCAA    148740
     ATTCGCAGGT GGCTTTCAGG GGCAGGTAGG CAGCGATCGA GGCGTGGGCA GAGTGACCGG    148800
     TAATTTTTAG ATCCAGGGGG TGATCGGATT TATAGCGTTG GTCATCGGGA TGTAACATCA    148860
     TTCCTCACTT CGGGGGTAAG GTTTCCTGGT TGGGGTCGGG GGGCAGATGA AACACCGGGA    148920
     CGGATAGAAA TCGACCAAAA TTAGTCCAGG CTGATTCCTC TCCCCGTCCG GCATAGAGCC    148980
     AGTAGGCCGC AATCACAGAA CTACCGAGAA AGGCAGACCT GAGCTTGTCC TTGCTTAACT    149040
     CAGAAGCAAC AGCCATGACC GTCAGCCCGG CCAGGAGTCC CGGTAATAGA TAGGTCGGAA    149100
     AGAACCCCAG CATTTTTTTC TGTCTACCCA GGGCTCGATT TGGCAAAATC GGTTGATTAT    149160
     GGATGGGCAT GAGCAACTTT TCCACACCTC AAGTCGTAAA TAATCCGATC AGGGCATCAA    149220
     GAATCAGCAT CCCGGCCAGA ATCTGAACAA TTTTGCCAAC AATCTGCCGC ACCCCTTCAG    149280
     AGTCTTCCTC TTGGGCCCGG CCAAACCGCA GGGCTAGGAC CGCGAGAAAG ACCACCGCGA    149340
     TGATGCGAAA GACCGCTCCC ACCCAGCCGG GGATCTGGTC CACCCCCGCA ACCCCAAACC    149400
     GGCCAAATAG GGTTTTCAAA CCATTTTCCA AGGTGTCAAA GAAAAGGGCT TGAGCCGGAG    149460
     CATGGAGCGT CATCAACACC CAGGCCAGCA GTGCTCCAGA ACCGAGTAGG AGGTTGGGGC    149520
     GCAGGGGGCT CGGAACGCGT TGCCAGTTCT GCTGCAAGGT AAATCCAATC AGGGTAGCAC    149580
     TCGCGCAGAC CAGGAGGACA AACCACTCCC CCATCACGAC CCGATAGAGC ACCAGGGCGA    149640
     CCAAAGTTCC CCAGCTGAGG ATAGTGCAGG CAGGCGAGTG GATCAGGGAA CGGCAGTAAG    149700
     TTTTCAACCT GTGCAGAGGG CGATGCTTCC CTCTGGAGGA TCGTAAATGC ATGGTTCAGT    149760
     ACCCGTGGCT AGAGATCTAC TCCAGATAGC GGGTTCATTC TCTAAGCGCA CACCCTCACT    149820
     CAGTCGTCTG CTGCTGAAAT CTCTACAGCT GCTATCGGTG TCCACACCAA ATCCGAATTG    149880
     AGCTGAAGAA GGGAGGGACA GGAGACGCTG AAGGGACTTT AAAGCTCGGT TGTAGGACAT    149940
     TCGGACCGCA CTGGCAGATT TGCCCAGCTC CTGACTGATT TGTACAAAAC TCATACCCGT    150000
     GGTTCGCATT GTGATAATCG CTTGAGTTGC CGTACTCAGT TGCGTTATGG CAATCTGCAA    150060
     GTGCTGCAAG TCCCGATGCA GTTGCTCCAT TTCAAACGGA TCGATCAGTT CGTCTTCATG    150120
     AACCAGTGGG GCGATCGCGG CCACCCGTTC AACTTTAGCC GCCTGGCGTT GCTCTCGGGC    150180
     AAAAACAGCG GTTAGCGCAC TGCGGACACA ATGGCTCGCC CAGGTCACCA GAGCATAGCC    150240
     GGAACTGAGG TCAAAGGTGA TGATCGCTCG GCGGAATCCC TCCAGTGCGG CAGAATAGGC    150300
     TTCACTTTCA TCCAGACCAG GTAGTTTATG GATCTGCTTC CAAAGCCACT GGTGGTAACG    150360
     AGAAAGCAAT TCAGCAAACG CGCGATCAGC AGTGCGTCGG TCAATGGCGG ATACGGAGGT    150420
     CGTCGTCACA CCAAAAAAAG ACTGGCAAAT CTGGATCAAG CGATGATCCG ATTGCAAGGA    150480
     AAAAGATGTG CAAGTCAGCA CAGAACCCTC GATTAGTTAA TTTGTAAAAG TTTTTTAAAT    150540
     CGCTTACAGC GACCACAACT CCCTGGAGAT CAGTAACTCC AAGCAGCTGG GGGAGGTTGA    150600
     ACTCAACCCT GATGGAATAA ACAACCGATC TTAAGCCACT TCAGCAAAAG AGTTGAACCA    150660
     GCGGCTTAGG TCAGGATCCA GACAGGGAAA AGACGATGAC GAAATTTCCT TCGACCGACT    150720
     TCCGTAGAGT TGCGATCGAA CATGAGAGAT TTAGATAGCA TAATGATGGC TCCTTAGCAG    150780
     ATATGTTGGG AGTCAACCTG CTCTGAAGGC TGTAGACCCT CGCAAAGTTT TTCACCTTCA    150840
     GAGTAGGTTT AAATTTATTT GCTACAGGGA ATTCTGAGTT AACCATTGAA CCACTCAGGC    150900
     AACTTGGCTT TTTTGTTCAA TGAGTAACAT TTCGGTCGAT TGTAGGACTC TGTTCAAGAA    150960
     ACTGTCAATC ATCAACTCTG AAAGTTAATA CTGTCTTTAA AGTTAATTTG AAAATTATGA    151020
     ACAAGGGAAC TTACGATTAT CCTCAAAGTC TAAACTGATT TTCTAGTAAC TATCTAAAGA    151080
     CATAGAGTGC TAATTCAAAA TTTGTTAAAT GATTATTAAA ATCTCTATTA TGGTTTATGT    151140
     CACCCAAATC TCATTGTTTA ATAAATAAGA GTCAATCTAG GGAATTCCTG CCTTATGAGG    151200
     TAGCAGTTAT GTGCATTGGT AGTAAAGTAA TGTGGAATTA CAGAGTTTTG AGGTGCCTAT    151260
     TCTCCTCCTT GTAAATTGAT CCGTATGACC AAAAAAGTTC TTACTCACCT TATTAATTAT    151320
     GAATTGAAGC ACTAAGAGCA GCGTTAGTAA TGTATGGATT ACTGCAAAAC ATAAGAATAC    151380
     AGCCACACTT ATGATCCAGC AGTCCATGCA TTAAGGGTAT GTGTATTGCG ATACATATAT    151440
     CTTTTAAGAA CATAAGTTTT CTATATGGCC ACTATAAAGA TGTCTTATTG ACACATCACA    151500
     GATTCATATA CAGCGATACT TTCTATTAAA CTTACTTCAG AGTCTATTTA CCTGGTGATC    151560
     TGATGCCTTC TACAAACCGT AAGCCTAAAG TGGCAAACAC CGATCAACCC AACTCTTTAG    151620
     TTGATCCAAC TGAGATGTTT ACCAGTCCAG GAAAGGGCGG TAGAAAGAGG GTTAGCCGAT    151680
     CGCGGGCTCT CTCTCATACA AAACTACCTT TGTTTTCTCA TAAGCAAGTC GAAATGACAG    151740
     CAACGGGAGC CCCTGTCATT AGTGCAACCC AGGCTTTTTT ACGGCATCCT GATTGGAGTG    151800
     AGTATGAAAA GAATCGCCTT TACTTTCACA GGTCTTTTGG CAAAGGAAGG CACATCGAGT    151860
     TTTACATCCT CAATAAGCAG AAGCACCAAC CAGGGTTTAT TACTAGTTTT GCTGAATCAG    151920
     AAATTCTCAG GCTCTATGGC ATTCATGCTG CTCGCCTTCA TGCTGTTTTC GCAACCTATG    151980
     CCGCTCAGCA AAAAGAACCC TGGAAAGAAA CTTTTATTCT TTTAGGAAGT GACCTGATCA    152040
     AAACATTGAG GATTCATACA GGGAACAGGC TAAAGAAGGC TGATAAGTTA AAAGCGATTG    152100
     CAGACCTGGC CTGGGTCTTA GGCACTTTGG GTGCTAAAAT ACAGTGGCAG GAAGGCTATC    152160
     TGGATTTAAC CATCGTTGAG CGATCGCTAA TCTGGATTGT GAATGTTAAA GAGCAGTACC    152220
     AGAACGACCT CAACGGCAAT CCAGGAGAAT TAATTGAAGT TGAGATTGAG GTTCAGGCAG    152280
     GTCAGTGGAC CCGCAATTTT CTAAATCGCG AAGGAGAAAA GCAACGAACT GCACTGTATC    152340
     AATATGGTTT CATCAATCAG GATATTCTAT CGATTGATCC TTACAAGAAG GAGTTAGCAG    152400
     CTGCTCTAGC ACTTTATTTA ATTCAAAATA GGCGCTCTCA CCCCAGCGGA AAATATCGGA    152460
     TTCAGACCTT ACTAGAAGCT GTTATGTCAG TTCAGGAAAT TAACCTGATT CGAAAAGATA    152520
     AACTTAAACG ATCTCGGTTT GTCAAACGAT TTTATATTTT GCTAGAAGAA TTAACTGAGG    152580
     TTAACTTTAC TATTCAATTT GATGAAAACT TTCCAAAAGA TCTCCTACCT AGCTGGGCAG    152640
     TAATATTAAA GGAAGCAGAT AATGATCTAA TACTTGCAGA TAATGGTTTT CAGGAGCAGC    152700
     GGATGCCGGA TGGCTTCTTC GATACCTGGC TGCAAGGAGT CGTTATCATC ATCCCACCTG    152760
     CACCTGTAGA AGGTGAACTA GCTAGTTTTG AAGCTAGCAA AGCTGAGGTA GTCAAGCAGA    152820
     TAGCCCGACC ATGTAGCAAT CAGCTCTTAC CATCTGGTTC AGCAAGAGGG AGCATCACTC    152880
     CAGAGCTGCT CGATGACGCA ATTTCCTCAA ACCAGTCGCT GACGGGCGCT ATGGTCAAGA    152940
     AGCTACGCCT GCAGGCTGGA CTAAGCCAGA TGGACCTGGC GATCGCAATG GGGATGAGTC    153000
     AAAGTTGGGT TCGCAATATT GAGAACAAGC TACAGGATAA GCCCCTTAAA CCTCTATATG    153060
     CCGAACAATT CAGAAAGGTT CTGAAACTCT CTCTGCAGAT ATAAGCGTGG TAAGTACAAA    153120
     AAGTACTTGA AAACTTCCAC TGGTTGATAC GCGCATTCAT TTCTATTTTA ACGCTTCTGA    153180
     TTAGATACGT ATCATTAAAA TTACAAAGTA CTTGAAAACT TCCACTGGCT GATACGCAAA    153240
     AAGTACTTGA AAACTTCCAC CGGCTGATAC GCCTAGAGCC TTCTCTACCA TCCTCAACTG    153300
     GGAGTGCTTA GGGGGGGGGT ACGAGTACTC AAAAACTTCC ACTGGTTGAT ACGCAAAAAG    153360
     TACTTGAAAA CTTCCACCGG CTGATACGCC TAGAGCCTTC TCTACCATCC TCAACTGGGA    153420
     GTGCTTAGGG GGGGTACGAG TACTCAAAAA CTTCCACTGG TTGATACGCA AAAAGTACTT    153480
     GAAAACTTCC ACTGGCTGAT ACGCCTATTC ATTTTGCTTT AACTTTTCTG CATATATTCA    153540
     TATCAATAAA ATGAAAAAGT ACTCAAAAAC TTCCACTGAG TGATACGCAA AGGAGATTTT    153600
     AAGTACTTTT TTAATAAAAC CTGGATTTAT TGCCTGATAA GACTTGTGGG CTTTCTCCCT    153660
     CTATTTTTTA GTACTTAAAA GTACTCGATT TCTTCCACTG AGTGATACGG AAACTTCCAC    153720
     TGAGTGATAC GGAAACTTCC ACTGAGTGAT ACGCAAGATT TTTATAACCC TTATGTAGCA    153780
     ATCGTTTCAG GCTTTAGTAC TCGCCTGATC ATATTGATCA ATTTGATCCA ACCGGATTTT    153840
     CCGGCTCTAA AAATCGAGCA TGCTAACCTT TTAATTCAGA AATTGGAAGT TTCATCCTAG    153900
     AAAGTTATGT CGGTCTATCA TCTAGTCAGT GAACACGGAA ATGCAGTAAG GCCGCCCTTA    153960
     GGGAATCCTT TTCATCCCTC TATATGTAAA TCTCTACCCA TTGGTTCAGA TTGGTCAGTT    154020
     AGGGTGGCAG CAGATCATGT TCAGGAATGG CGGGATTGTG GTGTTGACCC AGGAATTATC    154080
     GAACTTAACG TTGAGACTCT CGACGATACT GCCATCAACG ATTACTCAGA TAGTCTCTTC    154140
     CCAATTGCTG AGCGGCTTAA CTGGAAAATT ACGCGATTTG GGCGGAAAAC CCGTTCTAAC    154200
     CTTCGTGGCT GGTGGGTCAG TGGCATAGAT CCCCTTAATA ATTGGAAGCG TATGGAATGG    154260
     GGACGCTTCA AACCTGATGC TTCAACCCCC GTCATCGATC AGGAAAAAGG TAAACCTGCT    154320
     AAATACCTCA GTCCTAGCCT TGGTCCTGGT TCTAGCCGGC TAATTCTGCT TGATGTCCCG    154380
     CAAAGCATTT GGGAAAAAGT TGCTGGACGA TATGGAGTTT CCATCGTCCC TACTGATCTC    154440
     ACCAATGGTT TCTGGCACTG GGTCTGGAAA TCCAACCTTC CCATTATTGT AACAGAGGGA    154500
     GAAAAGAAAG CAGGTTGCTT ATTGACCCAA GGGTATGCTG CGATCTCCCT TCCAGGTATC    154560
     TTCAATGGCT ACCGTAAAGA CTCTAAGAAG CTGATCCCAG AATTGGCTCA TTTTGCTACA    154620
     GCTAAGCGTT CAGTGTTTAT TTGTTTTGAC CACGAAACCA AACCTAAAAC GCTTAAAAAC    154680
     CTTAACCTGG CCATTACAAA GCTTGGCAAA CTACTTGAGC GCGGTGGCTG TAGCGTCAAA    154740
     GTTATTTCTT TACCAGGTCC ACAAAAGGGG GTAGATGATT TTATCGTTGC ACAGGGGAAT    154800
     CAGCCCTTCG ATGCTTTCTA CGAGTCTGCC TTACCACTTC AATTCTGGGT TGCATCTAAA    154860
     CTCTGGTCTC TTACCTATCA ACCCACATTA ACCCTGAACA CCCCTTATCT GGGCAAACTC    154920
     CCCTATCCCA GTTCTGGTTT GGCATGCATT AAAAGTCCGA AGGGCACCGG CAAAACAACT    154980
     GCACTACAAG ACCTGATCCA AGAGGCTATC AACTCTGGAC GCAAAGTCCT GGTTATTACC    155040
     CACAGAATTC AGCTTGGCCG TGCCATCTGT TCAAGTATCG GCATTGACTG GATTGAGGAG    155100
     GTGAAAGAGT CTGAAACGGG GGGTTTATTC GGCTATGGCC TGTGCATTGA CTCTCTACAC    155160
     TCTACATCTC AGGCTCGTTT CAACCCCCAG CTTTGGAAAG GAGCAATCGT TATCCTCGAT    155220
     GAAGTAGAGC AGATTCTCTG GCATGCCCTT AACTCCACTA CCTGTTACGA ACATCGGGTT    155280
     AAGATCCTTG AGGCTTTACG GGAACTTGTG GAGGTGGTTC TCAGTAGCAA TGGACTAATC    155340
     GTTGCTCAAG ATGCTGACCT TTCCGATGTC AGTATTGATT ATCTTAAGGG ACTAGTTGAA    155400
     GCACCCATGG AACCCTGGAT AGTAGTAAAC CAGTGGAAGC CAGAATCTGC TTGGAACGTG    155460
     TCATTTTACG ACACAAAGAA TCCGGCTAGC ATGATTTCAC GGATGGAAAA ATTTATTGCC    155520
     CAGGGAGCCA TATTTGTCGC TGTAGATTCA CAAAAAGTTA GCGGCAAGTG GAGCTCAAAA    155580
     AATCTAGAAA CTTATTTGCA AACTCGCTAT CCTGATAAAC GTATTCTTCG TATTGATTCT    155640
     GAAAGCGTAG CTGATCCGCA ACATCCCGCT TATGGAATCG TAGAACAACT GAATCAAATT    155700
     ATTACGAACT ATGACATTGT TTTAGCTACC CCAACGATCG GTACCGGTGT TTCAATCGAT    155760
     GTCCGTGGGC ATTTTAAAGC CGTATTTGGC ATCTTCCAGG GAGTAACACC TGATGTTGAA    155820
     TCCAGGCAAG CATTAGCTCG AGTCCGAGAA CCAGTACCAC GTCTGGTTTG GTCAGCTCGT    155880
     TTTGGCCCAG GAAAAGTAGG CAACGGCAGT TGTAGCTATC AAGATGTCAT TCACTCCACC    155940
     ACCAAAAATG TAAAGTACAA TATTACCTTA CTTAAGGAAG TAGATTTTGA CATCGATGCC    156000
     CAAACAGACC CAATTACTCT GCGAACCTGG GCTAAGATGG CAACCCGGGT CAACGTGTCA    156060
     TTGTGGAATT ATCGTAATGA GTTCCGTAAC GGCTTACTTC TGGAAGGGCA TCAGGTTACA    156120
     ACGATTACCG ACGATCTTCT GAAACTTCTG CCTTCAGAGT TTCAGTTGCA ATGCAGTGAA    156180
     CTTCTAGAGA CCCTTGAAGC TAAAACAATT GCTGAGGTCT TGAAAGAAAA ATTACTTACG    156240
     GGTGTGCTGA GCTTTCCAGG TGTTGAGTAC TTACACTGCC AGCATGATGA ACGCCTTGCC    156300
     GACTCTATCA TGCAGGAGAT CAAAGGTATT CAAGAGTATA GCCGCCTGAC TGAAGCACAA    156360
     GCCGTTGCCA GTGCCCCTCT AATTAGCTCA GCCGAATACG ATCGCCTCAA AGATCAACGC    156420
     GCAAAAACCA GTGACGAACG CTATGTCCAA CAAAAACATG AGTTACAACG TCGTTATCCT    156480
     ATACCCGTAA CTCCAGAATT AAAGATCAAA GATGACGGAG GCTGGTATTC GCAGCTTCGA    156540
     CTACACTACT ACCTAACCCA TGACCCAGTG TTTGTCCGTT TGCGCGATCT CAAGGAATGG    156600
     CAAGGACATC TAGATCGTGG GAATGGCAAA GTTTCGTTAC AAGATATAAA ACTGCTTACA    156660
     GCTCAAGTTG AAACCTTCAA AGTCTTAGGG ATACTCAACC TTCTGAATCC ACAACGGCTA    156720
     ATCCGAGCAA CTGATCCAGA CATTGAGCAA CTTCGCCTCA ATTCAATTCA GTATCGTCAC    156780
     GACATTAAGG CCCTTCTGAA TCTCACCATT TCCGAAAAGA TGAAACCAAT TGAGGTTGTA    156840
     CAAGCATTAC TTAGAAAATT GGGGTTGAAG TTAGCTTGTA TTGGGAGAGA TCTTAAAGAT    156900
     GATGGACGGC GATGTGGTTC TAGAATCTAT CAATTTCAGA CACCGAAAGA TGAGCGAGAA    156960
     AGAATTTTTG CTCAGTGGCA GCAGAGAGAT GCTATAAACC CAGTCGATCA CGTAGAGGAA    157020
     GGAAAAGGAG ATAGTCTGCT ATCACGAAAT ATTATTGATA TAATTCCTGT AGATCCACCC    157080
     CCTGATATAT ATGATTTAAG TCAAGGATTA GGTGGATTTA GCGAAGTGCC CCTGAAACAA    157140
     CAACAAAAAC AGGTAGCCAG TGACACAGGC GAGGAAAAAT GCTTTATGGC AGAAAGAATT    157200
     TACGCCCAAA TGGGTTGCAC TACCAAGTTC CTATTCCCAT CCATTCAAGT TGGCAGTCTC    157260
     GTCAAGTATA TAGAGCAGTC TTGTTGTTGG GTTGTACAAC AATTGCAAGG AGCTACCGCT    157320
     GTAATCAAAC AAATTCATAG CACAGTTGAG CGCACAGTGC CCTTAAGTAA TCTGACGCTC    157380
     ATTGTTGCAA AGGAGGACCT TGCTGATTCA ACTAGTTAGG CGAAATTCAA AGGGATTGAA    157440
     TTGGTATATC TGACCCTTTT TAATGCTTTA GTGTATTGAC TTCAAGTTAA TAATTTTTCT    157500
     TGCTCTGATT TGCATTTCTT ATGTATAAGA AAGTAAAAAA TAGAATTTCT ACATAAGACA    157560
     ACAGATATGA ACCGAATTTA ACTACCTCAG TCAAAAAAGT AAAATTCAGT ATTCTTCCTT    157620
     ATGCTTCCTT CAGATTTGTT AACTGCCTTA ACTAATTTAA CTTTAGAGCA AACGCAGGAA    157680
     TTGCTTCAAT GGCTAAAAGA ACAGATAAAA CTCCAGAAGC GGGCCGAATG CCTTCAAAAA    157740
     AAAGAACATC AGCAGCGCGT AGCCCTTGAA AAACACAAGT TATCGGATGG TATTACATAT    157800
     CAACTGGAGT TGGTTAATTG TGGTAAGCAA AGATGCCAAA AGTGTGCTAT CGGTCCTTCC    157860
     CATGGTCCTT ACTGGTATGG CTATTACTGG GATTCCAAGC GCAAGAAGAT GGTAAGCCGA    157920
     TATCTAGGCA AAAAAGCTCC TCTGGATGGA AAAGACTGAG ATTCATGATT AAATTTATAG    157980
     GCGTAGGATT TAGTCTTATG TAGACCACAT CTTAAGTCTA CATAAGACAT AGCCTCGTAG    158040
     CTATGCCTTC ATAGGAATGG GTTGAAGGAG CTATAGCATT ATTTATGGTG GAAGGATTAT    158100
     ATTCATTATT CTACAAATTT CTAAAAAGTC TAGATTGCAT AGAGCCGGTT TCTGCTGCAT    158160
     AAATTGCTAT AGGACAGTAT CTCGTGCCTG ATGAGTAAGA TCGATCTTAC TCAAAACCGT    158220
     ATCTTAATAA AGTGGAGGCG TTCAGCTTTT GAAATGGCTG GTTCAGAACT TTACGGAGGT    158280
     GCTTGAATGA GGGTTTTAGA ACAGGAGGTC AAACCAATTA ATTCATCCTT GAAACAGATT    158340
     GTTCTATGGA TCGGGGCTAA TGCTGGTGGG GTGAGCAAGA CAACCTTAGC TATTCACCTT    158400
     GCGTATGAAA TGGCGAACCG GGGGATGTCA ATCGCAATAT TTGATCTAGA CACGAATGTG    158460
     AGCATGTCAC AGTTCACTGG TCTAGGTAAA AATCCATCCT GGCAGGAAAC ACTTGCTTAT    158520
     GTACTGTCTG AAGATTTTAA GGGAGACTGG CCATTGGCAA CACCGAGTTG GGGGTTAAAC    158580
     CAAGGGAAGG TGCAGATTTG CCGAGGTGGC CCAGTTATGG CAGAAGCTAC TATTGATCTC    158640
     ACCTTGCGAA AGCGGCGGGA ATACCTTTTA CGAGATCGCC TCATTGATTA CCCTCTACCG    158700
     CATGATCTCA TTATTCTGGA TTGTCCTGCT ACTTTAAGTA ACCTTAGTGA TGTTGCCCTT    158760
     GTTGCCGCAA CTCATCTTCT AATTCCACTT GAAGCAACAC CCAAGAGTTT TTCTGGCTGT    158820
     GACGCTTTAC TCACTTGGTA TCGGGTTACC TGTCGTCAGT TGCGTTTGCA ACCCACACCT    158880
     CCAATTTTAG GCATTGTGCC AGTACGATAT GACTCGTCTG AAGCGATTCA GCGGGATTAC    158940
     TACGCTATGC TGCCTCAGAT GCTACAGCCT CAAGGTATTA AATGCTATTC CTCTATCCGC    159000
     TATAGTCGGG AATTTATTAA TGCTAGTGAA CATGGTGTTC CTTTGCAAAT CTATCGACCT    159060
     AACCATAAGG CTTGTAGTGA CTTTCTGTCT ATTTGTAATG ATTTGAGTCA ATTGCTGGAG    159120
     AGTGAGTAAT GATGGCTAGA GCAAGGACAG CAGATTATTT CTCAATGAGT AATCAATCGA    159180
     TTGAGCTAGA GGCAGCACAG GAAAGGATTG CTCAGCTCGA AACGTTAAAT GCCCAGTTAC    159240
     AGTCGATGCT AACAGAAGGA ACTCCTCCAA CTGAGCAACA AACTCTCAAT GTTCCAATTG    159300
     ACCAAATCGA TCGCTATCCC GAACAAGTAC GGCAGTGGTT TGACCCAACC GAACAGGAGA    159360
     AGTTAACCCA ATTGATCCAG CAAGTTGGAT TTATTGGTCG AATCTGGGTA AGACGATTGT    159420
     CATCAGACCG TTATCAGCTA ATTGCTGGAG AAAGACGTTT GCGTTCCGCA ATCTCTGCTG    159480
     GTTTGACTCA TATCCCGGTT GAGGTTCTGG ATGTAGATGA TGAAACGGCA TTAATGCTTT    159540
     CCCTGCTAGA AAACCTAAAC CGTGTAGATC TAAATCCAGT TGAAGAGACA GAAGGGATGC    159600
     TTAGATTGCT GGCTTCCCGG CTAAACTATG AAGTTTCTGA AGTTAAATCG CTCCTCTATC    159660
     GTATGAAAAA TCACTATGAA CGGGGAGAAG AAGCTACACC CTCAGAAGCA GAAGCATTTG    159720
     CCATGATCAC AAAGATTTTT GACATGGTAG GACGGGTAAA CTGGCAATCT TTTATTACCA    159780
     TGCGGCTCAG ACTTCTCAAT CTACCTTCAG AAATTTTGGC AGCCCTTCAG CAGGGCAAGC    159840
     TTGAATACAC TAAAGCAACC GTGATTGCTC GTATCAAGGA CGAGGATTCC AGGATACAGC    159900
     TTTTGAATGA TTCTATTGCC TTTAACTTGT CACTATCAGA AATTAAAGAT CGAGTTAGAG    159960
     CACTGCGTCC AGAAAAGCCT ATCTCTCTCC GTGATGAACT AAAGCAGATA GTCAAGGTGT    160020
     TTCCTAAGCA GTTGAATGAT CCCCGCAAGG CTAGGCGTAT ACAAAAACTG GTTGAGGAAC    160080
     TACGGGTAGC TATTGCTGAG TAAGATCGCT CTACCTCAAC TTTCATACCT AATCAAGGAT    160140
     TGAAAATCAT TGGTCATACA TTTGCTATTT TGAGTAAATT AAATACAAAG CTGTTCTGCC    160200
     AAGACCTCCC GTGTCACAGA AAGTATCCTC GCATCAAAAA AATTGTCGAT CTACCCCTGC    160260
     ACACTGTTTG GAAGAGGATT TCCGGGAGAA AGTGCCTTCA TTTGAAGATC GCAGGGGTAG    160320
     ACATGGACAG GGGGGTGTCC AGACGATAAG CCCTAAGCCT AACCCCCATA TCCAGTTTTT    160380
     GCAACGGAGC TAAACGGTGC AGAACTGTTG TTGATCCGAC TATCCTAGAA CCACTGATAT    160440
     GACCCACCGT AATGCTGAAC CTTCCTCAAC TGCTGGCAGC CGAGCTTAAA CTCAAACCGT    160500
     TTCAGGTGGC TAATGCGCTC GAACTCTTGG CAGAAGGCGC AACGGTGCCA TTTATTGCTC    160560
     GCTACCGCAA AGAGCGCACA GGGGAGATGA ATGAAACCCA ATTGCGGGAC TTGTTCGATC    160620
     GCTATACCTA TCTGACGGAA CTGGAAGAAC GCAAAACAGC GATTTTGGCA GCCATTGCCC    160680
     AACAGGACAA ACTCACCCCG GATCTGGAAG CAAAAATTGC TGCCTGCCAG CAGAAGAACA    160740
     CCCTGGAAGA CCTCTACCTG CCTTTCCGTC CCAAACGTCG CACCCGTGCT ACTATTGCTC    160800
     GGGAGAAAGG TCTGGAGCCC TTAGCCAACT TCCTCAAAAC CCTCAACCAC CCGACAGCCG    160860
     TGCCAACGGA TCTGGCGCTC GCAGCAGCGA AGTATATTGC TGAAGCCAAG GGTGTGCGAA    160920
     CGGCAACCGA TGCCCTCCAG GGGGCCTCAG ACATCTTGAG TGAGGAAATT GCCGACAAAG    160980
     CCAACCTCCG GGCTTACCTA CGCGACTATT TGCTGACCAC TGGTGTGTTG AACGCCAAAG    161040
     TCAAAGGCGG CCATCCCGAA GGGACAACCA GGTTCGAGAT GTATCGCCAC TACCAGGCAC    161100
     CCATAAAAAC AATCCCCGCC CACAACCTGC TGGCCCTCTA CCGGGGCGAA GCCGAGGGTG    161160
     TGCTGGTCGT GGAGTTGACC TTTGATGAAG CCGCTGTGCT TGCCGATCTC GAATCCCAGG    161220
     AACTGCGGGC CAAGCAGCAA GAGGTGCGGG ACTTTTACCG CCAGATGCTC AACGATGCCT    161280
     TCCAGCGGTT GTTGAAAAAC TCGTTAATTA CCGAAGTCCG CTCGGCCAAG AAAGTTGAGG    161340
     CGGATCTGGA ATCCATTCGC ACGTTTGAAG CCAATCTGCG CGAACTGCTG CTGGCAGCCC    161400
     CGGCTGGCAT GAAATCCACG TTGGCGATCG ATCCAGGCTT CCGCACCGGC TGCAAGGTGG    161460
     TCGTTCTTGA TCCAACGGGC AAGTTTCTCG AATACCAGAC GATCTTTCCC CATCAGTCCG    161520
     TCGAACAGCG GCAGAAGGCC GGACAAACCC TGCTCAAACT GATTGACCGC TATCAGGTCG    161580
     AGCTGATTGC CGTTGGCAAC GGTACGGCGG GGCGGGAAAC AGATGAGTTT GTGGCTGAAC    161640
     TCCTGCAAAC GCTGGAGCCC AAACCCGTCA AAGTCATGGT TAACGAATCC GGCGCCTCGA    161700
     TTTATTCGGC CAGCCCGGTC GCCATTGCCG AGTTTCCCGA GCAAGATATC ACCGTCCGCG    161760
     GTGCCATCAG CATTGGTCGC CGTCTCCAAG ATCCCCTGGC CGAATTGGTC AAAATTGATC    161820
     CCAAATCGAT TGGCGTCGGG CAATATCAGC ACGATGTTGA CCAGAAATTA CTCAAAAAAA    161880
     AGCTGGATGA AACCGTTGAA AGCTGTGTCA ATTATGTTGG GGTTGACCTG AATCTGGCCT    161940
     CCAAAGAGCT GCTGACCTTT GTTTCCGGGG TCACCCCGAC GATTGCCGGC AATATCATCA    162000
     CCTATCGCAA CCAAAACGGG GCATTTAGCA ATCGGCGCCA ACTGCTGCAA GTCGCCAAAC    162060
     TGGGGCCCAA AGCCTTCGAG CAAGCAGCAG GTTTCCTGCG AATTCGCAAC GGTCAAAATC    162120
     CGCTCGACAA CACGGCCGTT CATCCGGAAA GATACAACCT GGTCGAAACC ATCGCCCGAG    162180
     ATCTGGGGGT ACCCTTAGCC CAAATCACTC AGGTTGCCGA GCGGCTCAAC AACACCGACC    162240
     TGAAAAAATA TGTCACCGAT ACGATTGGCG AACCGACGTT GCGCGATATC CTGGCAGAAC    162300
     TGGAGAAGCC GGGGCGTGAC CCGCGAGCTG AGTTCACCTT TGCCAGGTTT AGAGCCGATG    162360
     TTAAGGCAAT CTCGGATCTG AGCGTGGGCA TGCAACTGGA AGGAATGGTT ACCAATGTTG    162420
     CCAACTTCGG GGCTTTTGTC GATATAGGCG TCCACCAGGA TGGACTGGTC CATGTCTCGC    162480
     AACTAGCCGA CCGCTTTGTC AGTGACCCCA AACAAATCGT CAAAGTCGGT CAGGTCGTCA    162540
     ACGTCCGGGT TCTGGAGGTG GACGAAAAAC TGAAGCGGAT CAGTCTTTCG ATGCGCTCAG    162600
     ATACGCCGGA ACGGCAGGGG CAATCGCCCG TCTCTTCCCC AGCGCCCAAA TCCCAGCGTT    162660
     CTCAGCCCAA ACCCAGCGCT GGCAAACCCC CCACCTTAGA AGACCTGAAA GCCAAATTTG    162720
     GCAAGCACCG ATCGAGAGGG TAATTGTTCT TAAGGTTGAA TTCCAGTTTT TGCTAGGAAA    162780
     TGGAATTTCC CAGCGATAGC GAAAGCGGGC TCACTGTGCT GAGCTATTTG CCGGAACGTA    162840
     ATGTCACTCC ATGCCCGATC GCTCCGCCTA AAAATTTCTT CAGTTCACGT TGGTGCGCTT    162900
     TTTCAGTATT GGCTGCTAAC GATGGACCAA CGGGGGCATT TGAGCTGTGG GATTGCCGGT    162960
     ATGTTGGTCT GGCAAAAACT CAGTTGCAGC ATATCATCAC AGCAGCAGCC ATTAATGTTG    163020
     TACGGGTAGC AGCCTGGTTA AGTGGGAAAC CCTTAGCCCA AAGCCGACAA TCTGCTTTTA    163080
     TGCGACTGGC ACCTGCTAAA ATAGCTCACA CAAAATATTA AGCAATGTTT CGCCAACGGT    163140
     ATCAAAAATG GACATGAGCC CGAAGCCGTG TAAATACAGC AACCGCCATG ACTTCCAAAG    163200
     CCGTTGCCAT GTTGCTGTCA GATTTGGGCG TCACCAAAAC GCATTCTCGT CCCCATGTCT    163260
     CCAATGACAA TCCCTACTCT GAAGCCCAGT TCAAAACCCT CAAGTACCAG CCCCAGTTTC    163320
     CCAAGCAGTT TGGCTCGCTT GAGGATGCCC GCACCTTTTG CCAAACCTTC TTTGATTGGT    163380
     ACAACCATGA TCACCACCAT AGTGGTATCG GCTTGTTAAC ACCAGCGATG CTGCATTATG    163440
     GTCAAGCCGA AGTCGTAACA CACCACCGTC AGCAGGTGTT GCAAGTGGCA TACCTCGCCC    163500
     ATCCAGAACG CTTTGTCAAC GGCTTGCCCC TACCGCCTGC TGTGCCGACT CAAGCGTGGA    163560
     TCAATCCGCC CTCCCCAACC AGCCCTGCTC CCCAAGAGCA ACACTAATTT CCCACTCTAC    163620
     TCTGTCTCAT TCTTGTTGAC ATATTCCGGA TTAGAGCAAA TAATTTTTGC GGCTCTACCG    163680
     CTGGAAGACA GTGATAGGGC TGATTGGAAA GTTTGGATTG CGTTTTTAGG CTATTCGATC    163740
     GGGCGTGAAC ATCTGATTCA ACAGCATCAA AAACACTATG AGTGCATCCG GCAGATTCTT    163800
     TATCAGAAGT TAGCAGGTTT GCAGGCAGCT AAACTGATTC GAGCCAATTT GGATTTAACC    163860
     CTTGAAGCGA ATGCCCTCAT CGCCTTAGTA GATGGCATTA GCACTGGGAG CCGTGATCTG    163920
     CCCTGAACAG TTTTCAGCAG AGCAACAACG CTATCTTGTG CATCAACATA TCTATGCTCT    163980
     ATGCGCATTA CCTTGAACTA TGCGCATTAC CTTGAACAGC CATTACTCTT GCTGCAACAC    164040
     CACTTTCCCG ATCGTTTCCC CCGCCTCAGC CCGTTGGTGT GCTGCTGCTA CTTCAGAAAA    164100
     CTTGAATCTT TTGTCATCTA ATAACGGTTG TACCTGTCCG GCATCGGCTA ACTGAGCTAG    164160
     TTGGGTCAAG ATCTCTCCAT GCCGCGATCG CCCTACCCTG TACAGCAGTG GAATCAGCAT    164220
     ATAGACCAGA TGTAGGGTCA GTCCTTTTAC GTGCAGTAGA GTTAAATCTT GCTGAGACAG    164280
     GGAGACAATT GAGACCACTG TTCCATTTAG CTTCGCGGCT TTGAAGGCAT TTTGCAAATT    164340
     GTCATTTCCC ACGGTATCGA ACACCACATC AAATCCTTGC CCATTGGTGT GTTCTGCCAC    164400
     AAACTCTTCA ACCGGTTGTT GACGGTAGTT AATAGTGAAG TCGGCTCCGA GCGTACGAGC    164460
     GATCGCTCCT TTCTCTTGAC TCGATACCAG AGCATAAACT GTCGCTCCTG CCCACTTCGC    164520
     CAGTTGTACC CCGATATGCC CGACACCGCC CGTTGCGCCA TAGACTAGCA CCCGCTGTCC    164580
     GGGTTGGACT TTGGCGCGCT CGATTAGCCC TTCCCAGGCA GTGATTGAAA CGAGGGGTAG    164640
     AGCGGCGGCT TCTGTCATCG TGAGTGACTT GGGCTTATGA GCCACGAGAT CTGCATCTGC    164700
     CAGCATATAC TCTGCTATTG CTCCTCCCAA GCCTTTCACC CCACCTGCAC AGGCATAGAC    164760
     TTCATCTCCT GGTTTGAACA TAGTCACTCC CGCACCGATC GCCTCTACCA CTCCGGCAAC    164820
     ATCTCCATGC AACACAGCCG GAAAATCAGG AGCAATATCT GGAACTGCGC CCTGGCGAAT    164880
     TTTGTAGTCT ACTGGATTCA CGCTGGTTGC CATAACCCGA ATCAAGACAT GATTGGGTTG    164940
     AACTGGAGGA ATGGAAATGT CTGCCGTTTC AAAAACAGCA GGGCTACCGA ACTGGGTAAT    165000
     GATTTGGGCT TGCATGGCAA TTGACCTCAG AATTCATATT CCATGAGTAC CATTGGGATA    165060
     TTGCTGCCCG AAAGGATTAA CGGCAAAGTG CATTAGTTAC TTTTTGGTAA ACATGGTGAG    165120
     CAAACTGAAT TCTGACGCGC CCCAATTGAA TTACTTGCCG CAGCCTGCGC TCGATCGCAT    165180
     CGCTAACATG AACCTGTTTG ACACCAGCTG TGCAGGGCAT CAAATGCTTG AACACATTGC    165240
     AAACAAGTGG ACAATGTTGA TTGTGTACGC TCTAACACAG GGAAAAAAGC GCTATAGCGA    165300
     ACTTAAGCAG CAGATTGTTG GCGTATCTCC CAAGATGCTG ATTCAGAATT TGCGGAACCT    165360
     GGAGCGATGT GGATTGATTG AGCGAGAAAT TTATCCGACC GTTCCACCAC GGGTCGATTA    165420
     CTCGCTGACC CCCTTAGGAG AATCGCTGGT AGAACCATTG GCGATCTTGG GAGAGTGGGC    165480
     ATATCGTCAT ATTCCAGAGG TCAAGGCAGC AATGGAGCAG TATGACGATA ACACTAAAGA    165540
     AAACTACTGG AAACCCAAGT AATTTAGCAG CAGGTTTATT CCAGGGCAAC AGGCTTTAAC    165600
     TCTAAATACG ATCGGACATG CATCGGCAGT GTAACCGCAA GATTTTGATA AAACAGCGCA    165660
     AGAATTGGAC TTCAAGTTTG AGGGGACTTT TTCTAATCTT GAGTTATTGA AACCCAACTC    165720
     AAGCCGAGAA ATGAACCATG AACGTTATTC AATCCTTAAT TGCAACTGGC ACAATCACGG    165780
     TTGCCTTCAG CACGCTTTCA GCGAACGTTT CTCTCTCCTA TCTCCCTATT GCCCTGGCAG    165840
     AAACAGTGAA CCCTGCCCTA GTGACAGTTG GCTCCTCACA GTTAATGGCT AAACTCGGGT    165900
     AGCCTCAGAA AACGGAAAAT ATAGCACGCT AAGGATTTGC AGAGGCCGGA ATCCAGCGGT    165960
     ATAACGTGGG TACGGATATA TCTAGGTTTT TGGCTACATC CCGAGGTGGT ACCCCATTAG    166020
     CCAGTAATTT TTTCGCCGAT TCAATCTTAC TATCGGTCAT CCGACGCTTG CGTCCACCCT    166080
     TACGCCCGAG TTGACGAGCG GCTTCTAAGC CTGCACGAGT TCTCTCCACC GTTAGTTCCC    166140
     GTTCCATCTC CGCTAAGCTG GCCATGACAT GAAAAAAGAA TCGGCCCGAT GGAGTTGCCG    166200
     TATCTATCGC GTCCGTGAGG CTCTTGAACT GGATATCCTG CTGACGCAAT TCACCCACCA    166260
     GATCGACTAA GTGTTTAACG CTGCGACCTA GCCGGTCTAG CTTCCAAACG ACTAGGCTAT    166320
     CTCCCTGCCG AAGCATTTCC AATGCCTTGG CAAGTCCGGG TCGCTCTGCT CGGCTGCCAC    166380
     TGCTCTTGTC GGTAAAGACT TTGTGGCAAC CTGCCTGAGT CAGTGCCTCG ATCTGCAAGT    166440
     CCAAGTTTTG GTCATGGGTG GAGACACGCG CATAGCCAAT TAACATGGGG TTCCTCCTTA    166500
     TCAAAACTCA TTGAGAGGGC AGGGAATCAA GAATAATGTT TCAAGAACTG TTTGTGAGAA    166560
     TCGGAAAGCC TGGATGTGGT GTGCCACTGG CGGACTAGAA AAGGCTTATC AAAAACCCAC    166620
     GTTTTTAAGA GGCGCATCCA TGCCCCGTCG TTCCATTCTG TCTGCTATGG AGCGAGACAG    166680
     TCTGCTCACC CTCCCCGATG CCCAAGATGA GTTGATCCGG CACTATACGT TTAACGAATC    166740
     TGATTTGTCT ATCATCCGTC AACATCGTGG GGCTGCGAAC CGGTTGGGTT TTGCCATCCA    166800
     ACTTTGCTAT ATGCGTTATC CTGGCATCAT CCTGGGTGTA GGACAGTCAC CGTTCCCACC    166860
     TTTACTCAGC TTTGTGGCAG AGCAGATCCA GGTACCAGTG GGAGCCTGGG ATGAATATGG    166920
     TCGGCGAGAC CAAACACGAC GAGAGCACCT GGCCGAGCTG CAAACCGTAT TTGGCTTCCA    166980
     GCTTTTCAAC CTGAGCCACT ATCGGCAGGC AATCGAGACG CTGACCAAGT TAGCTTTGCA    167040
     GACTGATAAG GGCATTGTGT TAGCCAGCGC CCTCATCGAG CATCTGCGGA GGCAGAGGAT    167100
     TATTCTGCCT GCTATGAACA CTATTGAGCG CGCCAGTGCT GAGGCAGTCA CACAAGCTAA    167160
     CCGGCAAATT GATGCTGCTT TGACCGATTC TCTATCAGCT ATCCATCGCC AGCGTCTTGA    167220
     CCACCTACTG ACACTCAGGG ACAACAGTAA GATGACTTGG CTGGCTTGGC TACGCCAGTC    167280
     ACCGACTCGG CCCAACTCAC GCTACATGCT GGAACACATT GAGCGTCTAA AGGTTTGGCA    167340
     GCAGCTCGAC TTACCCGCTG GGATTAATCA GCAGGTTCAT CAAAATCGCC TCCTTAAAAT    167400
     TGCCCGTGAG AGTGGACAGA TGACCCCTGC TGATCTGGCT AAGTTTGGAG CACAACATCG    167460
     CTATGCAGCA CTGGTAGCAC AGGCATTAGA GGGTACAGCC ACTGTGACCG ACGAAATCAT    167520
     TGACCTGCAC GACCACATTT TCGGCAAGCT GTTGAATGCT GCCAAGAACA AACATCAGCA    167580
     ACAGTTCCAG GCTTCTGGAA AGGCAATCAA TGACAAGGTC AGACTATATG GGTGTATTGG    167640
     ACAAGCCTTG TTGGAAGCCA AGGAGAACGG TGCTGATCCG TTTGCGGCTA TTGAATCCGT    167700
     CTTACCCTGG GATCTCTTTG CAGTTAGTGT CAATGAGGCG AAGCAACTCG CACAGCCTGA    167760
     AGAATTTGAT TTTCTTTACC GTCTTGGTGA AGGCTATCCC ACATTGCGTC GCTACGCACC    167820
     GGAATTCCTG GATATCCTAA ACTTGCGCGC AGCACCAACC GCTAAGGGTT TGCTCGATGC    167880
     CGTCAACGTA CTGCGCAGAA TGAACGCTGA GAACACCCGC AAGGTACCTC CCGATGCGCC    167940
     AATTGAGTTT ATTAAGAAAC GCTGGAGGAA ACTAGTTCTG ACCCATGACG GGATCGACCG    168000
     GCGCTACTAC GAGTTATGTG TGTTTTCAGA ATTGAAGAAT GCGTTGCGCT CGGGGGATAT    168060
     CTGGGTGCAA GGCTCTCGTC AGTTCAAGGA CTTCGATACC TATCTGATAC CCAGCGAGAA    168120
     GTTTACAGCA CTGAAGCTAA CTCATCAGTT GCCGTTGGCG GTAGCTGATA ACTGCGAAGA    168180
     ATATCTGCAT GAGCGGCTGT CACGGCTGGA ACAGCAACTC GAAACCGTCA ATCGCATGGC    168240
     AGATGCCAAC GACCTACCCG AAGCAATCAT CACCGAGGCC GGTCTGAAAA TCACACCCCT    168300
     GGATACGGCG GTGCCAGATG CAGCTCAGGC TCTGATCAAA CAGACGGCGG CTTGGCTGCC    168360
     CCATGTCAAG ATTACTGAAC TACTTTTGGA AGTAGATGAG TGGACAGATT TTACTCGCCA    168420
     CTTTACTCAC CTGAAAACAG GCGACACAGC TAAAGATAAA ACCTTGCTGC TGACCACAAT    168480
     TCTGGCTGAT GCCATTAACC TGGGACTGAC CAAAATGGCC GAATCGTGCC CAGGTATGAC    168540
     CTACGCCAAA CTATCGTGGC TGCAAGCTTG GCATATTCGG GATGAGACCT ATTCAATGGC    168600
     GTTGGCGGAA TTGGTGAATG CCCAATACCA CCACCCCTTT GCTCAACATT GGGGCGACGG    168660
     GAAGTCCTCC TCCTCCGATG GTCAGCGTTT CCCAACCGGT GGTAAGGCTG AGAGTACCGG    168720
     TCACATTAAC CCAAAGTACG GCAGTGACCC AGGTAGAATG TTCTACACTC ATATCTCTGA    168780
     CCAGTACACA CCCTTCAGTG CAAAGGTCGT TAACGTTGGG GTACGCGATT CGACCTATAT    168840
     CCTCGATGGT CTGCTCTACC ACGAATCAGA CTTGCGCATT GAGGAACACT ACACAGACAC    168900
     AGCAGGCTTC ACGGATCATG TCTTTGCCAT GATGCACCTA CTGAGCTTCC GCTTTGCACC    168960
     GCGTATCCGT GACCTGAAAG ATACGAAGCT GTATGTGCCC AAGAATGGAC AGGACTACTC    169020
     AGCCCTGAAA CCCATGATGG GTGGGACTCT GAACATCAAG CATATCCGCG AACATTGGGA    169080
     CGATATCTTA CGATTGGCAG CGTCTATTAA GCAGGGTACT GTCACAGCCT CACTAATGAT    169140
     GCGTAAGCTC AGCAGCTACC CACGTCAGAA TGGTCTGTCC ATTGCGCTGC GGGAGCTGGG    169200
     CCGGATTGAA CGGACATTGT TTATGCTGGA CTGGTTGCAA AGCGTGGAGC TACGACGACG    169260
     AGTCAATGCT GGATTAAATA AGGGAGAAGC ACGGAATGCA TTGGCCCGTG CCGTGTCCTT    169320
     CAACCGCTTA GGCGAAATTC GCGACCGTAG CTTCGACCAG CAACGTTACC GTGCCAGTGG    169380
     CTTGACCCTG GTGACCGCAG CGATTGTACT CTGGAACACG GTCTATCTGG AGCAAGCCAC    169440
     CCATGTTCTA CAGGATAGAC AGCCATTAGA TGACACGCTG TTCCAATACC TGTCACCCTT    169500
     GGGTTGGGAA CATATCAACT TGACTGGCGA TTACGTCTGG CGTAGAAATA CCAAAGTCAG    169560
     TGCTGAAAAG AAGTTTAGAT CACTCCGCAA TCCTTAGCGT GCTATATTTT CCGTTTTCTG    169620
     AGGCTACCCG AAACTGCCTG CATCCTTCCA ACCTGGACTC AACCGGGTCG TGTTCCAGAG    169680
     CGAGGGCGAA CGGATGGTGG GTAACTTGTA TCTGCCAACC TCCTACCAAC CTGGAGACAA    169740
     GCTTCCCGTG ATTATTGTGA CGGGTGCCTG GACAACGGTG AAAGAACAGA TGCCTGCGGT    169800
     TTATGCCCAG CGGTTAGCCG ATCGCGGCTT TGCTGCCTTC ACGTTTGATT TTCGTTATTG    169860
     GGGTGAAAGC GGGGGTACTC CCCGACAATA CGAATCGCCT ACAGCAAAAG TGCAGGACAT    169920
     CAAGAATGCC GTTGCCTTTC TGCAAACCTT ACCTGTGATT GATGGCGATC GCATCGGTGG    169980
     GTTGGGGATC TGTGCGAGTG CAGACTACAT GGCTCAAGCG GTTGTAGAAG TGACGTTTTC    170040
     TTGTGATGGC TTCCCTCTCT GCATAGCGGA AAGCTTAAGC CCCTTCGTTT AAGGATACCC    170100
     ATAGGCAAAG CAAGTTTAGT CTTCGGTTAA TTATTCAGGC AAATTAGCAT CAGACTTAAA    170160
     GGGATCTTCC TCCATCCCTA GCATCTTCTT TATCCGTTTG AGTTCCTTGA TCAAGTGTTA    170220
     TTTACTTTCA CGATTTTCGG ACGATCCTAA CCTGGACATG AGCGATCCGA AACCATCTCA    170280
     TGAGTCCTGA CAGCTCATCA AGCCAGCGGC AACATTTTAA TGGAACCGAG CAATTAGTGC    170340
     CTTTGTATTA GCACCACTCA CAATTTGCCA TCTGCCCATC GAGTCTTTTT ACCCTTTGAA    170400
     GGCGACACCA CCCTAACGCT GATTCTCAGC AAAGCATTTT TACTGGCAGA TAATTCGAAG    170460
     AGCTAAGACC CAACCATTCT CAGTCAACTT CGCTGAGTAA GCTTGTGGGG GTGATCATGA    170520
     TTGATAAACA ATCCGTTGAG CCAAGTTTTG ATCTGATTAA AAGATAAATA AGATCCAAAG    170580
     AAGTGTATCT TTTTATACTT TTTATCATCC AGCATGATTC ACTTTAAAGT GAGTTCCTTG    170640
     ATGCTGAGAG ACTAAAACTG TGAGGGTGCT AATCGTAGAT TCCTATCCGG TCGCTGGAGC    170700
     AGCCCTAGCC TGGGAGTTAG AGGGATACGG TGTTGAAACC AGGATCGTGG ATACGATTGC    170760
     TAGAGCAGAA GCGGAAATCG CAGCCCTCAA GCCTGATGTT TTAGTGACTG AGTTATTTCT    170820
     CCAAGATGGT GATTACTTAG CCTTAACGTT ATATCGTCGC CTCTTCCCCA TTATTTTGCT    170880
     GACACACGAT CTGGCGGCCT ACGATGCCGA TGTCAAATCC ACCGTCGATG CTTACCTGTG    170940
     CAAGCCAAGC CAAGCGATTG ATCTGATTGC CGTTGCAGGG AATTTCATCA GCGAACGTCC    171000
     CTACTGCATT CTGAGAGAGC GAGAAAGCTG CTTAAGGTTT TGCCCAGTTC CAAACCGCTA    171060
     GTACTTTTAC TCTATATAGG TTGAATAAAA TTTTAAGTGG ACAGGGTTGA AGGGCGTGGA    171120
     AACTGCCTAA CCCTCATGTT CCTCCAGTTA ACGTTTGACC CAGCAGCCTC GCCAAATATA    171180
     TTAGCCTGTC AAAATATTGC ATTGCACTAT GGAAGAATGA GGCAATGTCC ATACTGTCAA    171240
     TCCAACCAAG TAGCCAAAAA CGGATGTCGC ACAGGGACTC AAAGTTATCT GTGTCGCCAT    171300
     TGCCGTCGTC AATTTCACCA AACTCATCAG CTCATCTGAG CCAGTTCAAC AGCAGACTTA    171360
     AATACAATCT CATTCATATC TTTTCTTCAT CAAAAACTTA TCCCTGCTTC CGCTGATGGG    171420
     AAAACAATTT TGGAAAAGCA CAATTTCGGA ATAGAGGATC TTCTGAAGCT CCAAACTCGG    171480
     TACACAGTTT GCGGCAAAGC GATAAGCAGC GACTTCTCCT TCATCCTGTT ATGGATGGTT    171540
     CAACCATTCG GATGCCATAC TTATTAAGGA TTGTAGGCAT TTTCGGTAGA TCCTCAGGCA    171600
     GCTCTATAAC TTTTTCTGCC ATTTCAGCGA AAAACTCGTC AATGGCTCCG CCAATGCTCC    171660
     ATGCAAGGAA TCGAACGCAT TGATTGGAAC CGTTCTTGTA GCCGTGTACT GTTCCGGCAG    171720
     GTATATAAAC AAAATCACCT GGTTCAATGG CCAATTCCTG GTCGCCCAAT TGCATCATCA    171780
     TTGTCCCTTC CAGCACAAAG TAGCTTTCTT CCTCTTTATC ATGAGTATGT GGAGGCACAA    171840
     AGCCCTCTGG CGGAACCTCG ATCGTCATCA CCGCCATCCG ATTAGGTGAG GCAGCGGATT    171900
     TTAATTTGAT ACAAACTCGA TCGCTTAATA CTTGTAGGTT TTGACCTGCT TGACTTCGTA    171960
     ATACTTTCAC TTTCTTGTCT CCTTTCTAAA ATTTATGTTC GTGTTGAATC TTCTCCATTG    172020
     CACTACCCAT TGATCAAACC TTTGAATGAG ATAGCAATCC TCTTAAGTTG CCACCAGCAA    172080
     GGCAGGTTGA AGGGGGGGAA TATGATAGTG ATCGCGCACC ATATCCAGCG GTAGATCCAT    172140
     AACTTCCCAA AAGTTCCAGT GATCAGACAA ATCTACGCTA CAAGCAGCCC CTCGTTGCAA    172200
     AGCATGGATA ACAAGTGGGA TATTAAACAA TCCCTGAGCA GGATCGGCAA TGGGGGTGAT    172260
     TTTGATATTC CAGTGAAAAT GCAAAATGAC AAACAACAGA AATGCAAAAC CATCCTTGCG    172320
     AATAAAACCT GCCTGAAATG CACCCTGCTG AATCTCGCCT TGTGGAGTGG TATCGTAACC    172380
     AGAGAGGATA TGCCCCAGGT CATGAAATAC GAGGCGTTCT GGAATACCGC CCGCTTCACC    172440
     AGGGAAGGGA AAACCGTTTT GGCTGTAGTG CTGCCAAAAG GTATGACCCA GCGTTCCTCG    172500
     TGGTAGTTGT CCAAGCTGGT GATACTTTTG AGCGATCGCT GGATCTTCAC TGCTTTTGAA    172560
     GAACAGCGAT GCAATGATTT TTTTGACTCC TGCAATCCCC TCTTCATGCA GTGCAGGCAC    172620
     CACGATTTGA CTCATCATCC GCCGCATCAT CTTGAATTGA GCCAGCCGTT GATGACCGCT    172680
     CATTGCTTCC TGGAGCACTT GTAAACCTTG CTCATGCACT GAGAGTGCCC TAGCTAATTC    172740
     CTTCAGTGCC TGCTGTTGTT GAGGAGTTGT TTCGCCATCT ACCATCGCCA TGATGATCGC    172800
     CAGTTGCAAT AGCCGCCTGC AGTGATGCTC CTGGAGAATC GATTGCGCCA CTTGGAATGG    172860
     AGTGACTGCT GTTGCTGCCA GGTCTCGCTT GCCTTGGTGC AGGGCAGCAA CAATCTCTAA    172920
     AAACTGCTGC TCGCGTGGTG TTAAAGCTTC AGGGTTAGCA GCCACAGTGA CGAGCGATCG    172980
     CAGCACTAAG GGTAATTCCT GTGAAGAAAA AATTGCAATG TCCATCACAA TCTCCTTTAA    173040
     AGTATTTGTA GGGTTAAGCT AAAAAACCCA ACTTTTTGCC ATTGTCATGA GCTATATGAA    173100
     TCAGGCGTTG GCGGATGTGA ATCGCAACAC CGCAGCGATC GCACACTTGA GTGATGACTT    173160
     GAAGATGCCG TGCAATCAGC TTGCTCCGCA GATGGTTGAA TTTGGGTTGA CCCATCCAAT    173220
     TGCGAATCCA GATAACAATC GGTGCAAACA TAGAAGCTTC TTTTCTCCAT TTGATGTGAT    173280
     TGGAATTGTG GATAGCTTTA GACTATGGGC TACCCCATGC TCAACACAGT GACTAAACAC    173340
     GTCAAAAAAC TTGACTTAAA ATGCCAATGT GCCAATGTCA GTGGGTCATC CTGAGCACAT    173400
     CAAGAAGCAT CTAATGCCAT GCAAAATTCC GTCTCGGTTA AACTCGTGCA AGCAATTTTA    173460
     GAGGCCGCCG CCCACTGTGG TCTGGATGTC AATGATCTCC TGACTGCTCT GAGGCTGGCT    173520
     CCAGGCTGTT TAGAGGATGT GGATGGGCGG ATTCCGCACG AGCAGTTCTG TGCCCTCTGG    173580
     CAATTGATTA CTCAGCGATC TAAAAGCGGC TGCATTGGCT TGCAGATGGC AACCGCTGCA    173640
     AAACCAAAAA CCTGGGATGT ATTGGGTTAC GCGATGCATA GTAGTGCCAA TTTGGGGGAA    173700
     GCATTTGAGC GGTTAGTGCG TTACTCACGT CTCAGGCACA CAGGAGCCGA ATTTACTTTC    173760
     GAGGTTCGGA GAGATATCGC CCGAATTACG ATGGCAATTC CCAACACACT TCTGCCGCCC    173820
     AATGATGCGA TGGGTGAATG GGTGGGAGCC AACTTTGTCC TGTTGAGCCG TCGATTAACA    173880
     GGGCTGGATA TAGTACCGTT ACAGATGGGT TTTCAGCATC CTAAACCAGA GGACGTATCA    173940
     GCTTACCATC GCCTTTTTCG GTCTCCTTTA GCGTTTGATC ACCCTGTGAA CGAAATGAGG    174000
     TTGGATGCAG CACTGATCCA GAACCCCCTG GCACAAGCCG ATCCGGGTCT CTCCTCTATT    174060
     CTCGATCGCC ATGCCGAAGA ACTGTTGGCT CGGCTGCCAC AGTCTGAAAG CTTGCTTGAT    174120
     AGTGTCAATC GATTGCTAAG TCAGGCATTG CGGGGAGGTG ATCCGAGCTT AGTGGCGATC    174180
     GCTCAACAAC TTGGCTATAC CCCCCGCACC CTCCAACGGA AGCTACAAGA AGCAGGCACG    174240
     TCCTACCATT CACTGCTAGA CGAAATGAGA CGAGAGCTTT CTATCTACTA TTTGCGAGAA    174300
     GCGCAAATTG CGATAAGTGA GATCGCTTTT TTATTGGGGT TTTCGGAAAC CAGTGCATTT    174360
     CATCGCGCGT TTCGACGTTG GATGGGCGTT TCCCCTGGTG ATTTTCGCCG CAGTGCCTAA    174420
     AAGGGTCCGG AAACCTATTC GTGTAATCTG GTATCACGAT AAGCTTCAAA TGCTTGCGGA    174480
     GCAGCGAGTT TGGGGATCAA AATATTAGGG TTGTTGGGAA ATAACATTGG CATAGAGACA    174540
     GTTTTTCCGA TTCTCTCCAA ATTCATGCCG CATCCAAATA GAAGTTCCAT AATCCTGTTG    174600
     CATTCAACAT TAAACGGTCA TCAAAATCAG GCACACGATT TCTGTAAACA GTTGCAACCG    174660
     ATTGATAGCG CTTGATGCCT GCGTGTGCAT GCTCACATTT AACTCGTTGG CGGCTAAATT    174720
     CTCGGTTTTC TTGCTTCTGT TGTTCGCTCA ACTCTTTGCC TTTAGGCTTT TTATGAGGTA    174780
     TCCGGATGTT CACAAACTCA TGTTGTAAGC CCTGAAACCC TAAATCTCCC TCTACCCTCA    174840
     CCTCATCTGG AATGTTTTCC ACCAACTCTT CCTCATCTAA TTGCCGCTTA TCATGTACCG    174900
     TCCCTGCTCT GGCTTTGGTT AAAATTATCA CTCGCTTTTG ACGGGTACTT CCAGTAATAT    174960
     GTTTGCGGGT GTGGCGTTTT TTTTACCAGA GTAATGCTCC TTTTGTCGTT GGGCGTCTTG    175020
     AGGACGTTGA ATCGGACGTT CCATTCCATC CACAATCACC TCCTCAACCC CCGCAAAGCG    175080
     TTCCACAAAC TCCTCTAAAC TCCGCAGTTT TCGTTCTGGC AAGGCCTGCT TGTGCCCTAA    175140
     TGCCTGTTCT AAAATGGGCA ACAGTCCATG CACCCAGTCC CAAGCGCAAG AGCGGTCAAA    175200
     GCCAAATAAC ACACTCATCA AGTCAAACGT GGGATAGCAT TTGCAGTACA GCAAGATGTA    175260
     AAACAGTTTG TCCCGGGTTG TCCGTAACGT GGCTTTACGC CCACCGCCGG GTGCTCGTTG    175320
     GCGCTCTGCC GCTGGTTGGG TCTGACGCTG CTCGTAAGCC TGCGCAAAAC TGGGGAGCAG    175380
     GGCTTCAAAT GCTTGACGGT TTAGCCCAGT CATTGCCCGT AGGAGTCGGT CGTTGTTGAG    175440
     AATACGGTCT AGACTCAGCA TGGGTCGAGC ACCTTGCAAC TGCTACTGAT TATCCCTTAT    175500
     TTCCCAACAG GTCTATTATA GTAACGTCAA GCCCAAGCAG CAGTCCGCAA CGACTATCGC    175560
     TATTTCATTG AGCGTTAACG ATGCTAAGGG TATTGCGGCT CTGAAGGTAA AGGTTGCCCT    175620
     TTGGGAAAGC GGCTCGTGCA AGTGCTGCGG TGTCCTCTGA AATAGGTGGG ATTGCATGGA    175680
     CATAATGCAC ACCTCCGTTC AGCCTTATCG CTTTACCCTC AGCTTAAAGA GTTTTGCCAG    175740
     CCTTATTTTC CTCTATCGAA TTCGCCAGCG GTATCGAGAT ACGGGCAAAA AAGTGCAAGA    175800
     TGAGCTGAAA AGCCTTATCT AGATTGCATT TTAGGAAATC TATCGAAGCG AGGATCAGGA    175860
     CTTCTGCCGG AGGCTGCAGA AGTTCCAAAA CATGAGACAG AGTTAAAAGC GTTACTGCGT    175920
     CTGTGTTAAG GGCAATTGAG CAACCGAGTT GAAGGAGTAG ACAGTCTCAC GAGTTTTTAG    175980
     TGTTTCAGCA GATGGTAAAT TGCTTATCTA GTCCGATTTT AGCCCGAGGA GATTTTGAAA    176040
     CAAGCAATCT CAGAATGATA TAGGTCTACC AAGTCAATTG CACCTTCTAA TAATCTACAA    176100
     GTGTAGTATT TAGAAATCTG ATCTTGCTGT GGTACTTCTG CCCATCACGC AATGATGGCT    176160
     AGCCAACCAG AGGATGAATA AAAATTATCA ATTAAATTCT GCCTCAACAT GATCGCCACA    176220
     GCTCTTTTTG ATCCACACAG CAACAAAACG GTTCAGGGTG CATCCCAGTT ATGCAATGAG    176280
     TAAAAGTACT CAGAATCCTA ATTTGAGAAC AGTTCCATTA TGCTGGGGAT AATCAATTGG    176340
     CTATCAGGAG AGTTAAGGTA TGGACATTGA TAAGCTGCAA CAAATCCAAA CTCATGCCCG    176400
     TGCCATTGCC GCTTTACTGT ACGACGAAAC AGCCCCTGAA CAATTGACAA CACTCGAAGG    176460
     AATCGAACAA GCCGTTCGAG GACATATCCT GGAGCATGTC AGTCCAGAAA TCGGTAATTT    176520
     TTTATTGCAA CGGCAAGTGG AACAAACCGT GGGCGAAGTC GGCAACTCAA AAGCATCCTC    176580
     GGAGCCATCC GCATCAGTGA ACAGCAAGCG AAAATCCTTC AAGTGAAAGC GCGAACCCAA    176640
     TTGAGTCCTT ACCTCGAAAA ATGTTGCTTA CTGGTCAGTG CGAATGTCTC CTATGAACGG    176700
     GCTGTTGAGG ACGTTACCGT ATTGACTGGA ATGGCTGTTT CACGAGGGAC ACAACAGCGT    176760
     CTAGTCCAGC GACACCCCTT TAAGTTACCA AGGGCTGAAG ATAGTGTTGA GGAAATCAGT    176820
     GTGGATGGTG GAAAGGTACG GATACGAACC CCAAAAGGAG AAATTTGCCG ATGGCAAGAT    176880
     TACAAAGCGG TTAATTTGCA TGGTCATTAC TGTGAAGCAT TTTTGCAGGA CAATGAGCAA    176940
     TTGATTGAGT GGGTCAATGG ACAACCTCTT GCTACTCCAG TTGTCTGTTT GGGAGATGGT    177000
     CATGACGGGA TCTGGAATCT GTTTAGGGAG ATCGCCAGTC CCAGCCAGCG ACAAGAGATT    177060
     TTAGATTGGT TTCACCTGGT TGAGAATCTC CACAAGGTAG GCGGGTCACT GCAACGATTA    177120
     GCCACCGTAG AGACCCGGTT ATGGAAGGGC GAGGTCGATG CAGCCATCGA GCAATTCAAA    177180
     GACTGGCAGC ATGAACAGGT AGACACCTTC ATTGCTTATC TCAACAAGCA CCGTCACCGC    177240
     ATCGTCAATT ACGCTTACTA CCAAGCCGAA GGAATTTCGA TTGGGTCAGG CAGGATTGAA    177300
     TCGACGGTCA AACAGATTGG AGCACGCATG AAGCTGTCTG GGGCACAGTG GAAAGCGGAA    177360
     AACGTTCCTC AAGCTCTCCT ACATCGTTGT GCTTATCTCA ACGGACAGTT CTCAAGTTGA    177420
     GACTTACAAG ACTGGGATGC ACCCAACGGT TCACGGTTCA CGCCGATCTC ATACTTCTCA    177480
     TACTTGAGCG CTGAGAGTTT TATTCCATAA GTGTTTATAT CTATCGTGAT ACCAAATTAC    177540
     ATGCATGGTT TTCCGCCCCA GAAAGAGCAT TGATGCCACG ATTACCATGC AAACAGTTGA    177600
     GGGTATAACA AATCGCTACA AGCCTTAAAG CAGGAGCCTT TTAACAACAA TAAACTTGCT    177660
     TAAAATCACC CTAAGACTTA GTTGTCTTAA AGGAAGACTA TGCCTTTTCA AGGGAATTAT    177720
     GAAAAGACCC TTAGTGTTGT AAACGAAATG AGTATAGAAC AAAAAAAAGG ATGGTAAGAA    177780
     CATCCCTGGT TTACACAATA CCAACTGTTC TTATGACCTC CGACAGAGAA CATTGAGCAA    177840
     TAAGAATCGT AGGCTTAAGG CAACTCAACC AAACGAAGGA AATCCAAGCA TAGTCTTGAA    177900
     GGTGTGGGGA AATTTTAGGT GAGATTTTGG GTGAGTAAGG TTAAACAGTA AATCAATCAA    177960
     GAGAAGTTGA TTCAGTTTAT TTGGATGGGA TGCGCCCATA ACGATCCACC GTTTTTACAG    178020
     ATGGCAGCCG AAGGGGCAAA TCCTGAAATT AAAGCATTGC TAACTGTTTG ATGAATAGAT    178080
     TCAGTCTACT CACAAATGAG GACATTGAGA TGGCTCAACC TATTAAAGTC GAAAGAACGG    178140
     TAACCATTGA AAAATCCGCA GAAGACCTTT ACCGCTTCTG GCACAACTTA GAAAACTTAC    178200
     CACGCTTTAC CAGACATCTT AAAAGTGTGA ATGTCTATGA AGATGGGCGA TCGCACTGGG    178260
     TTACTAGCGC ACCGTTGGGC AACAGTGTTG AATGGGATGC CAGAATCACT GAAGATCGTC    178320
     CGAATGAAAT GATTGCCTGG ACTTCACTGG AAGGGGCAGA CATTGCGAAC TCTGGTTCGG    178380
     TTCACTTTCA ACCTGCTCCT GGCGATCGTG GAACCGAGGT CAAAGTGGTT ACGGCATACA    178440
     ATCCACCTGC TGGAGCCATT GGAGATGCGA TCGCTACACT CTTTGGCGAA AACCCAAAAC    178500
     AGCAAATTGG AGATGATCTT GCCCGCTTCA AGATGCTAAT GGAAGCAGGC GAAATTGCTA    178560
     CAAACGATGG TCAGCCATCG GGACGCCGTA ACTCAAAGGA CTAATCACGA TGAAAGCAGC    178620
     TTGTTGGTAT GGTACGGAAG ATGTGCGGGT AGAGACTGTG CCTGATCCCA AAATCCTCAA    178680
     CCCGCGCGAT GCGACCGTCA AGGTGACCTC TACAACCATT TGCGGTTCTG ACTTGCACAT    178740
     CTACGATGGC TACATCCCAA CGATGCAACC CGGTGACATT ATTGGTCACG AATTCATGGG    178800
     AGAAATCGTT GAAGTTGGCA GTGAAGTCAA GCGCTTGAAG AAAGGCGATC GCACGGTTGT    178860
     GTCTTCAGCG ATCGGCTGTG GTCACTGTTG GTACTGTAAA CAGCAGCAGT GGTCGCTGTG    178920
     TGACAACTCC AATCCAAATG GCTGGATGCA AGAAGCAGTT TATGGCTATG GAACAGGAGC    178980
     AATCTTCGGC TACTCCCATG CCTTTGGAGG GTATGCGGGT TCCTTTGCTG ATTACATCCG    179040
     CGTCCCATTT GCAGATTTCA CAGCCATCCC TGTGCCGAAA GACATTCCGG ATGAAAAACT    179100
     GCTGCCTGTT TCTGATGCCT TTCCTACAGG CTATATGGGC GCAGATTTGT GCAACATTCA    179160
     ACCGGGTGAT GTCGTTGCGG TTTGGGGTTG TGGTCCGGTG GGGCAATTTG CCATGCGCAG    179220
     CGCCTACTTG CTGGGCGCAG AGCGCGTTAT TGGCATCGAT CGCTTCCCCG AACGACTGCA    179280
     ACTTGCGAGA GACTTTGCCA AAGCAGAGAC CATCAACTAC GAAGAGGTGG ATGCTGGCGA    179340
     AGCCCTCAAA GAAATGACAG GAGGAATGGG TCCGGATGCC TGTATTGATG CGGTCGGCAT    179400
     GGAAGCCCAC GGTACAGGTC TAGAGGGAGT CTACGATAAA GCCAAGCAAG CCGTTCGCTT    179460
     AGAAACCGAT CGCCCGCATG TGCTCCGGCA AATGATGGTG GCGTGTCGCA AAGGTGGCAC    179520
     TTTATCGATC ATGGGAGTGT ATGGCGGCTT TGTGGACAAA CTGCCAATGG GGGCAGCTAT    179580
     GAACAAAGCC CTCACCTTCA GATCGGGGCA GATGTTTGGT CCGAAGTATA TTCCCAAGTT    179640
     GGTGGAGCAC GTTTTGAACG GCGACGTGGA CCCCTCGGCT GTGCTGACGC ATCGCTTGCC    179700
     TCTGGCTGAA ATAAAGCAGG GCTTTGAAAT GTTCAAGCAC AAGAAAGACC AATGCATCAA    179760
     AGTCATGTTG CAGCCCGCCT AGTGGCTATC TCACTACAAA CAATGGAGAA AAATCATGAA    179820
     AGCAATTTGT TGGCAAGGGG CTAATAAAGT GGGAGTTGAC ACGGTCCCCG ATCCCAAAAT    179880
     TATTAACCCA CGAGATGCCG TGATCAAAAT TACGTCAACC GCAATTTGTG GGTCTGATTT    179940
     ACACCTCTAC GATGGATACA TTCCGACGAT GGAGCAGGGC GACATTCTCG GGCATGAATT    180000
     TATGGGAGAA GTCGTTGAAG TCGGTAGTGA AGTCAAGCGA ATTAAGGTGG GTGATCGCGT    180060
     CGTCAATCCA TTCCCGATCG CCTGCGGTCA GTGCTTTTTC TGCAAACAAT CGCTAACGTC    180120
     CCTGTGCGAC AACACCAATC CCAATGCCTT TATGGCAGAA GCGATTATGG GATATTCACC    180180
     CTCAGGCATT TTTGGCTACT CCCATATGTT GGGGGGCTAT GCGGGGGGGC AAGCAGAATA    180240
     TGCTCGCGTT CCTTTTGCGG ATGTCGGTCT CTTGAAGATT CCAGATGGTT TGGCAGACGA    180300
     ACAGGTGCTG TTCCTTTCGG ATATCTTTCC CACTGGATAT ATGGCAGCGG AGAACTGCAA    180360
     TATTCAACCG GGTCACATTG TTGCCATCTG GGGCTGTGGT CCGGTTGCTC AATTTGCGAT    180420
     TCGCAGCGCT TTTTTGTTGG GAGCAGAACG GGTCATTGCG ATCGATCGTG TGCCTGAACG    180480
     GCTCCAAATG GCAAAAGACG GTGGGGCAGA AGTCCTCAAT TATGAACAGG TTGATGTTGG    180540
     GGAAGCTCTC AAAGAAATGA CGGGAGGTCG TGGTCCAGAT GCTGTGATGG ATGCCGTGGG    180600
     GATGGAATCG CATGGGATGG GACTGGAGGG ACTATACGAC CAAGCCAAAC AAGCGGTGCG    180660
     CTTAGAAACC GATCGCCCGC ATGCGCTCAG ACAAGCGATC GTGGCCTGTC GTAAAGGAGG    180720
     CACTGTGTCC GTTCCTGGTG TATTTGGCGG ATTTGCCGAC AAGATTCCAA TGGGGGCTTT    180780
     TATGAACAAA GCCTTGACCA TGAAAACGGG ACAGACCCAC GTTCACAGGT ATTTGACCCC    180840
     GCTACTGGAG CACGTTCAGA ATGGCGATAT CGATCCTTCG TTTGTGATTA CCCATCGGCT    180900
     GCCGCTAGAG CAAGCCCCAG ATGGTTACGA GATCTTTAAG CACAAAAAGG ATCACTGCAT    180960
     CAAGGTCGTA CTCAAGCCCG GCCAGAGTGC CTGAAATCCC AGTAAGGCAA CCTTAGAACT    181020
     ACCAATGATT CAGCCAGTCC AGAGTCATTG GTAGTTCAAT CGCTCCTATC TGAGCAGGTT    181080
     GGAGGATTGC TGCACTGCCA ACCCGAAAGC GATCGCGCAG ATACCTATAG CCTGCGAGCA    181140
     ATGGTGCATA GATCACCTGC ACAGCGATGA AAACGATGAC GGTTTGTCAT AAGCGTGGCT    181200
     CATCCTGGGC TGAGCGGGCT GAAATTGGAA CAGCAAGCTC ACACAATCTA GCTGGCGGCA    181260
     AGGGAGAAGC AAGCCAGGGT AAACGAGCAT GGAGCAGACG GAATCGAGAT TCAAACAGCC    181320
     GACGTTTAGA GGAGACATAG AAAAATGGTT AGTCAGTTGC AGAAGTTACC CACCGATGAG    181380
     TCGTTAGGCA CACTGGAGAC AGTTGCTCAC TTTGACAACG CAATGCTAAC CGGGGTGACA    181440
     GTGTCACATC AGGGGCGCAT CTTCGTCAAT TTTCCGAAGT GGGGCGATGA GGTCGCGTTC    181500
     ACCGTGGCGG AAATCCGGGA TGGTCGTCCT GTGGCTTACC CTAACGAGGT AATCAATCGT    181560
     ACAGACCCAA ATAACCTCGC TGGGACGCTG GTGTCTGTGC AAAGTGTGGT TGTTGATCCC    181620
     GCCGATCGCC TATGGATTCT CGACACGGGC AGTCCGATGT TCCAGCCGAC GCAGTATGGT    181680
     GGACCGAAGC TCGTCTGTGT GGATTTGACG AGCGATCGCG TTATCAAAAC AATCCTCTTT    181740
     CCCCAAGATG TCGCCCTGCC TACCAGTTAC CTGAACGATG TCCGCTTCGA CCTGCGGCGC    181800
     GGTACCGAAG GCATGGCATT CATTACGGAT TCGTCTGACC AAGGGGCAAA TGGAATTGTT    181860
     GTTGTAGATT TGGCATCAGG CGAGAGCTGG CGCAAGCTGC ACGATCATCC GTCTACAAAA    181920
     GCTGAGGCAC TATCAAGTTT CCGCCCAATT GTTGAGGGTC GTCCACTGTT GGAACGCTAA    181980
     CCGGACGGAA AGACCAAGCC AATCACAATG GGGTCAGACG GGATTGCCAT TAGTGCAGAC    182040
     GGGTCACGCC TGTATTACTG CCCGCTTGCT AGCCGACGGC TCTACAGTGT TGCCATTGAT    182100
     GCACTTGCAG ATCGCTCGAT TGACGATAGC GCTGTTGCTG CAACTGTAAT TGATGAAGGA    182160
     GACAGGGGCG GTGCTTCCGA TGGACTCGAA ACAGACGCGG CAGGGTATAT TTACTCGACG    182220
     AACTACGAGC ATAATGCGAT TCTGCGTCGC CGTTCTGGTG GGGAGTGGGA AACGGTAGTA    182280
     CATGACCCCC GCCTTCTGTG GCCCGATACG ATGTCCGTTG CGGCAGATGG ATACCTCTAC    182340
     GTCACAGCCA ATCAGTTGCA TCGTCAGGCG AAATACCAAA AGGGAAAAGA CTTGCGCCAA    182400
     AAGCCGTATA CGCTCTTTCG CGTTCGCATC GACGCTCAAC CTGTTCTACT GCGGTGAGGC    182460
     TCGAAAACGA TGGTTTGCCC TAGTACTACA GTTGTAGATC CAGCATTGGA GCAATCAGCC    182520
     GACGTTTGTA GTGATAGAAC TTGGCGATGG CTTGATGAAC CCGTCGCCAG GTTGACCAGG    182580
     CGAAGATGTA GCCCGGATTC GGTGTCCACG CCCACAATAG GGCAGCTAGC AATCGCCGAA    182640
     CTTCCGGTAC TGTTAAGCGG ACTTCCAGCG ATGCTTATGC TTGCACTCGG CGGAAGAAGG    182700
     GCCGCTTCAC TAATTTCAAT CCCCCTTTTT TAACGCTTGC TGAGCGCCCA ACTTGCGAGT    182760
     GATGGTTAAA AAGGCGTGAG CCAGCAGAGC CAAGGTGATA TGCCGATACC ACCCTGGCCA    182820
     GGAACGGACT TCGTACTGGT CCAGTCCAAC TTCCCCTTTG GCGGTTTCAA ACCCCGTTTC    182880
     AATCGTCCAT CGGGTACCTG CAACGCTCAC CATCTCATCG ATTGAGGTGG CTTGTGGGGC    182940
     AAACACAATG GAATAGGCTA ATTCACTCGG GTCACGCACA CTACGTCTGA CCAGCAACCA    183000
     GCGGCACCAC TCGGGGGCTG TTGGACAATT GCAGGCAACC GTTGCCCAAT CATACACTCT    183060
     CGGTCCTTTG GTCCCATCGC CACAACTGAG TCTGACCCAA TCAGTGGGTG CCAGAGTTGC    183120
     AGCTACGGCA TCGACCCGGT GTTGCTCAAA ACCAATCCAT ATCGGTTCTT TGACGGAAAC    183180
     GGCTAAGTAT TGGACGACAA TCAACCTATC GCGCAACGAC AACCCTTTGG CGGATTAGCC    183240
     AAGACGGACC ATGAGGGAGC CTCGGTCCAG AGCAGGGGAT CAGGGGTATC CGTGCCAGTT    183300
     ATTTTCGCCT AAAAAAAGAC ACTAGGTCTT CCTCACACAC TGGAGTAAAA CTAGTGTCTC    183360
     CAAAAACAAT TGACTCCTAT CATATCCGGG TTTACATGAA TGCACGTCAC CATGGACTGA    183420
     CTCAAGTGGA TGCGGCTCAA ATTGCCGAGA TTTCCTGTCG CAGTGGTCAA CGGATTGAAG    183480
     CCGGGACACT GCAACCCCAG CGAGGGGAGC GCCCCCGGGG GCGAACGGTG CCGGACCCCT    183540
     TAGCGGCGGT GTGGGACAGC GAACTGGAAC CGATGCTGGT TCGAGAGCCG AAACTCAAGC    183600
     CGATGACCCT GTTTGAGTAT TTGCAAGAGA AATATCCGGG TCAATACCCG CAGGTGTTAC    183660
     GGACCCTTCA GCGGCGGGTG CAAACCTGGA AAGTACTGCA TGGACCGGCT CCAGAGGTGA    183720
     TGTTTGAGTT GCACCATGCC CTGGGGGAGA TGGGCCTGTC TGACTTTACG GAACTCAAAA    183780
     CTGTGCAGGT CACGATTGCC GGTCAACCCT ATGAGCATCT GTTGTATCAC TATCGCTTAG    183840
     CCTATAGCGG TTGGCAGTAC GCTCAGGTCA TCGAAGGGGG GGAAAGCTTT GTCGCGTTGT    183900
     GCGAAGGCTT GCAGAATGCC CTGTTTCGCT GTGGCGGGGT GCCCCAACAG CATCGCACGG    183960
     ATAGCTTGAG TGCCGCCTAT CGTAACCTTG GGGGCAAATA CCCGAAACCC TTGACGCGCC    184020
     TATACAGCGA CCTCTGCGAC CACTACCGCT TACAGCCCAC CCGTAATAAC ACCGGGGTTG    184080
     CCCATGAAAA TGGCAGTATT GAATCCCCTC ACGGTCACTT GAAAAACCGC CTGGAGCAAG    184140
     CGATCTATTT GCGCGGCAGT GCTGATTTTG CCAGTGTTGC TGAATATCAA GCGCTGATAG    184200
     AGACCGTGAC CGCCCAACTG AACCGGCAGT GCCAGGACAA ATTTGCCCAG GAGCAGTCCC    184260
     ACCTCCAACC CTTGCCGGCC TACCGCCTGC CCGATTATGA AATCCTCAGT GTCAAAGTGA    184320
     GCTGCCACAG CACCATCACG GTGCGCTGTG TGCTGTACAC CGTCCCTTCC CGCTTGGTGG    184380
     GTCGCCGTCT GGAATTACAT CTGTACCACA ACCGGATGGT CGGCTATTTC GGCACTCAAC    184440
     GGGTCGTCGA ACTCCCCCGT GTTCGGGTCC ATCATCCCCA GAAGCGCCGG GGGCGGTGTA    184500
     TTGATTATCG CCATGTGATT GAAGCCCTGC ATCGTAAGCC CCGCGCCTTT CTCTATTGCA    184560
     CCTGGCAATC CGACCTCTTG CCGAATGCGG ACTACCGCGA ACTGTGGCAA CAGCTCAAAA    184620
     CTCAGTTCTC TCCCGATGAT GCCGCTCAAC TCATGGTTGA AGCCCTCTAC CTGGCCGCCA    184680
     CCGGAAATCA AGAGGCGGCC GTCGCCGAGT ATCTCCAGCA AGCGCTCTCG ACCGGCACCT    184740
     TGAGTTTGTC GCGCCTGACG GGACACTTTA CGTTTCAGCC CACTCCGACC TTGCCTGATC    184800
     TGACCATTCC TCAGCACGAC CTCTCCAGCT ATGACCAACT CATCCCTACC ACCCCAGTCG    184860
     AACCCAAGGG ACTCGCTGAG CCCCCCCGCC CAGAGTCTGC CCCTGCTGCT GAAGCAACTG    184920
     AATCTCTCCC ACCTGTTGGA TCACCTGGAC GCTATCGAGC ATCAAGCTAC GCAACAGAAC    184980
     TGGTCCTATG GACAATTTTT GCTGCACTTG TGTCACCTGG AAGCCCAACG CCGCGAGCAC    185040
     GTTCGCTTGC AACGCAGTCT CTCAGAAGCT CAACTCCCCG CCGCAAAAAG TTTTACCAAC    185100
     TTTGATTTCT CCCACTGCCC CCAGTTCAAT CCCGCCCCCT TGATGCAGTT AGCCCAAGCG    185160
     ACCGACTGGT TAGCCCGAGC TCAAAACTGT ATTCTGCTGG GTCCCTCTGG GGTGGGCAAA    185220
     ACCCACCTGG CCGCCAGTTT AGCCCGTCGC TGTATTGAGC TGGGCAAGCG GGTCAAGTTC    185280
     TTTGCGGCCA CTGCCCTGGT CCAGCAGCTC CAAGATGCCA AGCTCCAACT CCAACTGTAT    185340
     CCGCTGCTGA AGAAACTCGA CCGCTATGAC CTCTTGGTCC TCGATGACCT GGGCTATGTC    185400
     AAGAAGAATG AGACGGAAAC GTCGGTGCTG TTTGAGTTGA TTGCTCATCG CTATGAACGC    185460
     AAAAGCCTCC TGATTACCGC CAATCAACCC TTCAGTCAGT GGGATAGCAT TTTCAGTGAT    185520
     TCCATGATGA CAGTCGCCGC CATTGACCGG TTGGTCCATC ATGGCGTGAT TATTGACGTG    185580
     CAGGCCCCCA GTTACCGCAA AGCTGCCGCC AGCCAACGTC TAACCCAATC TGCTGCCACG    185640
     GCATAACCCC AAGCCCTAGC GTGACACCCG ATCTGATCCG AGCTTGTCGT CCCGATCTGA    185700
     GCTTGTCGTT ACGATCTGGT CGAGATCTGA AGTTGTCATT GGACCCAGCG ATGGTCGTTT    185760
     GACTCTAAAG GGGGTGCCTT TAAATCAAGT TGACTCCCTA TCCACCCGAC CAGTAGGTTG    185820
     TCGTCATCTT GCTATGTGCT TGACATTTGA CACTTGCTGC TGTTCCTCTA ACCACAATCG    185880
     CAAGCGTCGG TCACTACCGT AGACTTCATC CCCACTCACC CACCGATGGG GAACCCCTGC    185940
     CGCAAAGGCC CGTTGCAGCA TCTGACGCGC TAATTAAGGT TTGGTGGCAA ATTCGATTGG    186000
     CTCGGGAATG CCGGCCTGCT GGCATCGCTC TCGCTCTTCG GTCCAACACT TGGGCAAGTA    186060
     GAGTTCTCGA TCTAAAAACG TATACCCGTC TGGGGTCGCG TAACTTAAAA ACACCCCAAT    186120
     CTGGCAATTC TCAATTCGTC CGGCTGTGCC ACTGTACTGC CGTTACACCC CCACTGACTG    186180
     ACTGCCCTTT TTGACAAATC CGGTTTCATC CATCACCAGC ACTGCCTCTG GGTGCCCCAA    186240
     CTGCTCTACC ACATAGGCTC TGGTTTCATC GCGAACCTCA TCTGCATCCC AGACTGAGCG    186300
     TCCGACCAAA TGTTGAATGG CATAAGGAGT CTCATCGCCG GCTTGTTCTG CAATCTGCCA    186360
     GCCATTTTTG CGCTGAACTG AACTGAGCAA CCCTTTGAGA TAATCTTCGG CACCCTGTTG    186420
     GCACTCTGCG ACAGGCCCCC GGCTCTTAGC CCTAGAGCGA GTATGGTATC GGCGTCAGAC    186480
     CAGTCATGGC AAAGACGAGG AGCAGAGCGG GGACCTTGAT CTGGATGGGT TTCGTTTTAA    186540
     TTAACAACTA CAGGTTGAAC GTAACCTCGA CCCATTCCAG CAACATCATT GATAGTTAGT    186600
     CCTGAAATGG CTGCTGAATG AGGGACTGTT AGAATAGCGA TCAACTCTAA ACCGTTACGC    186660
     TGATCGCCGG ACATATAAAA ACATACTTGT ACTTAAAAAC CTATATCTAG TGGGCAGGCT    186720
     ATTAAGTACG ACTCTAACTC AAAGCCTTTT GCGGTAAATC AACTCTTGAA AATCCAGCTT    186780
     GAAGCATGTT CCCCTGCGAC CACAGTTGTC ATCTTCTTGT AAGGGCATTA ATGATAGGGT    186840
     ACCATTCAAC TGCTGAGATA GATCACAGAT CAACTGCATT CCTAAGGATT CTGTGTTACG    186900
     GTAATCCAGT TGCTCAGGGA GTCCTATCCC ATCATCTTTT ACTACTAAAA TAAAACCTGC    186960
     CGCTGCTGCT CTGAACACCA CCCAAATATT TCCTTTGATC TGGTTTGGAA AAGCATGTAT    187020
     CAGAGCATTA CTAACTAATT CATTGATTAA CAGTCCACAG GGAAAAGCTG TTTCTAAGTT    187080
     AATCACTGTC GATTCCAAGT CAAAATGTAA TTTGAGGTTG GGATTACCCC ACGTTGTGAA    187140
     AAGAGATTTT ACCAATTTCT CGATATAGCT GCTGAAATCA ATTTGTGACA GGTTAGGAGA    187200
     TGAATAAAGG TGTTCATGAA CAAGGGCGAT CGATTGAATT CGTTCCTGGC TCTCTTGTAA    187260
     CACTTTAGTG ACATAAGGGT CTGTAATTGT GTCTGATTGA AGCATGAGTA GACTTGAGAC    187320
     AATCTGAAGA TTATTTTTGA CACGATGATG GATTTCCCGC AGCAGCAGTA CTTTTTCTTG    187380
     CAAAGAAGCT TCAAGCGCGG CTGTTCTTTC CTGTACTCGC TCTTCTAACT CTAAAGTCAG    187440
     TTGTCTGAGG TTATTTTCAA TTGATTTACG TTCTGTGATA TCAATATTAA TACCTGCCAT    187500
     TCGAGCCGGT TGACCATTGG GGTCATAAAA TACTTTCCCT TGGCTTAATA GCCAGCGAAT    187560
     TTTGCCATCA GGAAGCAAGG TTCGGAATTC AATATCATAG TTTTGGCCAG TGGCGATCGA    187620
     ATGATTGATA GCTGCTTGCA CTGGCTCTTT GTCCTCAGGA TGTAATCGAT TGATAAACAT    187680
     GGCATAAGAA CCATCAAACT CACCAGGTCC CAGCCCAAAT AGAGTTTCAA GGTTATCTGA    187740
     CCATTGAACC TGCTGCCCTT GGAGGTTCCA GTCCCACATT CCCATCCGTG AAGCTAGCAG    187800
     AGCAAAGCGC AATCGTTCTT CACTCTCCCG CAGAGTGACC ATCGTCTGTC GGCGTTCTTC    187860
     AATTTCTCTC TGCAGTTGCT GATTAACGGT TACGAGTTCA GCGGTCCGTG CTTGTACTCG    187920
     TTGCTCAAGC TCATTTTGAA AATGCCTCAG CTCGTCTTCA ACCCGTAACC GTTCCTCAAT    187980
     TTGGGACTGA AGAAAAGCAT TAGACTGTTC GAGTTGAGTA GGACTTGGAA GGGCTAGAGC    188040
     CTTAGGAATA ATCGGAACCA GTTCAAAAGC CGTAAGAACG GAGACAAAAG CTGTTCCTGC    188100
     CTTAAGGACC CCAGACAGCC AGTAAGTTGG ATGCCAGAGT GTCCAGATCT CCATCAGATG    188160
     GGTTGTTCCA CAAGCAATAA TAAAAGCTAT AAATAATGAG AATATCTGGG GAAAGGGGAT    188220
     ATCTTGGCGT TTACGAATGA AGTAGAGCAA TGTTAGAGGA ATAGAATAGT AAGCAAGGGC    188280
     AATTAGGGCA TCTGAAAGGA GATGTAAACT CACTAATGCT GGTTGCCATA AATAACAGTG    188340
     ACCATGGGGA ATGAAAGGGT TAGCAGTAAA CCAGTTAAGC ATAACGTTAT CCGTAGGTTA    188400
     AGAAACACTG ACAGAGATTT AAGAATGTCA TGGGATGAGT AAAATGATCT TTCCCGCCTA    188460
     ATCCTGCTTT CTTTATAGCT GAATATAGAA ATTTGCTACA ACTTGATAGC AATGTCTCTG    188520
     AAAAGTTTGG TATATTCTTG GTTTTCTGTT TCAGCGGTCA AGGAGTACAA TTACAATTTC    188580
     CATGCTGCCA GCTCTATAGC TATCCCTGTA CCTGATCTAT GCAGTTGATC CAGATAAGCC    188640
     AGAAAGAGGA AGTGAAGGCA ATTTTGCTGA ATCCGCAGTA CGTCTAGCCG CTGTAATTTG    188700
     TTTCTGGATT GTATTTCGGG ACTGCGATCG TCATCGAGCT ATAGTTGCGG ATATATGCAC    188760
     ACTGCACGGG TAGGTTTGTT TAGCTTGCCC GTGCTTATAG TTTTTTTCAA GGGGAGCGAT    188820
     CGCCCACAAA AAAGCCCGCT GGCTGGGCAC CAACGGGACT GGGGTACATG GGTTAAGCGG    188880
     AAAACTTTTG GGCCAGAGTG TCAACGGGGA GCCACGGCAG CGGTCGCGGG GGCTTGAATC    188940
     GTAGCGGTAA CCCAGTTGGA AGTCTGGGCA ATAACCCCGG CTCTTAGCCC TGGCACGGGC    189000
     ATGGTATCAG CGATCAGACC TGTAATGGCA AAAGCGAGGA GCAGGGCGGG GAGGTTGATC    189060
     TGGGGGGCTT TCATGGCTGG CTCTGGGTCA ACTCATCTCA TGTCCCTACT ATCCCAGGTC    189120
     AGCCAGCGGG ACTCAGTGAT GGTTCTGGGG GTGAGGGATG ATCTGCGTCA CCGGCTTCCC    189180
     CTTACCCCCC AGAACACTCT GTAAACTTGT ATTTAAAGAT CGTTTGCGAG ACCATATTGA    189240
     TGGGTTAAAC CATTCCATTA ACAAGTAAAG ATCAACTCCT GAGCGGAAAA GCCCAGGAGT    189300
     TTTTTGTCGT GACGTCAAGA CTGCCGCAGC ACCAGCAGGT CATCAACCTT GCATTCGAAA    189360
     TACCGGCACA AGACTTCGAT CGTGTGGGTA TCTACCCGGC TGAACTTGTT ATTAAACAAC    189420
     CGATTGACGG TTGTAATGCC CAACCCAGTG TCATCTGCTA GCTTATGCTG GGACAGTTTT    189480
     GGGTCTTTCT CTGCCATCAA GACAGCCAAA CGGCAGTAAA TTTTGAGCGG ATTCGCGCCT    189540
     TCCTTTTCTA TATCCATCCG CAAAATATGT CTCCCGACAC ATAAATATGA ATTATAGAAA    189600
     ACTATAAACG ATTAGGCATC AAAAAGGAAT TTTTAACCGT TTTTATACCT GCTGTTTTTC    189660
     TTGATTTGAT AATAAAAAAA ATGCCATCCA AGGAGTAATT GGATGGCAGC TCTTAAGATG    189720
     TGGGGTTTTC CTGATTCTAA GTTTTCGAAG GAGAGAAAAC ATTCCCTAAT GCCACAGAAA    189780
     GCAGATGGGA GGCTTAGGGA AAAGCCCTTC GGCATTGGCA CATCCATACC GGCACCTTGG    189840
     CTACAGGATT ACCAATTTGC GCCTTACCCT TTCGGAGTAA GTTGCCTTTT CGGGACTTTA    189900
     ATACGCTAGC GGGGGGTGCA GCGTAGATGG CACTACTGTA ATCTCCAGCC TCAAGCAGGG    189960
     AGAACCGTAA ATTCACGGAA TTTGTATATA TTAACCCCTA TTAAAAATCC CCTCCGGTTA    190020
     ATCATTGATT GAAACCAAGG GGATTTTTTA CTAGAACAAG GAAGGAGCGA TCAGATTCCT    190080
     GTTCCGTATT ACTAGAGTTC CCCTTTGCAT GGAAAAACCT TCGTCATTTT CCTCCATTGG    190140
     CCCACCTACT GAACCCTTCA AGAGTCCTGA CAGCTTATTA ACGCAAGTGC TTATATATCT    190200
     TTGACCTTCT GCCTACTTCG TAATGGGCCA AGATCCCATA ATGCCAGTGG GGGCGGTATT    190260
     TCCAGGAATA CGATCGCCAT CCCATTCTGC TAACACCGTC CAAATGGCGG AACTTCGTAC    190320
     TCTCGCGTTT GAACCGCTAG AGTGTTCCCG GCCCCGGGGA AAAGCTCAAG ATGCCTTGCG    190380
     TAAACAGGAG AAAAGCAACA AATAAGCCAC CCATGGGATT GGATGGCTAT GTTTCGTATA    190440
     GATCTTTAAG TTACTGGCTC TGACGTATAC TTTAACGGAC TAAAGCTTTG CGAAAAGTTA    190500
     ATCAACAATA GTCTTCCCAT TCTTTGTTGA TGCTAAGCCA CCGGCGATTT TGTTTAGCTC    190560
     GTCTTGTCCC AGATCCAACT CTTCATCGTC TTGGATCTCG TTGAGGTTTT CATCATTAGA    190620
     CACTTGGGAA GTTTTATTGG GATCCATTGC TTTTCTCCTG GAACACTGGG TTGATGGTTT    190680
     TATAGTACGG TGGGCAAATT CAGCTTGCAG TGACAAAATA ACACCCAGAG TATGATCGTT    190740
     AATAGGAAGA AAGTGTGATC TTCATCTGCA GTCAGGGCAG CGATCGCCTA TAAAAAAGCC    190800
     CGCTGGCTGG ACACCAACGG GGCTGAGGTA CATGGGTTGA GCGAGAAAAC GTAAGGATAT    190860
     CAATACTGGT ACTGCGACGC TCCCCAACCC CCTACAAACA CGATCGCTCC TCCTGAAATT    190920
     TGCCGTAATT CTTCAGGGGT TAGCATTTCA TCTGTCTGAT CATCTAGCAT TAACGATTCA    190980
     TCTTTCACTT CTGTAGCCAG TGAAGTTTGA GCGATATTCT GTCCGGGGAT GTTCATCATT    191040
     CTTCGTGTCT CCAAGCGCAT ACATGACACA TTCATCCTGT CAGATCGGGG ACATTGCGCT    191100
     GGTGACGACC AGCACCGCAC TTCTGTGATA GATTGGCTTC TCACAAGTGG TAAATTTTAG    191160
     CGTAAGTGTT TATAGCTTAT TGCCCTTCTA CCTGCTCCCC AATAGTCCAA GCCCCCTGCT    191220
     ACCTCCCCCG GAGCGATCAC CCCACAAAAA GCCCGCTGGC GGCAAACCAA CGGGGCTGAG    191280
     ACGAGTGGGT TAAGCTAAAC CTTCTAAGGG ACGAGTCTCA ATTTTTTGGG TTCACGGTGC    191340
     CAGGGCAGGC TGCTCCTCCA GCGACGCGGT TGAGTTCCTC TGCCCCTAAA TCTGATTCCT    191400
     CCTCCTGCGA AGCTTCCTTG TCGATTTCCT CAGATTGTTC TTTAGGATTT TCGTTAGGAT    191460
     CTACCATTTT TCTTCTCCTG GAATACTTGG TTGATGGCTT TGTAGTACGG TGAGCAAGTT    191520
     TAGCTTGCAG TGACAAAATA ACACTCAGAG CATGATCATT AATAGGAAGA AAGTGTGATC    191580
     TTCATCTGCG GTCAGGGCAG CTATCACTCA CAAAAAAGCC CGCTGGCGGC AAACCAACGG    191640
     GCATGAGATG AGTAGTATGG GAAAACTTAT GGGTGAGTCT CAACGGGGAG CCAGGGCAGC    191700
     GGCAGCAGGG GCTTGAATCG TAGCGGTGAC CCAGTTGGCA GTCTTGGCAA CAACCCCGGC    191760
     TCTTAGCCCT GGGACGGGCA TGGTATTAGC AATCAGACCA ACGATGGGAG GCTGAGGGAA    191820
     AAGTCCTTCG GCATTGGCAC ATCCATACCG GCACCTTGGC TACAGGATTA CCAATTTGCG    191880
     CCTTACCCTT TCGGAGTAAG TTGCCTTTTC GGGACTTCAA TACGCTAGCG GGGGGTGCAG    191940
     CGTAGATGAC ACTACTTTAA TCTCCAGTTT CACACAGATA AAACCGTAAA TTCACGGAAA    192000
     TTTTATATAC TATGCGTTCC TAAAAATCCC CCTCTCAAAA TCCGAACGAT CAGGAAACTG    192060
     AGGTGAAACC AAAAGGGGAC CTAACCGGAA CCAATCACGG AGCAGTAAAG CCTAAATCAA    192120
     TCTAAGCACC AATTCCACAG ACCACTAACG AAGAACCTAT TTCCTTGGAG CGATGCGGAC    192180
     GTGAAGAAAC AAGTTTAAAA TCGCAAGTTT TATCTAAAGG GGCTTATGCT CAAGGAAACG    192240
     CGGGGGAAAT AAGAGCTGTA ATGGGAGGAG AAGAAAATAT CGCTCCGACT CCTCCCTTTA    192300
     CAGAGGAACC AGAAGCAGAA CCCATACAGC TAAGCGATGC CCTGGTACAT GAATTGAGTG    192360
     AGGTAGGGGT CAGGCTTAAT AAAGAACTGC TATCAGCGGT CAGTTCAGGT ATTGGATTAA    192420
     TTGCAGGAAT AGCAACCTTT GCATCCTTGC AAGGGTTGCA TGAAGTCACC ATCGAAATTG    192480
     ACGCGAACGG GAAACTTCGG ATCAAGATTA CACCAAAAAA AAGGTGAAGA GTAGAGCGGG    192540
     GAGGTTGATC TGGGGGTCTT TCATGGCTGT TTTGAGGTCA ACTCATCTCA TGTCCCTACT    192600
     ATCCCAGGTC AGCCAGGGGA TCTCAGTGAT AGTGCTGGGG GTGAGGGATG ATCTGTGCCA    192660
     CCGGCTTTCC CTTACCCTCA AGAACACTCT GTAAGCTTGT ATTTAAAGAT CATTTACGAC    192720
     ACTACATTTT TGGATTAAAC CATTGTACTT ACAAGTACAG ATCAACTTCT GAGCGGAAAA    192780
     GCTCAGAAGT TTTTTGTCTT GAAATTAAGA CTGCCGCAAC GTTATCAGGT CACTAATGTT    192840
     GCATCCGAAG TACTGGCATA GGACTTCGAG CGTATGGATA TCCATCCGAT CAAATTTATT    192900
     ATTGAACAGG CGGTTGATCG TTGTGATAGC CAGCCCAGTG TCAAAGGCTA CCTTATGCTG    192960
     GAACAGTTTT GGGTCTTTCT CGGCCATTAG GACAGCCAGA CGGCAGTAGA TCTTGAGCGA    193020
     ACCCGCGCCA TTATTCATTA CACCCATAAT TAACTCTCCC TTCAACAGAG AAATATAAAG    193080
     CATAAAAACT ATAAACCATT AGGCATCAAA AATGGCTAAA GTCTCATTTT TGATGCCTGC    193140
     TATATTTTCT TAGTCTAATA ATAAAAATGC CATCCAGGGG GTAATTGAAT GGCTGATATC    193200
     ATCAATGTGA GGTTTTACCG ATTACAGTTT TTTCAAGGAG AAAAAACTTT CTCTAATGCT    193260
     ACAAAAATCC CCTGAAAAGC TAAGAGAAAA GTCCTTCGGC ATTGGCACAG CCATACCGAT    193320
     ACCCTGGCTG CAGGCTTACC AATTTGCGCC CTACCCTTTC GGAGTAAGTT GCTTTTTCGG    193380
     GACTTTAATA CGCTAGCGGG GGATGTAGCG TAGATAACCC TACTGTAATC TCTAGCTTCA    193440
     GGCAGGGGGA ACCGTAAATT TACGGGAAAA TTTATACAAT AAGTATTTTC AGAATAAAGA    193500
     TTTATTACAA CACCAAACTT GCTTTACTTA TGGGTATCCT TAAACGAAGG AAGCTTAAGC    193560
     TTTCTGCTAT GCAGAGAGAG AAATCATCAC AAGAAAACGT CACTTCTGCA ACACGATACT    193620
     ATGACCACGG CTGCCCATCA AAACCTCATT GTCTCTCGCG TTAGAGTTCA TCGGCATCTG    193680
     AGGATTCTTG CCTGTGATGG TCAGTGTGGA AAAGCGTGGG GCATTCATCG TCGTCCCAAG    193740
     ATTCAGTTTG ATGACAATGA TCCCGATGAC TATGCCTGGT TTGCAGATAG TGAAATAGGT    193800
     ACTGCACCTG TCGATCCAGG GACAGAAGAG GATGGGGATA GTAAACCCTT AAATCGTATT    193860
     CATAACAGAT GGTGTTATCT CGAATGTGAA CGCTCTGATT GCCGTCCAGT AGAAAAATTT    193920
     CGAGCTATCC AATTACCTGA CTTTACCGAT CGAATATATA ACCAACCCTC TAAGCATCCG    193980
     CCAAGAGAGC CATAGGGTAA CCCACTGTCT GCAAACGTCA CAGCTTTAAG TTTTGCCCTT    194040
     CTGCCAAATA GCAGAAGTTC CTAGTTTTGC GCATATTTGT GCTAACGTCT GCCGATCTTG    194100
     AGAAGCTAAT CTATCACAGG ATGGCGGTGC TGGTCGTCAC CAGCGCAATG TCCCCGATCT    194160
     GACAGGATGA ATATGTCATG TATGCGCTTG GAGACACGAA GAATGATGAA CATCCCCGGA    194220
     CAGAATACCG CTCAAACTTC ACTGGCAGCA GAGGTGATGG ATGAATTCCT AACGCTAGCC    194280
     GATCAGACAG ATGAAATGCT AACCCCCGAA GAATTGCGGC AAATTTCAGG AGGGATTCTT    194340
     ATCGGGCTGC TGTTGCCGGC AGTGCAATCG GCCAGATAGG CCGCCCGTTA AACAAAATTA    194400
     CAGGTCTGAT CGCTGATACC CTGTGCTCCA CCCAGGGCTA AAAACCGGGG TTATTGCCCA    194460
     GAGTGCCAAC TGGGACACCG CTACGATTCA AGTCCCCGAG ATCGCTACTG TGGTTCCCCG    194520
     TTGAGACTCA CCTACAAGTT TCCCGCTTAA CTACTCGTCT CAGTCCCGTT GGTGTCCTGC    194580
     CAGCGGGCTT TTTGTGGGCG ATCGCTGCCC TGACCACAGA TGAAGATCAC ACTTTTTTCC    194640
     TATTAACGAT CATGCTCTGC GTGTTATTTT GTCACTGCAA GCTGAATTTG CTCACCGTAC    194700
     TATAAAACCA TCAACCCAGT GTTCCAGGAG AACAATAATT ATGGATTCCA ACAGAGCTTC    194760
     CCAGCAGTCC GACGAGCAGT TGAATCAAGT CAAGGTAGAG GAAGAGCAAG ATCTAGAACT    194820
     GAATGCAGAT GACCTTAAAG ATGTTGCTGG GGGCGCGATT ATGCATGATA GAAAGGGCAA    194880
     CCTGTAAAGT AAAGTTTCTC GTTATCTTAG CCAACGTCAA CAAGTATTTT AGGAGAACAA    194940
     CAATGGACCC CAAAAAAAAT TCCAAAATGT CTAATGATGA AAACCTCCAC GAGATCCAAG    195000
     ACGATGAAGA GTTGGATCTG GGACAAGACG AGCTAAACAA AATTGCCGGT GGCTTAGCAT    195060
     CAACAAAGGA CGGGAAGACC ATTGTTGATT AACCTTCCGC GAGGTGCTAG ACCGTTAAAG    195120
     TATACGTCAG AGCCAGTAAC TTAAAGATAT ATACGAAACA CAGCCATTCC ATCCCGTGGG    195180
     TGGCTTATTT ATTATTCTTC TGCTGTTTTA CGCAATTCAT CGTGGGGTAG TCCCTGATAT    195240
     TGTTGGTGAA GTATCGAAGG AATCATCCTA TGGATAGACA GAACTTACAG CCTCAACAAG    195300
     CTCAACCCAT CCATCGCACC ACTGCAGGTC AACTACCTGC GAAACAGGCT GAACTGTCGG    195360
     AAGAAATTTT GTCTAACTCT TGTGTAATAT CCTCACACTA TTTAGGTACA GCGTGGACAG    195420
     GTTGTAGTGA GTGTTCTTAT GATGGGGACG AGGCAGAGTA GGCTCTCATC CTGCCAACTG    195480
     CTTACTCAAA CAAAATAACC TGACCATCGA GATCGGGTTG CTAAAAGGTA AGTACTCTTT    195540
     CAATGCTATA AGCACGGGCA AGCTAGACAA ACCTGCCCGT GTAATTTCAT ATATCCGTAA    195600
     CTATATTGTC TGGACTATTA GAGGCAGAAC CAACAAGTAG CTTCAGCTTT CATTTTGTTA    195660
     GCAACTTGGG CAATTAAGGC TTCTTTGGTG ATTTTGGTGT TCATGGTTGT TTCTCCTGAG    195720
     TGAGATTGAA TTTGTTTGAT GTTCTAAGAC TATCGGCAGG ATGTGACGGG GTTATGCTGC    195780
     CCCCATGAAG AGGTTGTGGC AGCTTTGGCT TGACGATCGC CCCAATAGAA CTTCCTGCTT    195840
     AACCGAAACC AGCCAGTCCC GCTTGAATCG TCTGCATTAA TTCGTCATCA CTCATCTGCG    195900
     CTACATCCGC TGTGATCACG GGTCTGGTTT TCTTCTGGCT ATCAGCAGAC GCAAAACCAC    195960
     CCAGGATCTC CATCCGCAAG CTAACGATCT TGATTATTTC GGAAAGAAAC CGGGGGTCAC    196020
     CGTTTTGCGG CTCGCGCCGG GTCACATGCT TAGGCTTAGT TATAGCGTAG GAAAATTTTT    196080
     GGTCGTTAAG GCTGAAGAGC TTACGAGATA AGGCTTCTAG GAAGATATAT TTCTATGCCT    196140
     GTAGATGATA CTGGCTAGTT AACTGTCCCA TTTTTGACTA TTTATGGGAC GGTTAAGTCC    196200
     TGAAAGTATT GATTTGTCGT TGATCTGTCC TTACTTATTG AACCTGCTCA ATTACCAAAA    196260
     ATGGGACAGT GACTCTAAAC CCTTCCTAAA CGACCAAATT TTTTCCGTTG CTAACCCTAA    196320
     GCCTAAAGGT ATGGTTATTC AATCGTTCCA GACTAAACCG TATCTTTTGG TTGAAATGCC    196380
     CCCGCTGGTC CATGAGGGGA TTTGGAACGT GTTTGACCAG ATCAAGGGGG AGGTAGAGCG    196440
     GCATGAGATT CTCGATTGGT ATCACTTGAT GGAAAACCTG GAAAAGGTGG GAGGCTCACT    196500
     CCAGCGATTG GCGCAGGCTC GTTCCTTGCT CTGGCAGGGA AAAGTAGATG AAACCCTGGT    196560
     CTTGTTTGAA GGCTGTCAAC GCCATCAAAC TCACTGTTTC TGTCAGTATT TACGCAAGCA    196620
     TCGCCATCGC ATTGGTAACT ATGATTATTT ACAAGCTGAA GAAATTTGTT CCATTGGCTC    196680
     TGGAGCGGTT GAATCAACGG TTAAGCAAAT TGATCGTCGG CTCAAAATTT CAGGAGCACG    196740
     ATGGAAACCG GAGCATGTTC CAACCGTTTT AGCGCATCGT TGTGCTTATC TCAATCACCA    196800
     GTTGTAACCC ATTTTCCTAT GGAGGAAGTG ACACGCA                             196837
//

If you have problems or comments...

PBIL Back to PBIL home page