(data stored in ACNUC8465 zone)

HOGENOMDNA: CYAP4_2

ID   CYAP4_2; SV 1; empty ; DNA; empty ; PRO; 34726 BP.
XX
AC   NC_011882;
XX
PR   Project: 59435;
XX
DE   Cyanothece sp. PCC 7425 plasmid pP742503, complete sequence.
XX
OS   Cyanothece sp. PCC 7425
OC   Bacteria; Cyanobacteria; Chroococcales; Cyanothece.
XX
RN   [1]
RP   1-34726
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Complete sequence of plasmid3 Cyanothece sp. PCC 7425";
RL   Unpublished
XX
RN   [2]
RP   1-34726
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (09-JAN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-34726
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (06-JAN-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001347.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082850
CC   Source DNA and bacteria available from Himadri Pakrasi
CC   (pakrasi@biology2.wustl.edu)
CC   Contacts: Himadri Pakrasi (pakrasi@biology2.wustl.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..34726
FT                   /strain="PCC 7425"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cyanothece sp. PCC 7425"
FT                   /plasmid="pP742503"
FT                   /db_xref="taxon:395961"
FT   gene            11..568
FT                   /db_xref="GeneID:7280612"
FT                   /locus_tag="Cyan7425_5269"
FT   CDS_pept        11..568
FT                   /locus_tag="Cyan7425_5269"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cthe_1137"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_1137 hypothetical protein"
FT                   /db_xref="GI:219883410"
FT                   /db_xref="GeneID:7280612"
FT                   /translation="MELAREILPLWTDWGIEDSGVLIHSLGVTFLTSIGQHLGYVSVSE
FT                   VPVPQQGPFAHVGDDVRSDSIWFDRSNRSPVLIAEFERYSGSDEHKLKLESKVKNLLLA
FT                   QHRCSPTSKPTAILLLAYWTKGLASLPKHAELQSIVQHGFETRSRQKVLGCNSRLLFLQ
FT                   FVMQESNSNLLHLTRIITRGVS"
FT                   /protein_id="YP_002478570.1"
FT   gene            565..2055
FT                   /db_xref="GeneID:7280585"
FT                   /locus_tag="Cyan7425_5270"
FT   CDS_pept        565..2055
FT                   /locus_tag="Cyan7425_5270"
FT                   /gene_family="HOG000081318" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: tyrosine protein kinase; Serine/threonine
FT                   protein kinase-related; SMART: serine/threonine protein
FT                   kinase; KEGG: cth:Cthe_1136 TPR repeat-containing
FT                   serine/threonin protein kinase"
FT                   /db_xref="GI:219883411"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:7280585"
FT                   /translation="MSRQNPFFLLRADRRLGNRYELLECLGDGSYGWVWRAQRLEDNEI
FT                   VAVKIPKEQGAKNEDLAEGERLLGAEPHPNIIGLFWMGRVPPEKEWYAIEMEYFPSQTL
FT                   AQLIERDDPQFLDSKNQAFLASYERVLSIYQQILAGIEHLHKLGMSHGDIKPQNILISG
FT                   DLIKLTDFGCSTLPEEMYARTRQNGGTILYSAPEVVGSSWRGRSSQELFKADIYSLGVL
FT                   LYYLVTARLPHDTLSQVARHTPFPRPREINSSIAPSLEDFILHCLALAPEERWNSVEDM
FT                   VTAFGQVRRCQLGYNPIRPLPIKDRPSEDWSSQVVRLIEDKEYRQAEHVAAREFERSGD
FT                   LHAFLLMLKSAYKDNRYFDCLQILESHSEALLGESSLLRDLRRIALATYIETRQIRQAE
FT                   EIVEKCLADDSTSPEVLMIKASLLGLQAKYEEASRILLALNRQYPGKPSILKRLVLVFE
FT                   QLRDTGKTTAFLRAYLKVCPESTWALQKVEHLYTIGVK"
FT                   /protein_id="YP_002478571.1"
FT   misc_feature    622..1401
FT                   /note="Protein kinase domain; Region: Pkinase; pfam00069"
FT                   /db_xref="CDD:143851"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    640..1401
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    order(640..654,664..666,703..705,709..711,793..795,
FT                   850..861,871..873,877..879,1021..1023,1027..1029,
FT                   1033..1038,1042..1044,1072..1074,1081..1083,1129..1140)
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    order(640..654,664..666,703..705,709..711,793..795,
FT                   850..861,871..873,1021..1023,1027..1029,1033..1038,
FT                   1042..1044,1072..1074)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    order(652..654,871..873,877..879,1021..1023,1027..1029,
FT                   1033..1035,1081..1083,1129..1140)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    order(1069..1089,1129..1140)
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cyan7425_5270"
FT   misc_feature    1438..>2019
FT                   /note="putative PEP-CTERM system TPR-repeat lipoprotein;
FT                   Region: PEP_TPR_lipo; TIGR02917"
FT                   /db_xref="CDD:163072"
FT                   /locus_tag="Cyan7425_5270"
FT   gene            2203..2400
FT                   /db_xref="GeneID:7280586"
FT                   /locus_tag="Cyan7425_5271"
FT   CDS_pept        2203..2400
FT                   /locus_tag="Cyan7425_5271"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883412"
FT                   /db_xref="GeneID:7280586"
FT                   /translation="MGDAKEYELFLQEIQQIDNLIDNLTKLHYGTLINDSSYDELQDLQ
FT                   KAQSFYGIDSGCVRFCATQP"
FT                   /protein_id="YP_002478572.1"
FT   gene            complement(2764..5337)
FT                   /db_xref="GeneID:7280587"
FT                   /locus_tag="Cyan7425_5272"
FT   CDS_pept        complement(2764..5337)
FT                   /locus_tag="Cyan7425_5272"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syn:sll1563 hypothetical protein"
FT                   /db_xref="GI:219883413"
FT                   /db_xref="GeneID:7280587"
FT                   /translation="MINTNQLLRAAKTIGEIKTIFRFPYVHLICISPSFTDLEPDEREL
FT                   DFCRLAKISVGELRRILRNSLLSLRLLTADEFLEEYPDNKDRGHHWLSALIDQELEETS
FT                   STEEPSTKIKVIHFYGYKGGQARSTLLGLLSTTLAEDGWKVLVVDSDIEAPSLDILYAR
FT                   TSRTLSGTLLGVIQSISDITPERVRTPEGSGYVDLLACRPKSAEFDIDASAFALRCALE
FT                   PMIIENAAKQIVEFAIEKKYDALLIDHRSGLSPVTLPWLNTLPGPTVVCVRLDEQWRPA
FT                   EQFIKSVLRTNSANPGVFVSWKPDDENLDSYRQRNNMQIDSLLDILAEAISEAAEISNS
FT                   FEEEAEISSVELEDHWIVWSYDSAFRQSRLPEKNQLSGLSIESLNKLRSILNISSKITE
FT                   NIDKNTSSLSPSGASDEGDLIQTEALRELSVPNNSISYVLGRKGTGKTRLLRELSKAGI
FT                   GEPLLVDSNSRDSKGLKSPSPELTRAAELYKDTPEKLWWHLLSAAIDAPETSTNELGRF
FT                   FSQEIEQPTNNDPISRILEKIEGKSKRTFLIDGLETAFNAKLIFTYTEVLFRFIQTVET
FT                   DSRLSKHIHIKLFIRSDLVGRGFQNIEQQLHGKSLYLSWDTQKIFNFILSRISRIQWYK
FT                   EQFPSLIEDIEKNRSDILKGSLPTEDCEVLLMKAFPEKIRRNNLATKTFLKTYFADSAS
FT                   DRPEISTSDKLRYYPRVFDKFLQVIADPQPTDVGSFQGSQTEEGKISQNLIFIAHEAAA
FT                   REYLSQLQSELNYLVSLSDDFSENQTRIKALLDAFEGLKTPFKLDECVSELTSKVNIDK
FT                   RDIRTAIERMKNVGMFEDRPDYPGQLRVGRLFKSSLKMKYVRGKK"
FT                   /protein_id="YP_002478573.1"
FT   misc_feature    complement(<4561..4998)
FT                   /note="Antiactivator of flagellar biosynthesis FleN, an
FT                   ATPase [Cell motility]; Region: flhG; COG0455"
FT                   /db_xref="CDD:30803"
FT                   /locus_tag="Cyan7425_5272"
FT   gene            complement(5334..5738)
FT                   /db_xref="GeneID:7280588"
FT                   /locus_tag="Cyan7425_5273"
FT   CDS_pept        complement(5334..5738)
FT                   /locus_tag="Cyan7425_5273"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883414"
FT                   /db_xref="GeneID:7280588"
FT                   /translation="MLHTYNQQSFKVGGTDPRNPLLCLYCSLVVLELAIKDYLHQSGPW
FT                   RKGHCIIDWLTTDLGETSLGTQLESKLSALYCTYRDGSEVNVDANRYPDIRYLRHETDF
FT                   PGKSTDSQLKEALEIIKDIKTRLISRGIRL"
FT                   /protein_id="YP_002478574.1"
FT   gene            complement(6327..6653)
FT                   /db_xref="GeneID:7280584"
FT                   /locus_tag="Cyan7425_5274"
FT   CDS_pept        complement(6327..6653)
FT                   /locus_tag="Cyan7425_5274"
FT                   /gene_family="HOG000037328" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MAE_47810"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_47810 hypothetical protein"
FT                   /db_xref="GI:219883415"
FT                   /db_xref="GeneID:7280584"
FT                   /translation="MTSPALFDVVELLINLPEHNLQAGAQGAIVEQYPDQRYEVEFTNL
FT                   DGETTALVTLPLEQFFVVWRAASKTWVPLTEKIEALVQVLPEETRLEVFDFARFVYSRR
FT                   AQSY"
FT                   /protein_id="YP_002478575.1"
FT   gene            complement(6650..6997)
FT                   /db_xref="GeneID:7280589"
FT                   /locus_tag="Cyan7425_5275"
FT   CDS_pept        complement(6650..6997)
FT                   /locus_tag="Cyan7425_5275"
FT                   /gene_family="HOG000287180" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MAE_47800"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_47800 hypothetical protein"
FT                   /db_xref="GI:219883416"
FT                   /db_xref="GeneID:7280589"
FT                   /translation="MKLSDVVAQVVIDPRKLINYALDPENPVGSNKAIIFQRRLGYTKD
FT                   NYEPLLQQIHAQALGAEAVPTQLDQHGQRYQVDLEVDGVEGQKAIVRTGWIVEPKANFA
FT                   RLVTLYVRKQP"
FT                   /protein_id="YP_002478576.1"
FT   gene            7050..7283
FT                   /db_xref="GeneID:7280590"
FT                   /locus_tag="Cyan7425_5276"
FT   CDS_pept        7050..7283
FT                   /locus_tag="Cyan7425_5276"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883417"
FT                   /db_xref="GeneID:7280590"
FT                   /translation="MNSSVIYERKPKETAAPDGDSDAEPSEKTVENSSPPPMENSQSKK
FT                   ESKPDGKSGSGNTNATTAWTAAQGPLRNVQIR"
FT                   /protein_id="YP_002478577.1"
FT   gene            complement(7336..7887)
FT                   /db_xref="GeneID:7280591"
FT                   /locus_tag="Cyan7425_5277"
FT   CDS_pept        complement(7336..7887)
FT                   /locus_tag="Cyan7425_5277"
FT                   /gene_family="HOG000069478" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gll3044"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gll3044 unknown protein"
FT                   /db_xref="GI:219883418"
FT                   /db_xref="GeneID:7280591"
FT                   /translation="MNAPLRFCLDLNIWCAALLAERKGRQGTAAQTLVQIVRFGTCPLG
FT                   PVQLVISWGMLNRLRLVLERDLGVIPESADLLIETIAGYAHLGPAGISPQLILGGTGVL
FT                   ALRDQEDAHVVEVAIAGQANLLITANFKDFLSKDTNVVVPEQHAIHNAPGHRFHIVHPY
FT                   LALDWLRSDTIPPLTTHAQI"
FT                   /protein_id="YP_002478578.1"
FT   misc_feature    complement(7450..7875)
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_5277"
FT   gene            complement(7897..8241)
FT                   /db_xref="GeneID:7280592"
FT                   /locus_tag="Cyan7425_5278"
FT   CDS_pept        complement(7897..8241)
FT                   /locus_tag="Cyan7425_5278"
FT                   /gene_family="HOG000069477" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gll3045"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gll3045 unknown protein"
FT                   /db_xref="GI:219883419"
FT                   /db_xref="GeneID:7280592"
FT                   /translation="MMSGKTISAYTDAATAERVTALAKLEGRSTAQIAGLALKFFTRLP
FT                   VEARTALHQIELLGEPGDLEVVLRDITRTLLHRQYEIAQRQVVEQMQIDHLEPLETEDD
FT                   FLAAAIRLTQ"
FT                   /protein_id="YP_002478579.1"
FT   gene            8427..9068
FT                   /db_xref="GeneID:7280593"
FT                   /locus_tag="Cyan7425_5279"
FT   CDS_pept        8427..9068
FT                   /locus_tag="Cyan7425_5279"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   cyt:cce_5220 hypothetical protein"
FT                   /db_xref="GI:219883420"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7280593"
FT                   /translation="MSVIAIVNQKGGAGKSTTAVHLACWLKKKRKELLLIDADAQQSSS
FT                   HWLKGMENSVPYLVMQSPDDLLEQLPELAKKHGYVIVDGPASLSETTRSILFRADLAIV
FT                   PCQPTGVDLRSASDAVRLIKQAQSVRGGMPKAAVFLSRAVKGTKLKDEAIALLGQTPGV
FT                   ALLKTVIHQKQAIADTSGQSATVWQLGTRPAAESGREYDQLFKEILEMLS"
FT                   /protein_id="YP_002478580.1"
FT   misc_feature    8433..9065
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="Cyan7425_5279"
FT   misc_feature    8433..8849
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5279"
FT   misc_feature    8454..8474
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5279"
FT   misc_feature    order(8472..8474,8673..8675)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_5279"
FT   gene            9065..9364
FT                   /db_xref="GeneID:7280594"
FT                   /locus_tag="Cyan7425_5280"
FT   CDS_pept        9065..9364
FT                   /locus_tag="Cyan7425_5280"
FT                   /gene_family="HOG000054827" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /codon_start="1"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: cyt:cce_5221 hypothetical protein"
FT                   /db_xref="GI:219883421"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="GeneID:7280594"
FT                   /translation="MSKSRKPLDDALAKEFVYGEHTSSRPTQPEPTSLPISQPESNLMA
FT                   KLLDGEPKEATIRLTVDLPESMHRKLSLLSARTGKKKAAIVRLLLTEALEEVQE"
FT                   /protein_id="YP_002478581.1"
FT   gene            9493..9702
FT                   /db_xref="GeneID:7280595"
FT                   /locus_tag="Cyan7425_5281"
FT   CDS_pept        9493..9702
FT                   /locus_tag="Cyan7425_5281"
FT                   /gene_family="HOG000287181" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_F6102"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_F6102 hypothetical protein"
FT                   /db_xref="GI:219883422"
FT                   /db_xref="GeneID:7280595"
FT                   /translation="MQLLDVVVVVRDLPDLNLHQGQVGTIVEVYAPNIFEVEFVDLQGK
FT                   TYAIATLDANQVMQLHYQALPQIA"
FT                   /protein_id="YP_002478582.1"
FT   gene            complement(9819..12302)
FT                   /db_xref="GeneID:7280596"
FT                   /locus_tag="Cyan7425_5282"
FT   CDS_pept        complement(9819..12302)
FT                   /locus_tag="Cyan7425_5282"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: . ; K03733 integrase/recombinase XerC"
FT                   /db_xref="GI:219883423"
FT                   /db_xref="GeneID:7280596"
FT                   /translation="MVLNTISEAVQRFDESPEIRNNPRLGDNLKSVLRRYILPSYDFTP
FT                   EELRHQLDQCLAKVSLRDLKDFEAKFEAQLQLLQSQGTLPSAGTVRNYRSALNRFRGWV
FT                   EEQPWFVPVLPVGPQSDRAPVMSVGRSKAVLTEQKRAAKQTFGYLAAFPLQPQVLTLES
FT                   LPETVQQQFLGLEAFWTKPDVPARKGDPIEAAKFAICQNVLLVFVDWLSIEKALPAAEL
FT                   NLQSMGVMEDLQAFIEWGLLQKQGYGWASEVAEVALLVVKWANPQSKQYHFADVPVIWP
FT                   LKRYIQQLKSQREDIGFYRLQPSEVSERLRVQLDRYRSFCLDLEVPERKGKAIAEKTLK
FT                   VYFEGIHAFLGWLHRYSPWLTSLSELELADITNLDLLQPFISWGINVRKNRYGWAKNVG
FT                   QTALSVAKFLNPQARRKDFSDVEQVELVREYARYLQEQDRNQEGKDEPEGRLLTFQEAQ
FT                   VIVEYLKKCCAPLDKYGDERSFRAQLQAWQRYLIIALLTYCPVRQKEIREMEQGKTLFR
FT                   EADRYWVKLKPSQHKAGRRTGKGREYPLPQHLTADLDTWWEKWRSTIPTSHRLVFIQTG
FT                   ANRCPETQGRPLNETGVTDLVGDSITSATGILFGESFEVTPHSFRDIGVTYQRRYGRPE
FT                   QQEAFAELMGHTPQEANRTYNRQTSRERTQKADGWWQLQLPLSAPESNHLPKVIPQSWS
FT                   DEDDYELSHLDPSVTENLQLKQLRDQVVLALWALEEFTWAQLHRANVGDLVEHDNCYRL
FT                   EVNSREGQREVLLKPQMTQIIRRYFDKRTALGEELMPLSPFLIAIGNRAGGKRLWPRGI
FT                   QVVVEAYLGKVSSRG"
FT                   /protein_id="YP_002478583.1"
FT   misc_feature    complement(10332..10859)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Cyan7425_5282"
FT   misc_feature    complement(order(10338..10340,10449..10454,10695..10697,
FT                   10794..10799))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Cyan7425_5282"
FT   misc_feature    complement(order(10338..10340,10365..10367,10440..10442,
FT                   10449..10451,10695..10697,10797..10799))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Cyan7425_5282"
FT   misc_feature    complement(order(10338..10340,10365..10367,10440..10442,
FT                   10449..10451,10797..10799))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Cyan7425_5282"
FT   misc_feature    complement(order(10338..10340,10440..10442,10797..10799))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Cyan7425_5282"
FT   gene            complement(12631..13026)
FT                   /db_xref="GeneID:7280597"
FT                   /locus_tag="Cyan7425_5283"
FT   CDS_pept        complement(12631..13026)
FT                   /locus_tag="Cyan7425_5283"
FT                   /gene_family="HOG000006294" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_2836 putative transcriptional
FT                   regulator"
FT                   /db_xref="GI:219883424"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:7280597"
FT                   /translation="MVMLKDILDELPPDRQEKIAARTAELISEEMTLQQLRTAHHLTQQ
FT                   VMAERLKVRQETISRLEKQADMLLSTLGSYISATGGELKLIAQFPDRPPVVLTGLSSLQ
FT                   GSPMEKDALPESKPRRPGRKAKKGSKK"
FT                   /protein_id="YP_002478584.1"
FT   misc_feature    complement(12736..12930)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Cyan7425_5283"
FT   gene            complement(13013..13384)
FT                   /db_xref="GeneID:7280598"
FT                   /locus_tag="Cyan7425_5284"
FT   CDS_pept        complement(13013..13384)
FT                   /locus_tag="Cyan7425_5284"
FT                   /gene_family="HOG000041070" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dshi_0987"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dsh:Dshi_0987 hypothetical protein"
FT                   /db_xref="GI:219883425"
FT                   /db_xref="GeneID:7280598"
FT                   /translation="MPWTVEFHEEFLPEFRQLDQAVQDELLAQAGLLEAIGPTLGRPRA
FT                   DTLNGSKHSNMKELRFDAADGVWRVAFAFDPQRHAILLVAGDKSGTSERRFYKNLIQKA
FT                   DTRFDQHLKRIEEAKNGNA"
FT                   /protein_id="YP_002478585.1"
FT   misc_feature    complement(13028..13384)
FT                   /note="Phage derived protein Gp49-like (DUF891); Region:
FT                   Gp49; cl01470"
FT                   /db_xref="CDD:163984"
FT                   /locus_tag="Cyan7425_5284"
FT   gene            complement(13568..13936)
FT                   /db_xref="GeneID:7280599"
FT                   /locus_tag="Cyan7425_5285"
FT   CDS_pept        complement(13568..13936)
FT                   /locus_tag="Cyan7425_5285"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883426"
FT                   /db_xref="GeneID:7280599"
FT                   /translation="MDPFSFEQPPPDLPDRTEQSRQETPARSKRPPGRTPSMHGIALQR
FT                   TLAEFGICGADLVSTIRLRLNRRATDAQIFALKNGTRQPRVDTIEEIMIGLRLINPAAL
FT                   NYYLQQLGQLAQTWDYQP"
FT                   /protein_id="YP_002478586.1"
FT   gene            14504..17419
FT                   /db_xref="GeneID:7280600"
FT                   /locus_tag="Cyan7425_5286"
FT   CDS_pept        14504..17419
FT                   /locus_tag="Cyan7425_5286"
FT                   /gene_family="HOG000037237" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_B0281"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0281 hypothetical protein"
FT                   /db_xref="GI:219883427"
FT                   /db_xref="GeneID:7280600"
FT                   /translation="MRSLTLTPTTDSDAHLTSSLEIFAARTRLEWTVESGIQGELFQNT
FT                   VKVVADTEVDPYSHEVSYPIHEALNWKPTRFGYQARTTLYAALILNDDGEVWQVKLSHP
FT                   KVDQQKRKARKYERPVGSKSRAWVPRNLPLVLWVAIAARSGLTLSEADLALGFRTWLIN
FT                   HPEVPVTICEGAKKAACLLSLGWAAVALPGIFNGYRKNNQGLIPDLADLATAGREIDIC
FT                   FDRDLKPKTIASVNLAIKRLGWLFVQQGCVVRVIQLPGPEKGVDDFVVAHGEEAFARLY
FT                   STAATLEDWSHQKLWELALTPTLELDQPFLGTLPYPEFGFAFVKSPKGSGKTRALYPLI
FT                   REATRSGRRVVVITHRIQLGRSICNDLGLDWIEEMHQSQTQGLLGFGLCIDSLHPSSQA
FT                   RFDPQDWRGAIVILDELEQIIWHALNSQTCYEKRVLILETLKDLIQTVYSSGGLIIGQD
FT                   ADLSDVSVNYLMGLVEGPIVNPWVVVNSWKPQNPWEVSFYATPDPAPLMAQLEVSIETG
FT                   AVFVCVDSQKASSRWGSINVEAYLKEKHPQKRILRIDSETVADPQHPACGIVERLNQAV
FT                   RDYDIVIASPTIGTGVDLTVQGHFVAVFGIFQGTTPDTEARQALARVREGVPRYIWARP
FT                   FGSGKIGNGSCDYREVARSTTRSIEFNLHLLREFDFDLDRSYDPITLRTWAKMAARVNS
FT                   SLWDFREELRRGLAAEGHQVTVLQPGDCLPSGPVKPALAQIQEQHEQAEAEQIATAEVT
FT                   EADYHRLKTKKAKSSSERSMERKYELQQSYGVEVTPDLVRKDNDGWYARLRLHYYLLND
FT                   IEAVQQRDLRELQGHLERGNQKLALQDVRLLGAQVEALRSLGLPELMRAGREIRGSDPL
FT                   VQQLAVLAIEYARDLKTVLNLTFTDTMTPIQIVQALLSKLGLKLKYLKQERLPDDTRER
FT                   VYQYEIPTDGRTAIFTAWKNRERAWQPSLGTPPIPWFMKAE"
FT                   /protein_id="YP_002478587.1"
FT   misc_feature    15005..15277
FT                   /note="TOPRIM_primases: The topoisomerase-primase (TORPIM)
FT                   nucleotidyl transferase/hydrolase domain found in the
FT                   active site regions of bacterial DnaG-type primases and
FT                   their homologs. Primases synthesize RNA primers for the
FT                   initiation of DNA replication...; Region: TOPRIM_primases;
FT                   cd01029"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="Cyan7425_5286"
FT   misc_feature    order(15020..15025,15032..15034,15173..15175,15179..15181,
FT                   15185..15187)
FT                   /note="active site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="Cyan7425_5286"
FT   misc_feature    order(15020..15022,15173..15175)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="Cyan7425_5286"
FT   misc_feature    order(15026..15031,15047..15052,15077..15079)
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173779"
FT                   /locus_tag="Cyan7425_5286"
FT   misc_feature    <15239..>15430
FT                   /note="DNA primase; Validated; Region: dnaG; PRK05667"
FT                   /db_xref="CDD:180189"
FT                   /locus_tag="Cyan7425_5286"
FT   misc_feature    15428..>15568
FT                   /note="putative bifunctional molybdopterin-guanine
FT                   dinucleotide biosynthesis protein MobB/MoeA; Provisional;
FT                   Region: PRK14491"
FT                   /db_xref="CDD:184707"
FT                   /locus_tag="Cyan7425_5286"
FT   gene            complement(18156..18908)
FT                   /db_xref="GeneID:7280601"
FT                   /locus_tag="Cyan7425_5287"
FT   CDS_pept        complement(18156..18908)
FT                   /locus_tag="Cyan7425_5287"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883428"
FT                   /db_xref="GeneID:7280601"
FT                   /translation="MGELIFNIVLRVKVEDGTPQITSSDIDIIQGGMDLLSRARAKLKE
FT                   LSFSDKFEENKTAQYVGYRPKRTTPGVRRYSLVLSQRKDGLLISLPGTFVRPYLLRLGY
FT                   DIESPIEPEYLCDNDDGSKHHLVCIGDDYWIITSKEYDFLNLNKIYKGIYRGEVCGSFS
FT                   LDPDNLDPDVLTDREKTSLSVVEGEEFAYWDHSSYIKQLESSGCCLKATHDTLFPYCTQ
FT                   FFVSSGDVLDEFISYFGQKLIEEYRTNL"
FT                   /protein_id="YP_002478588.1"
FT   gene            19367..20809
FT                   /db_xref="GeneID:7280602"
FT                   /locus_tag="Cyan7425_5288"
FT   CDS_pept        19367..20809
FT                   /locus_tag="Cyan7425_5288"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883429"
FT                   /db_xref="GeneID:7280602"
FT                   /translation="MGQLCSIRIPSERLSSENWCAALFCQFTIANLSDEAVRIELRELA
FT                   QSILEGWRVSTVQGRAGYDPRIQDAPIYRQANLEPMRFRLDAEHWKSPEVEGAWCVQPG
FT                   DVVINKIPPLRAALATSQLPRHPMDGNCILLRSLKDPYGAWIAFCLNQELYADYLIRSS
FT                   GSAALPRVGLKTLSQMPFALPSYADIAGINHQFWQWNDAALTNTESLYHLSAEVEAYVA
FT                   SEVELLQDDGDRLDSSPYHSEKVQAAGSRPSLLPGRFFSAEVINDSWVPSHVQVADWQR
FT                   QLRRRLGWLPLERLLSSDEISRDRLVNVPERGCYLRLSDVRSDFTFVQPEEEDSVAWRS
FT                   RVYCKPLMDEEVLLSTLVTSPQIAFVDESPLETTYVTDHLQRLRFKETPGAWALVLKTS
FT                   PIRAQLARMAMGTAQQFTHVDAVRQLCLPDVPIELRERWERVIRRHHQRKRELEVEWGE
FT                   TWNQTQRLFDAMHSLTGRRKDG"
FT                   /protein_id="YP_002478589.1"
FT   gene            20806..21195
FT                   /db_xref="GeneID:7280603"
FT                   /locus_tag="Cyan7425_5289"
FT   CDS_pept        20806..21195
FT                   /locus_tag="Cyan7425_5289"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883430"
FT                   /db_xref="GeneID:7280603"
FT                   /translation="MNGAIYEQLTEALKQQPLPLARVHAIVCDAGSRWSEEQLHLFLIC
FT                   MDGVEVDAGVEPTVVRLGQRTERDELIDAIRQVVRSRAGRPVPAAEVRRLLPSKFVTTE
FT                   DQIKRLAKETPGLEVFGPGLMRIVD"
FT                   /protein_id="YP_002478590.1"
FT   gene            21222..23228
FT                   /db_xref="GeneID:7280604"
FT                   /locus_tag="Cyan7425_5290"
FT   CDS_pept        21222..23228
FT                   /locus_tag="Cyan7425_5290"
FT                   /gene_family="HOG000245463" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /codon_start="1"
FT                   /product="N-6 DNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: cth:Cthe_1145 N-6 DNA
FT                   methylase"
FT                   /db_xref="GI:219883431"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="GeneID:7280604"
FT                   /translation="MAKTQTKAETEATQEISTIAATMVSLKKEMERKQFSQIKDLTGDA
FT                   EKQAAAVAYGVYKGVETPRILLLALELGQWEKASADYVQQQSYELTPPGTPEDQYPQFA
FT                   IVSDGEHQKIFDITFPAHEIDRLPTLTEINEYKRIKADPTYRWSMKIYFKLMWGFDSFH
FT                   EQVYHHVKDDVSSSNAIIQEVTKLLFLESFRLHHQGADLEFKHEDKTLRLDEVFTVGYV
FT                   KQHGKTAVAAIQAAFDHFRSHQDYVVTDDAGEAHPIFDNKTHLRLSQSRNYETILDLIQ
FT                   NLGPVTDNRDQVVKEQGTLADIAADVLGRLLDVFLRAKFKPEGMGVYLTPAPVKQAMLA
FT                   IAFHDIKTETPELLTARGEDGKPAFRFCDPTCGSYGFGSVAMGYLERALMDVLGKETSS
FT                   DIRRDKLFRDMCEYSFVGADNSQEMVTLARVNMALLGAPKAKIFRTSDSRISEQLKPCS
FT                   YDLICTNPPFGKLKGPAQNDAVLEYFQSDLKERKKKGTFDYEPSVDGLALGGKPDNKGI
FT                   WKPASSGIDLAILFIDRCLQLLKPGGRLLIVLPDGVLCNSGDRYVREYIMGQKDAVTGQ
FT                   FHGGKAIVKAVISLPSDTFKLSGTGAKTSILYLQKRKANPETPKHFLDEPQKDVFMAVA
FT                   DALGYVVKNNVEDYSTGVLNDLVPIVGAYVRGE"
FT                   /protein_id="YP_002478591.1"
FT   misc_feature    22137..23213
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Cyan7425_5290"
FT   misc_feature    22200..>22631
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Cyan7425_5290"
FT   gene            23228..24895
FT                   /db_xref="GeneID:7280605"
FT                   /locus_tag="Cyan7425_5291"
FT   CDS_pept        23228..24895
FT                   /locus_tag="Cyan7425_5291"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_1144 restriction modification system
FT                   DNA specificity subunit"
FT                   /db_xref="GI:219883432"
FT                   /db_xref="GeneID:7280605"
FT                   /translation="MFITRVATRQIERVRLEAEFYDPVKLENLSWMEQWRDRAHLLKDL
FT                   CEFITDGTHVTPKYQQKGVKFLSSTNIDPFSIDFDNTNHISESEHLKLGQQKCNPEPGD
FT                   ILISKNGRIGTVAVYRDSHQSCSLFVSVALLRYRGNVDIDFITAFSNSSGGWYQFTRSA
FT                   KTGVITNLHLEEIREVLVPEPFKAVQTYIGDKVRQAERLRERSKELASRIQALVQPLHI
FT                   QNALKTPDSKYNRLEGKELQHRLDAKYYNHRSMEVLDACKDESKAINNLMISVSNGFEH
FT                   RTFVDEGQPYITVSEVSSGRLDLTSVPKIPDSVEVPDKALINSNCVLVVRTGSIGIAVK
FT                   VHEEDEGASISSHLIRLEFQEESTAAAVAAFLNSAAGECLLHKISYGAVQPQVGQDELL
FT                   NLPIPRIILDNSEEILQCMNLQEMAIRSAERLTTAAKLLVEGLIEGKISELELQEAQEA
FT                   LQRGDTTLDRQILSRLTRKGIPVRGEKTEEPALFPDLDALYRVLSDHDDTDEDSDWDST
FT                   PESRQRWQTPIQSSRRAAEASIPYSQDATVTLLDEEGD"
FT                   /protein_id="YP_002478592.1"
FT   gene            24895..25515
FT                   /db_xref="GeneID:7280606"
FT                   /locus_tag="Cyan7425_5292"
FT   CDS_pept        24895..25515
FT                   /locus_tag="Cyan7425_5292"
FT                   /gene_family="HOG000287555" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tery_2847"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ter:Tery_2847 hypothetical protein"
FT                   /db_xref="GI:219883433"
FT                   /db_xref="GeneID:7280606"
FT                   /translation="MAYSDFKTLNQVLTAFSLKLVNQFGLFSQVNVIEPSPKLSEQIAE
FT                   NFDLALAIDTEKARSELIVTPILLDIYRRFSPNLSLFSGVALSVDATQGLNGECDFILS
FT                   ASTNQLEVSTPVLTLVEAKNNDIKSGLGQCAAQLVGAQRFNESQQKNVPIYGAVTTGAA
FT                   WRFMRLQSSQLEVDLTEYFVPPQISNVLGILCQPFLAEEKPKP"
FT                   /protein_id="YP_002478593.1"
FT   gene            25512..26720
FT                   /db_xref="GeneID:7280607"
FT                   /locus_tag="Cyan7425_5293"
FT   CDS_pept        25512..26720
FT                   /locus_tag="Cyan7425_5293"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883434"
FT                   /db_xref="GeneID:7280607"
FT                   /translation="MTLSASTIRAIDRLLTNGEVSRSGLASLYGYQLGLWADCIDTTRA
FT                   VATLEAVRLLRTLPTRNEAIAAILGCEPDIRQAWQRIATARLKEMGNLRDAQGLSEAIT
FT                   TLGQTCLALLPNFSQSSLSPTPYTDLERAVFDASAEQAIATPQLLRALSATAHLIEGEQ
FT                   GKPAVTIPDLDLYNPLTNWCKGRLIKPPERLATLPDTGMQNTSILPGSWALAPPPDSPP
FT                   PHRSISPTMYWVLSCPWLFLLAQVVFTQEAWGAERIAGRLSLELESTHLSQYYRPPEVL
FT                   VVVTTAEDEEVVCGTLSQLLLRVLDLLGVTLLAPDVTEIESKLPTLIESLLKHQIWRFD
FT                   QGSGGRRPGYSIHDSFSDGCYYLAGKYFNRLSTNVTAAIRTTCGQWAKERLAQTGKLAA
FT                   LIS"
FT                   /protein_id="YP_002478594.1"
FT   gene            26743..31020
FT                   /db_xref="GeneID:7280608"
FT                   /locus_tag="Cyan7425_5294"
FT   CDS_pept        26743..31020
FT                   /locus_tag="Cyan7425_5294"
FT                   /gene_family="HOG000081321" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_1141 hypothetical protein"
FT                   /db_xref="GI:219883435"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="GeneID:7280608"
FT                   /translation="MDKNLLTPKHRWAEDGVSGYPLTHPIVGQSNFFNDFKVWIPIVDQ
FT                   SQEKFAHVFAIVAQWGVGKSRLGYELISQINSNSPGWYVRNEVGVLEKGELFQESDRDK
FT                   YLGLYIRYSQLYKDYQNVDNWFGYGFYQVLLPLARGVFDNSIQGQVAEEAYNRLVVQGF
FT                   DKTQLAEILQLSQNHSDEHLYEAPDLLTEICTNAHNYLKEFGIEYVLIVLDELETVAET
FT                   ATFGLETEEIKYLDGRAIKLLGKAIKEEDPRRKLPWLRYVALCSPAIGDELREIRSIDR
FT                   RLPIVDLAQNPFADVSDFVKILEQQQKIEKSYPTGVVEAAYAMSGGNFGWFNVVMTYVD
FT                   RVLNTWKAPNPPSIGELFTEVVKVSSRVRDYVLDYNAINELRLSDRTHIEAARELLYGQ
FT                   LPVPLAKWQPDQLQTLLSGQNEYNEPIALRYRRVEWDDLDCSEALRQAKFRRPQGDRWF
FT                   LTGIDEPLNLQQLLDNLSTYAVHESGGVRTSDGKRIVLIPLKQAEFVQLVGLLYPHPAA
FT                   EDAARGLWKWLVGADLNDTDATHVGPSIAMLGRLNLRYRKQGQNSLIFRDPDQNTAHEK
FT                   VMEQRKNQPTDERAKEILTGIMRLLDRNWAYDVSSAGLADGLVAIATAPGSRAREKGGL
FT                   VNCDDLKLHPDGRLILAWVRNEDELEQLCNPGVSQQFNTHGRTPVLAFTSSRSLVDKFA
FT                   NPASPTLKDARSYLLLYQLSASEEFALHQVGLPTVDCKGFRLDNSGFNSAFSNRLNTLL
FT                   RPLTDAIRQWRRDLDAMGRIAWPLRPGGPLKDTEKALLFDAWRYLMLSKPAPHSLSDLD
FT                   ETSGLDVEEVVDVLKKIDLRPKPEGYTDDDRAMLFSSLDDSADAVFPPFLISILERLLQ
FT                   EGSSWTLNTAKREWFWGYTWKTAKPKEIFEDWMGLACDLQFAIETSAGTSRDSASFSLR
FT                   TTSELRNLINEADNWLKNDYPKIVTEKMALVFGEDKVFDYFAPRGGAAKVGSKTSNAEG
FT                   RLNQARDYLSALETAEANYTSSPNEDQLLESAKQRADLLNAVSYVYLDKDYKQLTNDEN
FT                   VRTLSFEDESVPLWKRVRRAEIFAEKTLRNKKRICSRIDKLPDEMKKDVRDLNLNHFPV
FT                   HLFTWCLEKIRDILNGALPEEGTPQGSTARRQVTEPGTLGQYLRDLQVDNATTRLSQLA
FT                   REVGIDLDSEAEADLEAIDGQIITGFRNLKQSYERLYTQKATLNQRLQKLVAKLQNSPT
FT                   DFPYPTDIPTLANFQKRIELLEDTLEGIKEDGVDNLQHDDALNNPSKLGNFQPLMQATQ
FT                   GLLTEPTRELQQLLGYAATLENAITGYLKSLLGKPDVISIEKGLNSLLQVQGKPLRKEL
FT                   DLPELEIAGSLQAAIEKIEERRGKWVQEGDRLLASSGITFERWRRIVEALNAERDPQLE
FT                   PEEAEKLVNGRLLVRTYRLGGTK"
FT                   /protein_id="YP_002478595.1"
FT   gene            31017..31841
FT                   /db_xref="GeneID:7280609"
FT                   /locus_tag="Cyan7425_5295"
FT   CDS_pept        31017..31841
FT                   /locus_tag="Cyan7425_5295"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:219883436"
FT                   /db_xref="GeneID:7280609"
FT                   /translation="MNSSIWLAGSLSSHRRSRILQSAVDAQSTAQIPEVGTCLLFGTDF
FT                   QEGEETSQQDWYTWTQKPGRALLLIPPFKSGSCSIPSSWQISRRSTPPAHQNLPLATTL
FT                   ASEVQYELQGQLQVATQLGGLWDDQSICTAYYRKHPHAGIFAITCLPLWSLSVLDHAAE
FT                   LQSWLDELYLLAGSPVEDSSLTKAEEIELQPEHYTVLLHLVSGPFANESTALAALHHSS
FT                   IFAVDTDRAKACLQDAQQHGLVIGGQLTELGRDILERSPYSTYINSLEALKR"
FT                   /protein_id="YP_002478596.1"
FT   gene            31838..33001
FT                   /db_xref="GeneID:7280610"
FT                   /locus_tag="Cyan7425_5296"
FT   CDS_pept        31838..33001
FT                   /locus_tag="Cyan7425_5296"
FT                   /gene_family="HOG000081320" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cthe_1139"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_1139 hypothetical protein"
FT                   /db_xref="GI:219883437"
FT                   /db_xref="GeneID:7280610"
FT                   /translation="MSLTFAGQGRSLPQTLAIQSQIHLPGTVGRVLKQIRDIEQVAPLF
FT                   VDAGLVHPVKREIALNARVAGIATRATTTKTIGGYLYAAAAVRMDLSAEDNVISTIGQD
FT                   STCELDDIDYEDQSKRLQLINVRQAYEMADAALRSSDQFDLIMLDCPLVLNRSMVPLRE
FT                   DESDAAFREAFIAATDAIKNFWNNHRDRLLPWNPNGTAVLGLASQRFGAIVYVARQDLR
FT                   TEAGRQQILDTEGVDETQIQAISKLSKSISGIGERRFVHGILSSYTRTAAFRMNVQSPR
FT                   MEPIEITKLGVIGFHFKAAHSMTPRLLQLIGDSPLWTRPMLDKVCSQVMALTVVGGAQA
FT                   APLPIQLAEREQQALDKFLEYYNQGVLQEIKRKEIEDLWLSDFDSPI"
FT                   /protein_id="YP_002478597.1"
FT   gene            33017..34708
FT                   /db_xref="GeneID:7280611"
FT                   /locus_tag="Cyan7425_5297"
FT   CDS_pept        33017..34708
FT                   /locus_tag="Cyan7425_5297"
FT                   /gene_family="HOG000245459" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF87"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   cth:Cthe_1138 hypothetical protein"
FT                   /db_xref="GI:219883438"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="GeneID:7280611"
FT                   /translation="MKHQVLGKLIGNTGDPNNLTMTLASSFAGKRGEFVRIRHKEREDQ
FT                   SVDVLGRIVSVVRSNVLYNSDMGSSVVELELLPGAQVTGERVMARLELIGYKDPSTGQI
FT                   KIPRRALDPGANVETVDYYFLSSFYEFDEQTSLHIGNLVGYESGENTVPVYLDVNRLVT
FT                   EHLAVLAMTGAGKSYTVGRIIERLVVLNNGTVVVFDPHGEYGRALQGGNLQFNLTFSSI
FT                   EDARDRRTIEEIQEGFKHLASAGMGIVVYTPQTRDFREKYAGKNKELALQFDRFEMDDV
FT                   SEILPGLTEPQQRVLDVAIRYWRLMEKAEPRDINRLRYYLGDGLEELREWDELSTAEAT
FT                   ALNSRSAAVASLRLSRLLNEAQSFYSAALPRPTDLYEMVGRPADKRGRLVIVDLQGLSD
FT                   TAKQVITALISSEVLRLASSKTDPIRPCFLVYEEGHNFAPAGQDAVSHRIIKKIASEGR
FT                   KFGVGFAIVSQRPSKLDSDVTSQCNTLIAMRLKNPDDQRFITKTSDMVSKADIEELPSL
FT                   STGEALIYGRSIPAPLLVKVGTKALLHGGQSPEVLEVWGKFNGAST"
FT                   /protein_id="YP_002478598.1"
FT   misc_feature    33029..34627
FT                   /note="HerA helicase [Replication, recombination, and
FT                   repair]; Region: COG0433"
FT                   /db_xref="CDD:30782"
FT                   /locus_tag="Cyan7425_5297"
FT   misc_feature    33425..34255
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_5297"
FT   misc_feature    <34220..34576
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_5297"
SQ   Sequence 34726 BP; 9363 A; 8195 C; 8173 G; 8995 T; 0 other;
     ACTACAAAAT TTGGAACTTG CAAGAGAAAT ATTACCTTTG TGGACAGATT GGGGGATTGA        60
     AGATTCCGGT GTCTTAATTC ATAGTCTCGG CGTTACTTTT CTGACATCGA TAGGTCAACA       120
     TCTTGGATAC GTCTCTGTTT CTGAAGTACC AGTTCCCCAA CAAGGACCCT TTGCCCATGT       180
     CGGCGATGAT GTTAGATCGG ACTCTATTTG GTTTGACCGA TCTAACCGTT CTCCAGTATT       240
     GATCGCTGAA TTTGAGCGCT ACAGCGGCTC CGACGAGCAT AAATTGAAGT TAGAGAGTAA       300
     AGTCAAAAAC CTCTTGCTAG CTCAGCATCG TTGCAGCCCC ACTTCAAAAC CAACAGCAAT       360
     TCTTCTATTG GCTTACTGGA CTAAAGGACT TGCTTCTCTT CCGAAACATG CTGAGCTTCA       420
     GAGCATAGTA CAACACGGAT TTGAAACGCG ATCCAGGCAG AAGGTATTGG GATGTAATAG       480
     CCGATTGCTT TTTCTCCAGT TTGTTATGCA GGAGAGTAAT AGCAATTTAT TGCACTTAAC       540
     TCGAATTATC ACTAGGGGAG TTTCATGAGC CGTCAAAATC CTTTTTTCCT TCTACGAGCT       600
     GATCGACGAT TGGGCAACCG ATACGAACTC CTGGAATGTC TAGGAGACGG TTCCTATGGC       660
     TGGGTATGGC GAGCACAACG GCTCGAAGAT AACGAGATTG TCGCTGTTAA AATTCCGAAA       720
     GAGCAAGGCG CAAAGAATGA GGATCTTGCT GAAGGGGAAA GGTTGCTGGG GGCAGAGCCT       780
     CATCCCAATA TTATTGGTCT CTTTTGGATG GGACGTGTTC CACCTGAAAA GGAGTGGTAC       840
     GCCATTGAGA TGGAATATTT TCCTAGTCAA ACCCTTGCTC AACTGATAGA GCGGGACGAT       900
     CCTCAGTTCT TAGACAGCAA AAATCAAGCA TTTCTAGCTA GCTACGAACG AGTTCTCAGT       960
     ATCTACCAGC AGATATTAGC AGGCATTGAA CATTTACATA AACTAGGTAT GTCACATGGG      1020
     GACATCAAAC CCCAGAACAT TCTTATCTCA GGAGACCTAA TTAAACTGAC TGATTTTGGT      1080
     TGTAGTACCC TTCCAGAAGA AATGTATGCT CGAACCCGCC AAAACGGAGG AACAATTCTG      1140
     TACTCTGCAC CTGAAGTTGT TGGATCTTCT TGGCGGGGAC GTAGCTCTCA AGAACTCTTC      1200
     AAGGCTGACA TTTATAGTCT TGGAGTTCTC CTCTATTACC TTGTTACAGC AAGATTACCG      1260
     CACGACACTC TCAGCCAAGT TGCACGCCAT ACACCCTTTC CGCGCCCACG AGAAATTAAC      1320
     TCTTCTATTG CTCCATCTCT GGAGGATTTC ATCCTACACT GCTTAGCTCT AGCTCCAGAG      1380
     GAACGCTGGA ATTCTGTGGA AGATATGGTC ACTGCGTTTG GGCAGGTTCG TCGCTGTCAG      1440
     TTAGGCTATA ACCCCATTCG TCCGTTGCCA ATCAAAGATC GTCCCTCAGA AGATTGGTCA      1500
     TCCCAAGTTG TTCGCCTTAT TGAGGATAAG GAATATCGGC AGGCAGAACA TGTTGCAGCC      1560
     AGAGAGTTCG AGAGGAGCGG CGACCTTCAT GCGTTCCTTC TAATGCTTAA GTCCGCATAC      1620
     AAAGACAATC GCTACTTTGA CTGCCTTCAA ATTCTTGAGT CACACTCAGA AGCGCTTTTG      1680
     GGCGAATCTT CCCTCCTTAG AGATCTTCGC CGCATTGCTC TAGCTACCTA TATCGAAACA      1740
     CGCCAAATTC GGCAGGCTGA AGAAATAGTC GAGAAGTGTT TAGCAGATGA CAGCACTTCC      1800
     CCTGAAGTTT TAATGATAAA AGCATCACTT CTAGGTCTTC AGGCAAAATA TGAGGAAGCG      1860
     TCAAGGATTC TCTTAGCACT AAACCGGCAG TATCCCGGAA AGCCTAGCAT CTTGAAGCGA      1920
     CTAGTTCTAG TTTTTGAGCA ATTACGCGAT ACTGGCAAAA CTACTGCTTT TCTCCGAGCT      1980
     TACTTAAAAG TATGTCCAGA AAGTACTTGG GCCTTGCAAA AAGTTGAACA TCTATATACC      2040
     ATAGGTGTAA AATAAATGGC ATACAGTTTA TAGCAGTTTC TCCTAAAATA AGGTACACCC      2100
     AAGCAAGATG GAGTAAGGGT TTGAGGGCGT GAACTGTACC TCATCAAAGC AGAAAAGGCT      2160
     ATATATTTCA GTTAACAGTT AGCTTATCTA TGGAGTTTTA TTATGGGTGA TGCAAAAGAA      2220
     TATGAATTAT TTCTGCAAGA AATTCAACAG ATCGATAATC TAATTGATAA CCTTACAAAA      2280
     CTTCATTATG GCACATTAAT AAATGATTCA AGCTACGATG AACTGCAAGA TCTTCAAAAA      2340
     GCACAAAGCT TTTATGGGAT TGATTCGGGA TGCGTGCGTT TTTGTGCCAC ACAGCCCTGA      2400
     AAAGCTTGAA ATCTGGTAGC TCAATCAGGC TGAATAGGGC CAAACCCACG ATTTCTGAAG      2460
     TCCTTACAAA ATGGGCTTTT CGAGCTTTCG TGGCACTGTT TTACGTGTAT CCCGAATCAA      2520
     CCCCAGATTG AGGCTCCCAG GGTTAGATAC GTTCGTGGTC TGCATTCCAC TGGATTCATT      2580
     GCGGATAACC AGCGTGACCG GAGTCCAAGA CTCTTTTACG TGAGGACAGT GGGACAGATG      2640
     CCACTGGGAA AGGAGGCTTT CCACTCATTC ATGAGGATTC ACTTTAACCC TCTAACACTT      2700
     GACGATCTAC ACCGCACCGC TACTTTTACC CCATTTAGAG CGAGTTTCTC AGCTTGAATT      2760
     TAGCTACTTT TTCCCTCTAA CGTATTTCAT CTTCAAGGAT GACTTGAAAA GGCGACCAAC      2820
     ACGAAGTTGT CCTGGATAAT CTGGGCGATC TTCAAACATT CCTACGTTTT TCATTCTCTC      2880
     AATTGCAGTT CTAATATCTC TTTTATCTAT ATTTACTTTG GAAGTGAGTT CTGAGACACA      2940
     TTCATCCAAC TTAAATGGTG TCTTTAAACC TTCAAAAGCA TCTAATAATG CTTTAATCCT      3000
     TGTTTGATTC TCAGAGAAGT CATCTGACAA GCTCACCAAA TAATTTAACT CGGACTGAAG      3060
     TTGACTAAGA TATTCTCTAG CTGCTGCTTC ATGAGCAATA AAGATAAGAT TTTGGCTGAT      3120
     CTTTCCTTCT TCAGTTTGTG ATCCTTGGAA AGAACCGACA TCAGTTGGTT GAGGATCAGC      3180
     AATTACTTGA AGAAATTTAT CAAAAACTCG TGGATAATAT CTTAGTTTAT CACTAGTGCT      3240
     AATTTCAGGT CGGTCACTTG CACTATCAGC AAAGTACGTT TTGAGAAATG TTTTTGTCGC      3300
     GAGATTATTT CTGCGTATTT TTTCAGGAAA AGCTTTCATT AAAAGGACTT CACAATCCTC      3360
     AGTTGGTAGA GAACCTTTAA GAATATCAGA TCTATTTTTT TCTATATCTT CAATTAAACT      3420
     TGGAAACTGT TCCTTATACC ATTGAATCCG GGATATTCGT GACAAAATGA AGTTAAAGAT      3480
     TTTCTGTGTG TCCCAGCTTA AATATAGACT TTTACCATGA AGCTGCTGCT CAATGTTTTG      3540
     GAAGCCTCGT CCTACTAAAT CACTTCTTAT AAAGAGTTTA ATATGTATGT GCTTAGATAG      3600
     CCTAGAATCT GTTTCAACAG TTTGTATAAA CCGGAAAAGG ACTTCAGTAT AAGTAAAAAT      3660
     TAGCTTGGCG TTAAATGCTG TTTCAAGACC ATCGATCAAG AAAGTGCGTT TAGATTTTCC      3720
     CTCTATCTTT TCAAGAATTC GCGAAATTGG GTCATTATTT GTAGGCTGCT CTATCTCCTG      3780
     AGAAAAGAAC CTTCCTAGCT CATTAGTAGA TGTTTCAGGT GCATCAATTG CAGCAGATAG      3840
     TAGATGCCAC CACAATTTTT CAGGAGTATC TTTATATAGT TCCGCTGCTC TTGTTAATTC      3900
     TGGACTAGGA GACTTTAACC CTTTACTATC TCTACTGTTT GAGTCAACTA ACAGTGGTTC      3960
     ACCAATCCCA GCTTTTGAAA GCTCTCGAAG TAAGCGAGTC TTACCTGTTC CCTTACGCCC      4020
     TAAAACATAG GAAATTGAAT TGTTAGGAAC ACTGAGTTCT CGAAGAGCTT CTGTCTGAAT      4080
     TAAGTCACCT TCATCAGATG CACCACTTGG ACTAAGCGAT GAAGTATTTT TGTCAATATT      4140
     TTCAGTTATT TTAGAGCTAA TATTGAGAAT ACTACGAAGT TTATTGAGTG ATTCAATACT      4200
     TAAACCAGAT AACTGATTCT TCTCTGGCAA TCTGCTCTGC CTAAAAGCAC TATCATACGA      4260
     CCAGACAATC CAATGGTCTT CAAGCTCAAC AGAAGAAATT TCTGCCTCTT CTTCAAAACT      4320
     GTTTGAGATT TCAGCGGCTT CAGAGATTGC TTCAGCAAGA ATATCTAACA GCGAATCAAT      4380
     CTGCATATTA TTCCGTTGCC TGTATGAATC TAAGTTTTCA TCATCTGGTT TCCATGAGAC      4440
     AAAAACACCA GGATTGGCAG AGTTAGTTCG GAGGACTGAT TTTATAAATT GTTCAGCAGG      4500
     TCGCCACTGT TCATCAAGAC GAACACAGAC AACTGTCGGA CCAGGAAGTG TGTTCAGCCA      4560
     AGGTAAGGTT ACTGGTGAAA GGCCTGATCT GTGATCAATT AATAGAGCAT CATATTTCTT      4620
     CTCTATTGCA AATTCTACAA TCTGTTTAGC AGCATTCTCA ATAATCATAG GTTCTAGAGC      4680
     ACACCGAAGA GCAAATGCAG ATGCGTCAAT ATCAAATTCT GCTGACTTAG GCCTACAAGC      4740
     CAATAAATCT ACGTATCCAC TTCCTTCAGG TGTCCTAACA CGTTCAGGAG TAATATCAGA      4800
     TATAGATTGA ATAACTCCTA AGAGGGTACC AGATAATGTT CGAGAAGTTC GAGCGTAGAG      4860
     TATATCAAGA GAGGGAGCTT CAATATCACT ATCAACTACA AGAACTTTCC ATCCATCTTC      4920
     TGCTAGAGTA GTTGATAGAA GTCCAAGAAG GGTTGAACGA GCTTGTCCAC CCTTGTAGCC      4980
     ATAAAAGTGA ATAACTTTAA TCTTTGTAGA TGGCTCTTCT GTAGAACTTG TTTCTTCTAA      5040
     TTCCTGATCG ATGAGAGCAC TCAACCAATG GTGTCCTCGA TCTTTATTGT CAGGATATTC      5100
     TTCTAAAAAT TCATCAGCAG TAAGCAAGCG TAACGAAAGT AAAGAATTGC GTAAGATCCG      5160
     TCGTAGTTCT CCTACACTAA TTTTGGCTAA GCGACAGAAA TCGAGTTCAC GCTCATCTGG      5220
     TTCTAGGTCA GTAAAGCTAG GAGATATACA TATTAAGTGA ACGTATGGAA ATCGAAAAAT      5280
     GGTTTTGATC TCACCAATCG TTTTTGCTGC TCTTAGCAGT TGATTTGTAT TTATCATAAT      5340
     CTTATTCCCC TACTGATAAG TCTAGTCTTA ATATCCTTAA TAATTTCTAA GGCTTCTTTT      5400
     AATTGGCTGT CTGTGGATTT TCCTGGGAAA TCAGTTTCAT GCCTGAGATA TCTGATATCA      5460
     GGGTAACGGT TAGCATCAAC ATTAACCTCA GATCCATCTC TATAGGTGCA GTATAAAGCG      5520
     GAGAGTTTAG ATTCTAGTTG TGTCCCTAGA GAGGTTTCGC CCAGATCAGT AGTCAGCCAA      5580
     TCGATGATAC AGTGTCCCTT TCTCCATGGA CCAGATTGAT GTAAGTAATC CTTTATTGCA      5640
     AGTTCTAGCA CTACCAAGGA ACAGTAGAGA CATAAAAGAG GATTCCTAGG ATCTGTCCCC      5700
     CCAACCTTGA AGGATTGTTG ATTATAGGTG TGAAGCATAG TAAAAACAAG GATTTGGACC      5760
     TGCCAATCAG ACAAGGTGTC TGGTATTAAT TATAACCACT AAATAGTTTG GGCTATGATA      5820
     GTGCAGGTAT TTTGAACATG TCAATCTCCC CCTCTTGTCA ACAATCTTCA AAATATTATC      5880
     CCTGCAAAAA TATAAAGCAG TCCAATGCCT CTCCATTATT GAACTTTTAT TAGGGGGCCG      5940
     GCAACGATTC GTGTAAAAAA GGGCCATTTG CCCAAAAGAG TATAAATACT TATCAGAATA      6000
     ATTAATTTAT CGGGTGTTCT ATAACTTGTA CTCATAGCCC TTTATCGGCT GATGCGTTGC      6060
     TCATCCCGCA GAAGGGCAAC GCCAGAATCT GGGTTCCAGA GCTTCTTGCC TTAAAGATTA      6120
     CGAATGTAAT ACAAGTTTTT CGTTCACCCC TAGTCCAAAG TTAGGCCAGT GGGTGTGTAG      6180
     TAAGTTTTTT GTGGGCTAAG CAGAACTTAT CAGTGTAAAC CTCATTATTT ATTATTGAGA      6240
     GCTAGAAGGC ATGACTGTTG AACGACCTCT GAAGCCTGAT GTAACCTCCA TGGTCTGCCG      6300
     ATCGCTAAGC AAGGCCGAAG CCAACCTCAA TAAGACTGCG CCCTACGACT ATAGACAAAG      6360
     CGGGCAAAGT CAAAGACTTC CAGACGAGTT TCTTCCGGCA AAACTTGAAC TAAGGCTTCA      6420
     ATTTTTTCCG TCAAAGGTAC CCAAGTCTTT GAAGCAGCTC GCCAAACCAC AAAAAATTGC      6480
     TCCAGGGGCA GCGTTACCAG CGCAGTTGTT TCGCCATCCA AATTGGTAAA TTCAACCTCA      6540
     TACCGCTGGT CAGGATATTG CTCAACGATC GCTCCCTGAG CACCAGCCTG CAGATTATGC      6600
     TCTGGCAAGT TGATTAACAA TTCAACTACA TCAAACAGGG CAGGACTCGT CATGGCTGCT      6660
     TCCTCACATA TAGCGTTACC AATCTGGCAA AATTAGCTTT CGGCTCCACA ATCCAACCCG      6720
     TCCGAACAAT TGCCTTTTGT CCTTCTACTC CATCCACCTC CAAATCTACC TGATACCGTT      6780
     GCCCATGCTG ATCCAGCTGA GTGGGTACAG CTTCAGCACC TAAAGCTTGG GCGTGAATCT      6840
     GTTGTAAAAG CGGTTCATAG TTGTCTTTGG TATAGCCCAA CCGTCGTTGG AAGATTATAG      6900
     CCTTATTAGA TCCAACAGGA TTTTCGGGGT CTAGGGCATA GTTAATTAAT TTACGTGGAT      6960
     CAATAACAAC TTGAGCAACA ACATCGCTCA GCTTCATTTG AGCATCTCCT TAAGTTGCTC      7020
     CATCCTTTAC TGCCTTCGGA TCGCCAGTGA TGAATTCTTC TGTCATTTAT GAGCGTAAAC      7080
     CCAAAGAAAC AGCCGCCCCG GATGGAGACT CGGATGCTGA GCCCTCGGAA AAAACGGTAG      7140
     AGAATTCGTC CCCACCCCCA ATGGAAAACT CGCAGTCCAA GAAGGAGTCA AAACCTGATG      7200
     GTAAGAGCGG CAGTGGAAAT ACCAATGCTA CTACAGCATG GACAGCTGCA CAAGGACCGC      7260
     TACGAAACGT CCAAATTCGC TAAACCACCT TTGTATAACC AAGCCGACAG CAAATAATTA      7320
     CTATGAAGAG AAATATCAAA TTTGTGCATG TGTTGTCAAG GGAGGAATAG TATCTGAGCG      7380
     GAGCCAATCC AGAGCCAGAT AGGGATGAAC AATATGAAAG CGATGCCCAG GGGCGTTATG      7440
     AATCGCGTGT TGTTCTGGTA CAACTACATT CGTATCTTTA GATAAAAAAT CCTTGAAATT      7500
     TGCAGTGATC AGTAGGTTGG CTTGCCCGGC GATCGCCACC TCCACAACAT GGGCATCTTC      7560
     TTGATCGCGT AGTGCCAGCA CTCCCGTTCC GCCCAGAATC AGTTGCGGAG ATATTCCAGC      7620
     TGGGCCCAAG TGAGCATAGC CTGCAATGGT CTCAATCAAT AAATCCGCTG ATTCTGGGAT      7680
     AACTCCCAAA TCCCTTTCCA GAACAAGGCG GAGCCGGTTG AGCATTCCCC AGGAAATAAC      7740
     CAGTTGTACT GGCCCCAGTG GACAGGTTCC AAACCGGACT ATTTGCACCA GTGTTTGGGC      7800
     TGCGGTTCCT TGCCTGCCCT TACGCTCTGC CAGGAGAGCG GCGCACCAGA TGTTTAAATC      7860
     CAGGCAAAAC CGGAGGGGAG CATTCATCTT TCCGCATCAC TGGGTGAGAC GAATGGCAGC      7920
     CGCAAGAAAA TCATCTTCGG TTTCTAAGGG TTCTAGATGG TCAATCTGCA TCTGTTCCAC      7980
     GACTTGCCGC TGAGCAATTT CGTACTGTCG GTGTAATAAG GTGCGAGTGA TATCCCGAAG      8040
     AACAACTTCT AAATCTCCAG GTTCTCCAAG CAGCTCAATT TGATGTAGAG CAGTTCGAGC      8100
     TTCGACAGGT AGCCGTGTGA AGAACTTCAG AGCCAGCCCG GCGATCTGAG CTGTGGAACG      8160
     CCCCTCCAGC TTAGCTAAAG CGGTCACTCT CTCCGCTGTA GCTGCATCCG TATAAGCTGA      8220
     AATCGTTTTT CCACTCATCA TACTGCCCCC TGTCTGCCTA TAGAAATTAT AGTTTCTATA      8280
     GAAACCTTTG AAGTTATAGA TTCTATTTTT TTGTGCTTCA GTACTAAGAT TGCTTCGCGG      8340
     ATAAGCCATA GAAAAGCTGG AAGCAGTGCT TCTTGACGAG GAAAATTAGC AATGTTTAAC      8400
     TGAAAGCAGT AATGCAGTAA TTCAGTATGT CAGTCATTGC CATTGTCAAT CAAAAGGGAG      8460
     GCGCTGGAAA GTCCACCACA GCCGTTCACC TTGCCTGTTG GCTGAAAAAG AAGCGCAAAG      8520
     AGTTACTTCT GATCGACGCT GATGCTCAAC AAAGCAGTTC GCACTGGCTT AAAGGCATGG      8580
     AGAACTCAGT TCCCTATTTG GTGATGCAGT CTCCTGATGA CTTACTGGAG CAACTACCAG      8640
     AACTGGCAAA AAAACATGGC TATGTGATTG TGGACGGTCC AGCCAGTCTC TCTGAAACCA      8700
     CCCGTTCAAT TCTTTTTCGT GCTGACTTAG CGATCGTTCC CTGCCAACCA ACGGGTGTAG      8760
     ATTTGCGTTC TGCCTCCGAC GCGGTTCGAT TAATTAAGCA AGCCCAATCA GTCAGAGGAG      8820
     GAATGCCCAA AGCGGCAGTA TTTCTCAGCC GGGCTGTGAA AGGCACAAAG CTTAAGGATG      8880
     AAGCAATTGC CCTTTTAGGA CAAACCCCGG GAGTTGCTCT ACTCAAGACT GTTATCCACC      8940
     AAAAACAGGC AATCGCAGAT ACGTCAGGTC AATCAGCAAC CGTGTGGCAA TTAGGAACCC      9000
     GTCCCGCTGC TGAGTCCGGC AGGGAATATG ACCAGCTATT TAAGGAAATT TTGGAGATGT      9060
     TGTCATGAGC AAAAGCCGTA AACCTCTAGA TGACGCATTG GCAAAAGAGT TTGTCTATGG      9120
     AGAACATACT TCTTCCCGTC CAACTCAGCC TGAGCCCACT TCTCTCCCAA TATCTCAGCC      9180
     AGAATCCAAT TTAATGGCAA AACTTCTTGA TGGCGAACCT AAAGAAGCCA CAATCCGCTT      9240
     GACCGTTGAT CTACCAGAGT CGATGCATCG GAAGCTATCC CTGCTCTCCG CCAGAACTGG      9300
     GAAGAAGAAA GCTGCGATCG TACGACTACT ATTAACGGAA GCTCTAGAGG AAGTGCAAGA      9360
     GTAAATTACT GCATTACTGC ATTTTTGAAA GCAGTAATGC AGTAATGCAG TAGTTATAGA      9420
     GGGAAGTAAA TGAGACTGCC AAACTCGGAT TTAGCCACCT ATTATATTCT TTAAGAAAGG      9480
     TTTGATGAGC TCATGCAGCT TTTAGATGTC GTTGTTGTAG TCAGAGATTT ACCCGACTTG      9540
     AATTTACATC AAGGGCAGGT TGGAACGATC GTCGAGGTCT ACGCTCCGAA TATTTTTGAA      9600
     GTTGAATTTG TAGATCTTCA GGGTAAAACC TACGCCATTG CAACTTTAGA CGCCAACCAG      9660
     GTGATGCAAC TTCACTATCA AGCCCTGCCC CAAATCGCTT GAAGGCTGAT CTGCGTGTCT      9720
     TTGGCAAGGG TTTTCAACCT ATGCTGCCCA AGACACGGAT CGTTCAAATT CAAACAGGGG      9780
     GCTAAATCTC CTCCAAGTTC ATAACATGCT TGAAAAGATT AACCCCGGCT AGAGACTTTC      9840
     CCCAAATAAG CCTCGACCAC CACTTGAATG CCCCGCGGCC AGAGGCGCTT CCCCCCGGCG      9900
     CGATTGCCGA TCGCAATTAA GAACGGAGAC AGGGGCATAA GCTCCTCCCC CAAAGCAGTC      9960
     CGTTTATCAA AATAGCGCCG GATAATTTGA GTCATTTGCG GCTTGAGCAG AACTTCACGC     10020
     TGCCCCTCCC GGCTGTTAAC TTCCAAGCGA TAACAGTTAT CATGCTCCAC TAAATCGCCC     10080
     ACATTCGCTC GATGCAATTG AGCCCAGGTG AACTCCTCCA GAGCCCAGAG TGCCAGCACC     10140
     ACCTGATCCC GTAATTGCTT CAACTGAAGG TTTTCGGTTA CAGAGGGATC AAGATGGGAC     10200
     AGTTCGTAGT CATCCTCGTC CGACCAGGAC TGAGGGATAA CCTTAGGAAG ATGATTAGAT     10260
     TCCGGGGCAG ACAAAGGAAG CTGGAGCTGC CACCACCCGT CGGCTTTCTG AGTCCGCTCC     10320
     CGGGAAGTTT GGCGATTATA GGTACGATTA GCCTCTTGCG GCGTATGTCC CATCAGCTCC     10380
     GCAAACGCTT CCTGTTGTTC TGGTCGCCCA TAGCGACGCT GATACGTCAC GCCAATATCT     10440
     CGGAACGAGT GGGGCGTTAC TTCAAAGGAC TCGCCAAATA AAATGCCAGT CGCTGAGGTA     10500
     ATACTATCGC CCACTAAATC TGTCACCCCA GTTTCATTCA AGGGCCGACC TTGAGTCTCA     10560
     GGGCAACGAT TAGCACCAGT TTGAATAAAA ACAAGGCGAT GGGACGTCGG AATGGTAGAG     10620
     CGCCACTTTT CCCACCAGGT ATCCAGATCA GCCGTTAAGT GTTGGGGCAA AGGATATTCC     10680
     CTTCCCTTGC CTGTCCGTCG GCCCGCCTTG TGCTGCGAAG GCTTGAGCTT CACCCAATAG     10740
     CGATCGGCTT CCCGAAATAG CGTTTTTCCT TGCTCCATTT CGCGAATTTC CTTCTGCCGC     10800
     ACGGGGCAAT ACGTCAGGAG CGCGATGATT AAATACCGCT GCCAGGCTTG CAGCTGAGCT     10860
     CGAAAACTTC GTTCGTCCCC ATATTTATCC AGAGGTGCGC AACACTTTTT AAGATATTCG     10920
     ACGATCACTT GAGCTTCCTG AAAAGTGAGA AGCCTTCCCT CCGGCTCGTC CTTCCCCTCT     10980
     TGATTTCTAT CCTGCTCTTG GAGATAGCGG GCATACTCTC GGACCAGCTC AACTTGCTCG     11040
     ACATCACTGA AATCTTTACG CCGGGCCTGG GGATTGAGGA ATTTGGCGAC CGAGAGAGCT     11100
     GTTTGTCCAA CGTTTTTTGC CCACCCATAA CGATTTTTGC GAACATTAAT ACCCCAGCTA     11160
     ATGAAAGGTT GAAGCAAGTC CAGATTCGTA ATATCCGCCA GTTCAAGCTC AGATAAAGAG     11220
     GTGAGCCAGG GGCTGTATCG ATGCAACCAG CCTAAAAAAG CATGGATGCC CTCAAAGTAA     11280
     ACTTTCAAAG TCTTTTCGGC AATCGCTTTC CCTTTCCGTT CTGGTACTTC TAAATCCAGA     11340
     CAAAACGAAC GATATCGGTC TAATTGAACT CGCAAACGCT CTGAAACCTC ACTAGGCTGT     11400
     AGGCGGTAAA AGCCAATATC TTCTCGCTGC GACTTTAGTT GCTGAATATA GCGCTTCAAG     11460
     GGCCAGATCA CTGGAACATC AGCAAAGTGA TACTGCTTTG ACTGAGGATT GGCCCATTTG     11520
     ACCACCAGTA AAGCCACCTC CGCTACTTCG GAGGCCCAAC CGTATCCCTG CTTCTGTAAC     11580
     AGTCCCCACT CAATGAACGC CTGGAGATCT TCCATCACTC CCATAGACTG GAGGTTCAAT     11640
     TCAGCCGCCG GTAGGGCTTT CTCGATCGAT AACCAATCAA CAAACACCAA AAGTACGTTC     11700
     TGACAAATAG CAAACTTCGC CGCCTCGATC GGATCTCCTT TCCGTGCCGG CACATCCGGT     11760
     TTCGTCCAGA AGGCTTCCAG TCCAAGAAAT TGCTGCTGGA CGGTCTCTGG TAAAGACTCC     11820
     AAGGTTAAGA CTTGCGGCTG TAAGGGGAAA GCAGCGAGAT AGCCAAACGT TTGTTTGGCT     11880
     GCCCGTTTTT GCTCGGTGAG CACGGCTTTG GATCGACCCA CACTCATCAC CGGGGCCCGA     11940
     TCGCTTTGAG GGCCTACGGG CAAAACAGGG ACAAACCAGG GCTGTTCTTC CACCCAACCC     12000
     CGAAAGCGGT TCAGCGCCGA GCGATAGTTG CGCACCGTGC CGGCACTCGG CAGAGTGCCC     12060
     TGAGACTGCA ACAACTGCAG TTGGGCCTCA AATTTAGCTT CAAAATCCTT GAGGTCCCGC     12120
     AGGGATACTT TGGCCAGGCA TTGGTCCAGC TGGTGGCGAA GTTCCTCCGG GGTAAAATCA     12180
     TAACTTGGAA GAATATAGCG CCGCAGCACG GACTTTAAGT TATCCCCAAG GCGAGGATTA     12240
     TTTCGGATTT CTGGAGATTC ATCGAAACGC TGTACAGCTT CTGAAATAGT ATTCAAGACC     12300
     ATAATTAGAT TTCCTGATGT ATCTATACTA GACTGATAAG CCTTAACGTT TGTAAGGAGT     12360
     ATCAATGGCA GGGAATACTG AATCTGAAAT CCTGATGGTG TAAGCTTTTA AGCAGTTTTT     12420
     GTCTTTCCTA CAGTAGGAAA GCGTTTCCTA CTGTAGGAAA AGGGCAGCAG ACCGGCTACA     12480
     CCGACGAGAT TTTCGATCCC TGAGGCCATT GGCAGTCCGA GTGTATGACC CGCGATCGGT     12540
     TTAAATCATT TTTTCAGCCT TGCTCTGCCC AAGTAATAAT CACTGAGGTT GGAATGCGGT     12600
     ATCGTTGGGT CTGAACGATC CAGCATCTTT TTATTTTTTA GATCCTTTCT TGGCTTTCCG     12660
     ACCTGGCCTG CGGGGTTTGG ACTCGGGCAA AGCATCTTTT TCCATGGGAG AGCCTTGCAG     12720
     GCTGGACAAC CCCGTCAGAA CTACGGGGGG CCGATCCGGA AACTGAGCAA TCAACTTCAG     12780
     CTCCCCGCCA GTGGCACTGA TATAGCTCCC TAACGTGGAC AGCAGCATGT CTGCTTGCTT     12840
     CTCAAGCCGG GAAATAGTCT CCTGCCGCAC CTTAAGCCGC TCTGCCATGA CTTGCTGAGT     12900
     GAGGTGATGG GCTGTGCGGA GCTGCTGCAG TGTCATCTCT TCAGAAATTA ATTCAGCCGT     12960
     TCGGGCCGCG ATCTTCTCCT GGCGATCTGG AGGCAATTCA TCCAGGATGT CTTTAAGCAT     13020
     TACCATTTTT AGCCTCCTCT ATCCGCTTCA AATGTTGATC AAATCGGGTA TCTGCTTTTT     13080
     GAATCAGATT TTTGTAAAAG CGTCGTTCAC TCGTGCCAGA TTTATCTCCG GCAACCAGAA     13140
     GAATGGCATG GCGTTGGGGA TCAAAGGCAA AGGCAACCCG CCAGACCCCA TCTGCGGCAT     13200
     CAAACCGTAA TTCCTTCATG TTGGAATGCT TGGACCCGTT AAGGGTATCG GCTCTGGGGC     13260
     GACCGAGCGT TGGCCCGATC GCTTCGAGTA ACCCCGCCTG AGCAAGCAAT TCGTCCTGCA     13320
     CAGCCTGGTC TAATTGCCTA AACTCTGGCA AAAATTCTTC GTGAAACTCA ACGGTCCAGG     13380
     GCATTCAGCT GTTATGCATT CAATTATATA TAGCTTTAAA TTTATACATG GTCTTCTATT     13440
     ATAGAGAATA GCTGCTTCCT TGACCAGGGC GAAGTGAACC TGATTTGAAG AAGCAGCTGT     13500
     AGCTTGAACA AGGCCGATGG GGTACCGGAC TAACTCTCAA CGGCGGATAC GCCTGGGACT     13560
     GCCTTCTTTA TGGCTGATAA TCCCAGGTCT GAGCCAGCTG TCCGAGTTGT TGAAGATAGT     13620
     AATTCAGGGC AGCGGGGTTG ATCAGCCGCA AGCCAATCAT GATCTCTTCG ATCGTGTCCA     13680
     CCCGGGGCTG ACGGGTGCCG TTTTTAAGCG CAAAGATCTG GGCGTCCGTC GCGCGGCGGT     13740
     TGAGCCTCAA GCGAATGGTC GAAACGAGAT CCGCGCCACA GATGCCAAAT TCCGCCAACG     13800
     TCCGCTGGAG GGCAATGCCG TGCATACTGG GGGTGCGACC AGGGGGACGT TTCGATCTAG     13860
     CGGGCGTTTC TTGGCGTGAT TGTTCTGTCC GATCCGGCAG ATCTGGGGGA GGCTGCTCAA     13920
     AGGAGAAAGG ATCCATATTT CCTCTTTATG TAATTAATAT GATGGGGTGA TCAGCAAGGT     13980
     CTGAGACCAT GCCAGCCTCA AAATAGTATA TATGTACTAT TAAGATCCAA TTTGTTAAAA     14040
     ATGCATGACT GCAATTGGCG ATCGCGGACA AAATCTGTTT ATATTTACTA GCAATTGACA     14100
     AAATGGGCGA TCACAGACTT CACTAGATCA AACCCCGCAG TTGATCGCGG TTAAGGCAAC     14160
     TGCCCAAAGG ACAAGTTTTA GCAAGATTGA GGAGAATTGA TGGTCTAGAA AAACCCTAAT     14220
     GCACAAAACC CCCCCTGCTA CGAACAGAGG AGGTCTCGTG CCCCAAGAAC GAATTCTACG     14280
     GGACTCGGAC AAATGCTTTT TTTGCTCGGC ATTGTTTTGG TCTCCCGGGG GAGCCTTGCG     14340
     CCCATTTTAG GCATCTTTTG CCTACCAGGT CAACTCCTTG ACCTTTTTGA CCGTAAGGCT     14400
     CCCTATCTTA CTCGCTTCAT TGATAGGGAG AAATAAATGG AAATGACAAC CTTACCCAAA     14460
     ATTTATTCTC CTGATGCATC CAACAACGAT AGGGAGAATA TTCATGCGTT CACTGACTTT     14520
     AACTCCAACC ACTGACTCTG ATGCCCATTT AACGTCCAGC CTAGAAATTT TCGCTGCCCG     14580
     CACTCGTCTG GAGTGGACGG TTGAGAGCGG CATCCAGGGA GAACTGTTTC AGAATACGGT     14640
     CAAGGTTGTG GCTGACACAG AGGTCGATCC CTACTCCCAT GAGGTTAGCT ATCCCATCCA     14700
     CGAAGCCCTG AACTGGAAAC CTACTCGCTT CGGCTATCAA GCCCGCACCA CGCTTTATGC     14760
     TGCCCTGATT CTCAATGATG ACGGGGAGGT CTGGCAGGTG AAGCTCAGCC ATCCCAAAGT     14820
     GGATCAGCAG AAGCGGAAAG CTCGCAAATA TGAACGACCG GTTGGCAGTA AAAGTCGAGC     14880
     CTGGGTTCCG AGAAATTTGC CCCTGGTTCT CTGGGTAGCA ATCGCGGCTC GTTCTGGCTT     14940
     AACCCTGTCA GAGGCGGATC TAGCGCTCGG TTTTCGCACC TGGCTGATTA ACCATCCTGA     15000
     GGTGCCCGTG ACCATCTGCG AAGGGGCAAA GAAAGCGGCC TGTTTGCTCA GCCTGGGTTG     15060
     GGCTGCAGTC GCCCTGCCAG GGATTTTCAA TGGCTACCGC AAGAACAACC AGGGGTTGAT     15120
     TCCGGATTTA GCAGACCTGG CAACCGCTGG GCGGGAGATT GACATTTGCT TTGACCGTGA     15180
     CCTCAAACCC AAGACGATCG CGAGTGTCAA CCTGGCAATT AAGCGATTGG GATGGCTGTT     15240
     TGTCCAGCAG GGGTGCGTTG TCCGGGTGAT TCAACTGCCC GGTCCTGAAA AAGGGGTGGA     15300
     TGATTTTGTC GTCGCCCATG GCGAAGAGGC ATTTGCTCGG CTTTACAGCA CTGCTGCCAC     15360
     CCTGGAGGAC TGGAGTCACC AGAAGCTTTG GGAGCTGGCT CTGACGCCAA CCCTGGAGCT     15420
     GGATCAGCCC TTCCTGGGAA CTCTCCCCTA TCCAGAGTTC GGATTTGCCT TCGTCAAGTC     15480
     CCCCAAAGGC AGCGGCAAAA CCCGGGCTCT CTATCCGCTG ATTCGAGAAG CGACCCGCAG     15540
     TGGCCGTCGA GTCGTAGTAA TTACCCACCG GATTCAGCTG GGGCGTTCGA TCTGCAATGA     15600
     CCTGGGCCTC GACTGGATCG AGGAAATGCA TCAGTCCCAG ACCCAAGGAC TACTGGGGTT     15660
     TGGTCTCTGT ATTGATAGTC TCCACCCCTC CTCCCAGGCT CGGTTTGATC CGCAAGACTG     15720
     GCGCGGGGCG ATCGTCATCC TGGATGAGCT GGAGCAAATC ATCTGGCACG CCCTCAATTC     15780
     CCAGACCTGT TACGAAAAGC GGGTGCTGAT CCTGGAGACC CTGAAGGATC TGATCCAGAC     15840
     GGTCTACAGC TCGGGAGGAT TGATCATTGG GCAAGATGCT GACCTGTCCG ATGTCAGCGT     15900
     GAACTACCTA ATGGGATTGG TCGAAGGACC AATTGTCAAT CCCTGGGTCG TGGTCAACAG     15960
     CTGGAAACCC CAAAACCCCT GGGAGGTGTC TTTCTATGCC ACCCCCGACC CTGCCCCCCT     16020
     GATGGCCCAA CTTGAAGTTT CAATTGAGAC CGGTGCTGTT TTTGTCTGTG TCGATTCTCA     16080
     GAAAGCCAGC AGCCGGTGGG GATCGATTAA CGTGGAAGCT TATCTGAAAG AAAAACATCC     16140
     CCAGAAGCGG ATTCTGCGGA TTGACAGTGA GACGGTGGCG GATCCCCAAC ATCCGGCCTG     16200
     TGGGATTGTC GAGCGGCTCA ATCAGGCGGT GCGGGACTAC GACATCGTGA TTGCCTCTCC     16260
     CACTATTGGC ACCGGAGTAG ACTTGACCGT GCAGGGGCAT TTTGTCGCTG TCTTTGGCAT     16320
     TTTTCAGGGC ACCACCCCAG ATACTGAAGC TCGGCAGGCT CTGGCCCGGG TGCGAGAAGG     16380
     TGTTCCCCGC TATATCTGGG CCCGTCCTTT TGGCTCCGGC AAGATCGGCA ACGGCAGTTG     16440
     TGATTATCGG GAAGTTGCTC GATCGACGAC TCGCAGCATT GAATTTAATC TGCACTTGCT     16500
     ACGTGAGTTC GACTTTGACC TGGATAGGTC CTATGACCCC ATTACCCTCC GCACCTGGGC     16560
     CAAGATGGCC GCACGGGTCA ATAGCTCCCT CTGGGACTTT CGCGAAGAAC TGAGACGGGG     16620
     TTTGGCGGCA GAGGGTCATC AAGTCACGGT GCTTCAGCCG GGAGATTGCC TCCCCAGTGG     16680
     GCCGGTGAAA CCTGCCCTGG CACAGATCCA GGAACAACAC GAGCAGGCAG AAGCCGAGCA     16740
     GATCGCCACC GCTGAGGTGA CAGAAGCGGA TTACCACCGC TTGAAAACTA AAAAGGCAAA     16800
     GTCGTCTTCA GAGCGATCCA TGGAGCGCAA ATATGAACTC CAGCAAAGCT ATGGGGTAGA     16860
     GGTCACCCCC GACTTGGTGC GCAAAGACAA TGACGGCTGG TATGCGCGAC TGCGACTGCA     16920
     TTACTACCTG CTGAACGACA TTGAAGCTGT GCAACAGCGC GATCTCCGAG AACTGCAGGG     16980
     CCATCTGGAG CGGGGAAATC AGAAGCTGGC GTTGCAGGAT GTCCGTTTAC TCGGAGCGCA     17040
     GGTTGAGGCG TTGCGCAGCT TAGGATTGCC TGAACTGATG AGAGCTGGAC GAGAAATCCG     17100
     AGGCAGTGAC CCCCTGGTTC AGCAGCTAGC GGTTCTAGCA ATAGAGTACG CCCGTGACTT     17160
     GAAGACCGTG CTCAATCTGA CGTTCACCGA CACCATGACC CCGATCCAGA TCGTGCAAGC     17220
     GTTGCTGAGC AAGTTGGGAT TAAAGCTGAA GTATCTCAAG CAAGAGCGGC TACCAGATGA     17280
     CACACGGGAG CGAGTCTATC AGTATGAGAT TCCCACAGAT GGACGAACAG CCATCTTTAC     17340
     AGCCTGGAAA AACCGAGAGA GGGCATGGCA ACCATCTTTA GGAACACCCC CCATACCTTG     17400
     GTTTATGAAA GCTGAGTAGG TCTTTGTCTC TTAGTAAGGA ACACCCAGCG ATAAACTTAG     17460
     TTTAAATCAA TCTACTGAAA CATTAGATTA TCCAAGCTTT TAAGGTTAGC GTATTTTTTT     17520
     CGCGATTCAG AAACCTCCCC GAGCTCCTGA TAATGGCTGT TCTAATCCTC CATCGCGCCG     17580
     AAAGGCAATC GCAATCCTAC AATGTCATAG TTATAACGCC ATGTGAGTTG AATGAGACCT     17640
     GCACAATTTC CGAGAAAACA AATAACTTCA TGATAAAATA ATATTTTAGT ATCAAGATGA     17700
     CTTGACGAGC GTAGAGAAGC AAGAATACCT CAATAAAATT GGTCAATAGC ATTACTCCGA     17760
     ATAAAAATTA TATAATGACG CTGATTAACG GGCTTTAAAT CAAAAGAGCT CCACTATACT     17820
     TTGTATTGTA AAATTTCTTT TTTCTTCTCT TATAAAGACT ATTTTTATCA AATATTTAGT     17880
     TTTTTCATTA CTCTCATATT TTGCTTGTCT TTACCAGTTT TTGTTAATAC TTGAATGGAA     17940
     ATAGCAAAAT CATAGAATAA GAAAGCTTTA CTTCTGAAGA ATGAACACTG GTAAAAGCTC     18000
     TTTAACTTTC TTTTTCAGTA GTCTAATTGT TGTATGCTGG TTCAGGAAAA GATTACTATC     18060
     TTTTCCTGAA AGCTCTACTG TGAATTTCCC ATTCAAAATC CCAGGTTTTT GTTCAAGTAC     18120
     TCCCCCTAGC CTGTTTTAAA ATTCTTAAAT CTAATTTATA AATTAGTTCT ATATTCCTCT     18180
     ATTAATTTTT GTCCAAAGTA AGAAATGAAT TCATCTAAAA CATCTCCTGA TGAAACAAAA     18240
     AACTGCGTGC AATAAGGAAA TAAAGTGTCA TGGGTTGCCT TTAAACAGCA ACCACTGGAC     18300
     TCTAACTGTT TGATATAGCT TGAGTGATCC CAGTAAGCGA ATTCTTCTCC TTCCACCACA     18360
     GACAAACTTG TTTTTTCACG GTCTGTTAGA ACATCAGGGT CAAGATTATC AGGGTCGAGA     18420
     GAAAAACTAC CACAAACTTC TCCCCGGTAA ATCCCCTTGT ATATTTTATT AAGGTTTAAA     18480
     AAATCATATT CTTTGCTTGT AATTATCCAA TAATCATCGC CGATACAGAC AAGGTGATGT     18540
     TTAGAACCGT CATCGTTGTC GCACAGATAT TCGGGTTCTA TCGGTGACTC TATGTCATAT     18600
     CCTAGTCTGA GCAAGTAAGG GCGAACAAAA GTTCCAGGTA AGGAGATAAG TAGCCCGTCC     18660
     TTTCGCTGGG ACAAAACCAA TGAATAACGC CTTACTCCTG GGGTAGTGCG TTTAGGTCTA     18720
     TAACCCACAT ACTGAGCAGT TTTGTTTTCT TCAAATTTAT CAGAAAAGCT CAACTCCTTT     18780
     AGCTTCGCTC TAGCACGAGA CAAGAGATCC ATACCACCCT GAATTATATC GATATCGGAA     18840
     GAGGTGATCT GAGGAGTACC ATCTTCAACT TTCACCCGCA GTACAATGTT AAAAATCAGC     18900
     TCGCCCATAA GATGTCAAGA GAGTAAATAA AAATCCTAAG ATTCAAGACA TCTATAGCCT     18960
     GCCATTTATC TTTTAAGTTG TCAATCATCT TAAAAATTTC TCTTATTTCC TAAGATCTTC     19020
     TTTACGATGG GCTTTAGAAA ATGCACTTTG TGAGCAAATA TCATTCCATA GCAAAGGTAG     19080
     CGCGATTAGC TTATGGCTTT CGCTTAGATC TATCATTTCT GCGGATTAAA TTGTTAAGCT     19140
     AAGTTTGTGA GTTGACATGG ATAACTGAAA AATGACCTTG ACACTCTCTG GTAGGGATGG     19200
     CATACTGAAA ACTGCCTGGG TAAGAGTAAA TTATTGATTC GGCTATTAGC CCTTTAAGTC     19260
     CTAAAAGAGG GTGAATGACG AGCAATCGTC TACGTAACGT TGCTAATGAA TTAATTGATT     19320
     TGGCAGCGAT CCAGGAGCAA ATTCGGAAGA CTTGGAGGTA AGGATATTGG GGCAACTCTG     19380
     CTCAATTCGC ATTCCATCAG AGAGGTTATC TTCAGAAAAC TGGTGCGCAG CTCTGTTTTG     19440
     CCAGTTCACG ATCGCCAATC TATCTGACGA GGCAGTGCGA ATTGAGCTGC GGGAGCTTGC     19500
     CCAATCTATC CTTGAAGGTT GGCGGGTCAG CACTGTCCAG GGACGAGCAG GGTATGACCC     19560
     GCGAATCCAA GATGCCCCGA TCTATCGGCA GGCAAATCTA GAACCCATGC GGTTTCGTCT     19620
     CGATGCGGAG CATTGGAAAT CGCCTGAGGT GGAGGGGGCG TGGTGTGTGC AACCCGGAGA     19680
     TGTGGTGATC AATAAGATTC CACCGTTGCG GGCTGCATTA GCGACATCGC AGTTACCACG     19740
     CCACCCGATG GATGGGAACT GTATTTTACT TCGATCACTA AAGGATCCTT ACGGTGCATG     19800
     GATTGCATTT TGTTTAAATC AGGAACTCTA TGCTGATTAC CTGATCCGTA GTTCTGGGTC     19860
     GGCTGCACTA CCCCGTGTTG GGTTGAAAAC GCTAAGCCAA ATGCCCTTTG CTTTGCCATC     19920
     GTATGCAGAC ATTGCTGGAA TCAATCACCA ATTTTGGCAA TGGAACGATG CAGCCCTGAC     19980
     CAATACAGAA AGCCTGTATC ACTTGAGTGC TGAGGTTGAA GCATATGTGG CTTCGGAGGT     20040
     TGAACTGTTA CAGGATGATG GCGATCGCCT AGATAGCAGC CCGTATCATT CAGAAAAGGT     20100
     ACAAGCAGCG GGATCACGAC CATCGCTTTT GCCAGGGCGG TTCTTCTCGG CTGAAGTGAT     20160
     CAACGATTCT TGGGTACCGA GTCATGTACA GGTCGCAGAT TGGCAGCGGC AGCTACGCCG     20220
     TAGGTTAGGG TGGTTGCCCT TAGAACGGCT ACTGTCATCG GATGAAATTT CTAGGGATCG     20280
     ACTGGTGAAT GTGCCAGAAC GGGGGTGCTA TCTGCGATTA AGTGATGTCC GCTCAGATTT     20340
     TACGTTTGTT CAGCCGGAGG AAGAAGACTC GGTAGCTTGG CGATCGCGGG TCTACTGCAA     20400
     ACCCTTGATG GATGAAGAGG TGCTGTTATC GACATTAGTG ACGAGTCCCC AGATTGCGTT     20460
     TGTGGATGAG TCGCCCCTTG AAACAACCTA TGTGACGGAT CATCTTCAGC GGCTGAGGTT     20520
     TAAGGAAACG CCGGGGGCGT GGGCACTGGT GCTCAAAACT AGCCCGATTC GTGCTCAACT     20580
     TGCAAGGATG GCAATGGGAA CTGCCCAACA GTTCACCCAT GTTGATGCGG TGCGTCAGCT     20640
     TTGTTTGCCG GATGTACCCA TTGAATTACG GGAGCGATGG GAACGGGTGA TTCGGCGGCA     20700
     TCATCAACGA AAACGGGAGT TGGAGGTGGA GTGGGGGGAA ACCTGGAATC AGACACAGCG     20760
     ACTATTTGAT GCGATGCATT CTCTAACGGG GCGGAGGAAA GACGGATGAA CGGTGCGATT     20820
     TACGAGCAAC TCACTGAAGC GTTGAAACAA CAACCTTTGC CCCTGGCACG GGTTCATGCG     20880
     ATCGTCTGTG ATGCCGGAAG CCGTTGGTCA GAGGAGCAGC TCCATCTGTT TCTAATTTGT     20940
     ATGGATGGCG TAGAAGTGGA TGCAGGGGTT GAACCGACGG TGGTGCGGTT GGGACAACGG     21000
     ACAGAACGAG ACGAGTTGAT TGATGCCATT CGGCAGGTGG TGCGTTCTCG TGCGGGTCGC     21060
     CCGGTTCCAG CGGCGGAGGT GCGGCGGTTG TTGCCGAGTA AGTTTGTGAC GACGGAAGAC     21120
     CAAATTAAAC GGCTGGCAAA GGAAACACCT GGCTTAGAGG TGTTTGGACC CGGTTTAATG     21180
     CGGATCGTTG ATTAATCAGC ATGGTTGAGG GGAAAAGCAG AATGGCGAAA ACTCAGACTA     21240
     AAGCGGAAAC AGAAGCAACT CAAGAGATCT CTACGATTGC TGCGACAATG GTATCCCTAA     21300
     AAAAGGAGAT GGAGCGGAAG CAGTTTTCAC AGATTAAAGA TCTGACAGGT GACGCAGAGA     21360
     AGCAGGCAGC CGCTGTGGCT TATGGCGTGT ATAAGGGCGT AGAAACTCCT CGAATTTTGC     21420
     TACTTGCATT GGAATTGGGG CAATGGGAGA AGGCAAGCGC CGACTATGTG CAGCAACAGT     21480
     CCTACGAGTT AACTCCGCCA GGAACGCCAG AGGATCAATA TCCTCAGTTT GCAATCGTGT     21540
     CGGATGGGGA ACACCAGAAG ATTTTTGATA TTACGTTTCC GGCTCATGAA ATTGATCGCC     21600
     TGCCAACCCT TACGGAAATC AACGAATACA AGCGGATTAA AGCTGACCCT ACCTACCGCT     21660
     GGTCAATGAA GATTTACTTC AAGCTGATGT GGGGATTTGA TAGCTTTCAC GAGCAGGTTT     21720
     ATCACCATGT CAAGGATGAT GTGTCTAGCT CTAACGCAAT CATTCAGGAA GTAACGAAGC     21780
     TGTTGTTCCT GGAGTCGTTC CGGTTACATC ATCAGGGCGC AGATCTGGAA TTCAAACATG     21840
     AGGATAAAAC GCTGCGGCTG GATGAAGTGT TTACGGTGGG GTACGTGAAG CAGCATGGCA     21900
     AAACGGCTGT AGCGGCAATT CAAGCTGCGT TTGACCACTT TCGATCGCAC CAGGATTACG     21960
     TTGTCACAGA TGATGCAGGT GAAGCCCATC CCATTTTTGA TAACAAAACG CATTTGCGGC     22020
     TATCGCAATC CCGAAATTAC GAAACCATTT TGGATCTGAT TCAAAACTTG GGTCCGGTGA     22080
     CGGATAACCG AGACCAGGTG GTGAAAGAGC AAGGGACACT GGCAGACATT GCCGCCGATG     22140
     TGTTGGGGCG GTTGCTGGAT GTGTTTTTGC GGGCGAAGTT TAAACCGGAA GGGATGGGGG     22200
     TTTATCTAAC TCCGGCTCCG GTAAAGCAGG CAATGTTGGC GATCGCCTTC CACGACATCA     22260
     AGACTGAAAC ACCGGAACTG CTGACGGCAC GGGGAGAAGA CGGTAAACCT GCGTTCCGGT     22320
     TCTGTGATCC GACCTGTGGC AGCTATGGGT TTGGCTCGGT GGCGATGGGC TATCTGGAAC     22380
     GGGCATTGAT GGATGTTTTA GGCAAAGAAA CCTCGTCAGA TATCCGGCGA GATAAGCTGT     22440
     TTCGGGATAT GTGTGAGTAC AGTTTCGTGG GGGCGGATAA CTCGCAGGAG ATGGTGACGC     22500
     TGGCGCGGGT GAATATGGCG TTGTTGGGTG CCCCAAAAGC CAAGATTTTC CGCACGTCAG     22560
     ACTCACGAAT TAGTGAGCAA TTAAAGCCCT GTAGCTATGA TTTGATCTGC ACCAATCCAC     22620
     CGTTTGGAAA GTTGAAGGGG CCGGCTCAGA ATGATGCGGT GTTGGAGTAT TTCCAGTCGG     22680
     ATCTAAAGGA GCGCAAGAAG AAGGGCACGT TTGACTATGA ACCCTCGGTG GATGGGTTGG     22740
     CGTTGGGCGG CAAGCCAGAC AACAAGGGCA TCTGGAAACC TGCCTCGTCT GGAATTGATC     22800
     TAGCGATTCT GTTTATTGAT CGCTGCTTAC AACTCCTCAA ACCGGGTGGC AGGTTGCTGA     22860
     TCGTATTGCC CGATGGGGTG TTATGCAACT CTGGCGATCG CTATGTGCGC GAGTACATCA     22920
     TGGGACAGAA GGATGCTGTG ACAGGGCAGT TTCACGGTGG TAAGGCGATC GTGAAAGCGG     22980
     TGATTAGCTT ACCTTCAGAC ACGTTTAAGC TGTCGGGAAC GGGAGCTAAG ACGAGCATTT     23040
     TGTATTTGCA AAAGCGCAAA GCGAATCCAG AAACTCCGAA ACATTTTTTG GATGAACCCC     23100
     AAAAGGATGT GTTTATGGCG GTCGCCGATG CATTGGGCTA TGTGGTAAAG AACAACGTGG     23160
     AGGATTACAG CACTGGGGTT TTGAATGACT TAGTGCCGAT CGTTGGTGCG TATGTGAGGG     23220
     GTGAGTAATG TTTATAACAA GAGTTGCTAC CCGTCAAATT GAGCGTGTGA GACTGGAGGC     23280
     AGAGTTTTAC GATCCTGTAA AACTAGAAAA TCTTTCTTGG ATGGAACAAT GGAGAGATCG     23340
     AGCACACTTA CTGAAAGATC TGTGCGAATT TATTACTGAT GGAACTCATG TTACGCCTAA     23400
     GTATCAACAG AAAGGTGTTA AGTTTCTCAG CTCTACAAAT ATTGATCCCT TCTCGATTGA     23460
     TTTTGATAAT ACAAATCACA TATCTGAAAG CGAACATTTG AAACTTGGGC AACAGAAATG     23520
     CAATCCTGAA CCCGGAGATA TATTAATTTC TAAAAACGGA AGAATTGGTA CAGTTGCCGT     23580
     TTACCGAGAT AGTCATCAGT CGTGCTCACT TTTTGTAAGC GTTGCATTAC TTCGGTATCG     23640
     AGGAAATGTA GATATTGATT TTATTACTGC ATTCTCGAAT TCAAGTGGTG GTTGGTATCA     23700
     ATTTACTCGA TCCGCAAAAA CAGGTGTAAT AACTAATTTG CATCTTGAAG AGATTAGAGA     23760
     AGTTTTAGTT CCAGAACCGT TTAAAGCAGT TCAAACTTAT ATTGGAGATA AGGTGCGCCA     23820
     AGCGGAACGG TTGCGGGAGC GATCAAAAGA ATTAGCATCT CGTATACAAG CATTAGTACA     23880
     ACCTCTTCAT ATTCAAAATG CTCTCAAAAC TCCAGATTCA AAATATAATC GTTTAGAGGG     23940
     AAAAGAACTT CAGCATCGAT TAGATGCAAA GTACTATAAT CACCGTTCGA TGGAAGTTCT     24000
     GGATGCTTGT AAGGATGAAA GCAAAGCAAT CAATAATTTG ATGATTTCTG TAAGTAATGG     24060
     ATTTGAACAC AGAACTTTTG TTGATGAAGG ACAGCCTTAT ATAACTGTTT CAGAGGTTTC     24120
     TTCAGGCAGA CTAGATTTAA CCAGTGTTCC TAAAATTCCT GATTCAGTTG AAGTTCCTGA     24180
     TAAAGCATTA ATTAATAGTA ATTGTGTCCT TGTTGTACGA ACAGGTTCCA TTGGAATTGC     24240
     TGTTAAAGTT CACGAGGAAG ATGAAGGGGC TTCAATTAGT AGCCATTTAA TTCGATTAGA     24300
     GTTTCAAGAA GAATCTACGG CTGCTGCTGT TGCTGCTTTT TTGAATTCTG CTGCGGGTGA     24360
     ATGTTTATTA CACAAAATTA GCTACGGAGC AGTTCAACCT CAAGTTGGAC AAGACGAACT     24420
     TCTTAATCTA CCTATTCCTC GAATTATTCT TGATAACTCA GAAGAAATTC TGCAATGTAT     24480
     GAATCTTCAG GAAATGGCAA TACGTAGTGC AGAGCGTCTG ACTACTGCCG CAAAACTTTT     24540
     AGTTGAAGGC TTAATTGAAG GCAAGATTAG CGAACTCGAA TTACAAGAAG CACAGGAAGC     24600
     ACTTCAACGG GGAGATACCA CACTAGATCG CCAAATCCTT TCCCGTCTCA CCCGCAAAGG     24660
     CATTCCTGTC AGGGGCGAAA AAACTGAAGA ACCAGCCCTG TTTCCCGATC TCGACGCACT     24720
     CTACCGCGTC CTATCAGACC ATGACGACAC AGACGAGGAT TCAGACTGGG ACTCAACCCC     24780
     TGAATCGCGG CAACGGTGGC AAACCCCGAT TCAATCCTCC CGTCGTGCTG CCGAAGCTTC     24840
     CATCCCTTAT TCCCAAGATG CCACCGTCAC GTTACTCGAT GAGGAGGGCG ATTAATGGCT     24900
     TACAGCGACT TCAAAACCCT GAACCAAGTC CTGACTGCTT TTAGCCTGAA GCTGGTTAAC     24960
     CAATTTGGGC TATTTAGTCA GGTAAACGTG ATCGAACCTT CACCCAAACT CTCCGAGCAA     25020
     ATTGCCGAAA ACTTTGATCT GGCACTGGCG ATCGATACCG AAAAAGCGAG ATCGGAACTG     25080
     ATTGTCACCC CCATACTGCT CGATATCTAC CGCCGCTTCA GCCCTAACCT ATCCCTGTTT     25140
     AGCGGTGTCG CCTTATCCGT TGATGCCACC CAGGGATTAA ACGGGGAATG CGACTTCATC     25200
     CTGTCCGCTT CCACCAATCA GCTTGAGGTT TCCACCCCTG TCCTTACCCT GGTTGAAGCC     25260
     AAAAACAACG ACATTAAATC AGGACTGGGA CAATGCGCTG CCCAACTCGT CGGAGCGCAA     25320
     CGATTTAACG AATCGCAGCA AAAAAATGTC CCGATTTACG GCGCAGTCAC CACTGGAGCC     25380
     GCATGGCGAT TTATGCGCTT GCAGTCCAGC CAGCTAGAAG TCGATTTAAC TGAATACTTC     25440
     GTGCCACCCC AGATCTCAAA CGTCCTGGGA ATTTTGTGTC AACCGTTCCT TGCTGAGGAG     25500
     AAACCCAAGC CATGACCCTC TCAGCCAGCA CCATTCGCGC GATTGATCGT CTCCTGACCA     25560
     ATGGAGAAGT GAGCCGCTCT GGGCTGGCTT CCCTTTATGG GTATCAACTG GGATTATGGG     25620
     CTGATTGTAT CGATACCACT CGCGCCGTCG CCACCCTCGA AGCCGTCCGT CTCCTGCGAA     25680
     CCCTACCGAC TCGTAACGAG GCGATCGCCG CCATCCTCGG CTGTGAACCC GATATCCGTC     25740
     AGGCATGGCA ACGCATCGCC ACCGCTCGCC TCAAGGAAAT GGGTAACCTC CGCGATGCTC     25800
     AAGGTCTTTC AGAAGCCATC ACCACCCTGG GTCAAACTTG CCTTGCCCTA TTGCCGAACT     25860
     TCTCCCAATC CTCCCTTAGC CCGACCCCCT ACACTGACCT GGAACGAGCC GTCTTTGATG     25920
     CTTCCGCAGA GCAGGCAATC GCCACCCCTC AGTTATTAAG AGCATTAAGC GCAACAGCCC     25980
     ATTTAATCGA GGGAGAACAG GGCAAACCTG CCGTTACCAT TCCAGACTTA GACCTCTATA     26040
     ACCCACTCAC CAACTGGTGT AAGGGACGCT TAATCAAACC GCCCGAACGG CTTGCAACCT     26100
     TACCAGACAC AGGAATGCAG AACACCTCGA TCCTGCCTGG AAGTTGGGCG CTCGCCCCAC     26160
     CCCCCGACTC CCCACCGCCC CATCGCTCCA TCTCCCCCAC GATGTATTGG GTGCTGTCTT     26220
     GCCCCTGGCT GTTTCTCCTG GCTCAGGTCG TATTCACCCA AGAAGCCTGG GGAGCCGAAC     26280
     GCATCGCAGG CAGACTCTCT CTAGAACTGG AATCAACCCA TCTATCCCAG TACTATCGTC     26340
     CCCCCGAAGT GCTGGTTGTC GTGACAACAG CCGAAGACGA AGAAGTGGTA TGTGGAACCC     26400
     TCAGCCAGCT TCTACTACGG GTACTGGATT TACTTGGTGT CACTCTGCTT GCCCCCGATG     26460
     TAACCGAGAT CGAATCCAAA TTGCCAACCC TAATTGAGTC CCTACTCAAA CATCAAATTT     26520
     GGCGATTTGA CCAGGGCAGC GGCGGTCGCC GTCCAGGGTA CTCCATTCAT GACTCCTTCT     26580
     CCGATGGGTG CTATTACCTT GCAGGCAAAT ACTTTAATCG CCTTAGCACC AATGTCACCG     26640
     CTGCCATTCG CACCACTTGC GGGCAGTGGG CAAAAGAACG ACTCGCTCAG ACCGGAAAAC     26700
     TCGCAGCACT CATCTCCTAA AACCCTTTTC TTGTAACCCG TTATGGACAA AAATCTCCTC     26760
     ACACCAAAAC ATCGATGGGC AGAAGACGGT GTCTCCGGCT ATCCATTAAC TCATCCAATT     26820
     GTTGGGCAAA GTAACTTTTT TAATGATTTC AAAGTCTGGA TTCCTATCGT TGATCAGAGT     26880
     CAGGAGAAAT TTGCTCATGT TTTTGCCATT GTTGCCCAAT GGGGGGTAGG TAAATCACGC     26940
     TTAGGTTACG AACTGATTAG CCAAATTAAT AGCAATTCTC CAGGTTGGTA TGTCCGAAAT     27000
     GAGGTAGGTG TTTTAGAGAA AGGTGAGCTA TTTCAGGAAA GCGATAGAGA TAAATATCTA     27060
     GGTCTATACA TCCGATATAG CCAGCTCTAC AAGGATTATC AGAACGTCGA TAACTGGTTT     27120
     GGATACGGTT TTTACCAAGT TCTTTTGCCA CTAGCGAGGG GTGTGTTTGA TAATTCAATT     27180
     CAGGGGCAAG TTGCAGAAGA AGCCTATAAC CGCTTAGTTG TTCAAGGGTT TGACAAAACC     27240
     CAGCTAGCAG AGATTTTGCA GCTCTCTCAA AACCATTCTG ATGAGCACTT GTACGAAGCT     27300
     CCAGACCTTT TAACTGAGAT CTGTACCAAT GCCCATAACT ATTTAAAGGA GTTTGGGATT     27360
     GAATATGTTC TTATCGTCCT TGATGAGCTA GAAACCGTTG CCGAGACTGC TACGTTTGGT     27420
     TTGGAAACAG AAGAAATAAA ATATTTAGAT GGCAGGGCAA TCAAACTGCT TGGTAAAGCA     27480
     ATTAAAGAAG AAGATCCTCG GCGTAAATTA CCTTGGCTTC GTTATGTTGC TCTCTGTTCT     27540
     CCTGCCATCG GTGACGAATT ACGAGAAATT CGCTCAATTG ATCGTCGATT ACCAATCGTC     27600
     GATCTTGCTC AAAATCCATT TGCTGATGTC AGCGATTTTG TAAAAATTCT TGAGCAACAA     27660
     CAGAAGATTG AAAAAAGCTA CCCAACCGGG GTAGTTGAAG CCGCTTACGC TATGAGCGGC     27720
     GGTAACTTCG GTTGGTTCAA CGTAGTTATG ACATACGTTG ATCGAGTTTT GAACACATGG     27780
     AAAGCGCCTA ATCCACCTTC CATCGGCGAA TTGTTTACTG AAGTTGTAAA AGTCTCTAGC     27840
     CGTGTCCGTG ACTATGTTTT GGACTACAAC GCTATCAATG AACTACGCCT GAGCGATCGT     27900
     ACCCATATCG AAGCTGCCCG CGAACTCCTC TATGGACAGT TACCTGTCCC CCTAGCAAAA     27960
     TGGCAACCTG ACCAGCTACA AACCCTGCTA TCTGGACAAA ACGAATACAA CGAACCGATC     28020
     GCCCTGCGCT ACCGCCGTGT AGAGTGGGAC GACCTGGATT GCAGCGAAGC TCTGCGCCAG     28080
     GCAAAATTCC GCCGTCCTCA AGGAGATAGA TGGTTCCTTA CCGGAATAGA CGAACCACTC     28140
     AACCTGCAAC AGCTATTAGA TAACCTCAGC ACCTACGCCG TTCATGAGAG CGGTGGAGTC     28200
     CGTACATCTG ATGGCAAACG AATTGTGCTG ATTCCACTCA AACAAGCGGA ATTTGTTCAA     28260
     CTCGTTGGGT TACTGTATCC CCATCCTGCG GCAGAAGATG CTGCTAGAGG ACTTTGGAAA     28320
     TGGCTAGTTG GTGCTGACCT GAACGATACT GATGCAACCC ATGTCGGTCC AAGCATCGCC     28380
     ATGTTGGGTC GGTTAAATCT GCGCTATCGC AAACAAGGGC AGAATTCCCT TATTTTCCGT     28440
     GACCCCGATC AGAACACGGC TCATGAAAAG GTCATGGAGC AGCGCAAGAA TCAACCCACC     28500
     GATGAACGGG CAAAGGAAAT TTTGACCGGC ATTATGCGCC TACTTGACCG GAACTGGGCT     28560
     TATGACGTGA GCAGTGCTGG GCTTGCAGAC GGTTTGGTGG CGATCGCCAC TGCCCCTGGT     28620
     AGCCGAGCCA GAGAGAAAGG CGGCTTAGTG AACTGTGACG ACTTGAAGTT ACATCCTGAT     28680
     GGCAGGCTCA TTCTCGCCTG GGTAAGGAAT GAAGATGAAT TAGAGCAGCT CTGCAACCCT     28740
     GGTGTATCCC AACAATTTAA TACTCATGGT AGAACTCCAG TGTTGGCGTT TACATCTTCT     28800
     CGCTCTTTAG TCGATAAATT TGCTAACCCT GCCTCACCAA CACTTAAAGA TGCCCGGAGC     28860
     TACCTGCTGC TTTACCAGCT TTCCGCGAGT GAAGAGTTCG CCCTGCATCA AGTTGGACTG     28920
     CCAACTGTTG ATTGCAAAGG CTTTCGGCTC GATAACTCAG GCTTTAACAG TGCCTTCAGC     28980
     AATCGTCTCA ATACGCTACT ACGCCCCCTA ACCGATGCAA TTCGGCAATG GCGACGCGAT     29040
     CTCGATGCAA TGGGGCGAAT CGCGTGGCCC CTTCGTCCTG GCGGTCCCCT CAAAGACACA     29100
     GAAAAAGCCC TGCTTTTTGA TGCCTGGCGC TATCTCATGC TTTCCAAGCC TGCGCCCCAC     29160
     TCCCTGTCAG ATTTAGATGA AACGAGCGGG CTGGATGTAG AAGAGGTTGT TGACGTTCTC     29220
     AAGAAGATAG ATCTTAGACC CAAACCAGAA GGCTATACAG ACGACGATCG CGCAATGCTC     29280
     TTCAGTTCAT TGGATGACTC AGCCGATGCG GTCTTCCCTC CTTTCCTAAT CAGCATTTTG     29340
     GAGCGACTGC TTCAAGAAGG ATCGTCCTGG ACACTGAACA CTGCTAAGCG CGAGTGGTTT     29400
     TGGGGGTATA CCTGGAAAAC CGCTAAGCCA AAGGAGATCT TCGAGGATTG GATGGGTTTA     29460
     GCCTGCGATT TACAATTTGC GATCGAAACC TCTGCCGGAA CTAGCCGGGA TAGTGCCTCC     29520
     TTCAGCTTAC GAACAACATC GGAACTCCGT AACCTGATCA ACGAAGCAGA TAACTGGTTG     29580
     AAGAATGATT ACCCAAAGAT AGTCACTGAA AAGATGGCAT TAGTCTTTGG AGAAGACAAG     29640
     GTTTTTGACT ATTTCGCTCC CCGTGGTGGT GCTGCTAAGG TTGGCTCAAA AACTTCTAAC     29700
     GCTGAGGGTC GATTAAACCA AGCACGAGAC TACTTATCAG CACTAGAGAC AGCAGAGGCA     29760
     AATTACACAT CTAGCCCCAA TGAAGATCAA CTGCTGGAAT CTGCCAAACA ACGAGCAGAT     29820
     TTATTGAATG CAGTCTCCTA TGTCTATCTC GACAAGGATT ACAAGCAACT CACTAACGAC     29880
     GAAAATGTCC GTACCCTCAG TTTTGAGGAT GAGTCAGTAC CTCTCTGGAA GCGAGTTCGA     29940
     CGGGCTGAAA TTTTCGCAGA AAAGACTTTG CGTAACAAAA AACGTATCTG TTCTCGCATC     30000
     GATAAGTTGC CCGATGAGAT GAAAAAAGAT GTGAGGGATT TGAACTTGAA TCATTTCCCT     30060
     GTTCACCTTT TTACCTGGTG TCTGGAAAAG ATTCGAGATA TTTTAAACGG AGCATTACCC     30120
     GAAGAAGGTA CGCCTCAGGG AAGCACCGCC CGACGACAAG TCACAGAACC TGGCACCTTA     30180
     GGGCAGTACC TGCGAGATCT ACAGGTAGAT AATGCAACAA CTCGGCTGTC TCAATTAGCC     30240
     CGCGAGGTTG GCATTGACTT AGATTCTGAG GCTGAAGCTG ACTTAGAGGC GATCGATGGT     30300
     CAAATCATCA CCGGCTTTCG AAACCTGAAG CAGTCCTATG AGCGACTCTA CACCCAGAAG     30360
     GCAACGCTCA ACCAACGGTT GCAGAAGTTA GTTGCCAAAC TGCAAAATAG CCCAACAGAC     30420
     TTTCCGTACC CGACTGATAT CCCTACCCTT GCCAACTTTC AGAAACGGAT AGAACTACTG     30480
     GAAGATACAT TGGAGGGGAT TAAAGAAGAT GGAGTTGATA ACCTCCAGCA CGACGATGCT     30540
     CTCAACAATC CATCAAAGTT GGGCAACTTC CAACCTTTGA TGCAAGCAAC ACAGGGATTA     30600
     TTAACAGAAC CTACCCGTGA ACTCCAGCAA TTGTTAGGGT ACGCCGCAAC TTTGGAAAAT     30660
     GCCATCACTG GATATCTAAA GTCGCTTTTA GGCAAACCCG ATGTCATTTC TATTGAAAAA     30720
     GGCTTGAATA GCCTGCTCCA GGTTCAAGGA AAGCCTCTTC GGAAAGAGCT TGATCTCCCT     30780
     GAGCTAGAAA TAGCAGGAAG TCTGCAAGCA GCGATCGAAA AAATCGAAGA ACGGAGAGGC     30840
     AAGTGGGTTC AAGAGGGCGA TCGCCTACTT GCTTCCTCTG GAATCACGTT TGAACGGTGG     30900
     CGACGTATTG TTGAAGCGTT GAACGCGGAA CGCGACCCAC AACTCGAACC AGAAGAAGCC     30960
     GAAAAGCTTG TCAATGGCAG GTTATTGGTG CGTACATACC GACTGGGGGG TACAAAATGA     31020
     ACAGCTCCAT CTGGTTAGCT GGCAGCTTGT CGAGCCATCG CCGTAGCCGC ATCCTGCAAT     31080
     CCGCAGTGGA TGCTCAATCC ACAGCACAAA TTCCTGAGGT TGGTACCTGT CTCCTGTTTG     31140
     GAACCGATTT TCAAGAAGGG GAAGAAACTT CACAACAGGA TTGGTACACC TGGACCCAGA     31200
     AACCGGGACG TGCTCTCCTG CTCATTCCCC CATTTAAATC TGGAAGCTGT TCTATTCCTT     31260
     CCTCATGGCA GATTTCCCGT CGCTCAACCC CTCCAGCTCA TCAGAATTTG CCACTGGCTA     31320
     CCACTCTCGC ATCAGAGGTG CAGTACGAGT TACAAGGGCA GCTCCAGGTC GCAACTCAAC     31380
     TTGGAGGACT CTGGGATGAC CAAAGCATTT GCACAGCTTA TTACCGCAAA CATCCCCACG     31440
     CTGGTATTTT TGCCATTACT TGCTTACCGC TTTGGTCCCT ATCAGTTCTC GATCATGCAG     31500
     CGGAATTGCA AAGCTGGCTA GATGAATTGT ATCTACTCGC TGGTTCTCCC GTAGAAGATT     31560
     CTTCACTGAC CAAGGCAGAG GAGATTGAGC TTCAACCTGA GCACTACACA GTACTACTCC     31620
     ATCTAGTCAG CGGACCTTTT GCAAATGAGT CAACAGCCCT CGCCGCACTC CATCATTCGT     31680
     CAATCTTTGC TGTTGATACA GACCGGGCAA AGGCTTGTTT ACAGGATGCT CAGCAACATG     31740
     GATTAGTCAT CGGAGGGCAA TTAACAGAAT TAGGACGCGA TATCTTAGAA CGCAGCCCCT     31800
     ACAGCACTTA TATCAACTCT CTTGAGGCAT TAAAGCGATG AGTTTAACGT TCGCAGGACA     31860
     GGGGCGATCT TTACCCCAAA CATTAGCCAT TCAATCCCAA ATCCACTTAC CTGGAACCGT     31920
     AGGTCGCGTC CTGAAACAAA TTCGAGATAT TGAACAAGTT GCTCCTCTAT TTGTCGATGC     31980
     AGGACTGGTT CATCCGGTAA AACGGGAAAT TGCCCTTAAT GCCAGAGTCG CAGGAATTGC     32040
     AACCAGGGCC ACAACGACTA AGACCATTGG CGGCTATCTC TATGCAGCAG CAGCAGTTCG     32100
     CATGGATTTA TCCGCTGAAG ACAATGTCAT TTCAACGATC GGGCAGGATA GCACCTGCGA     32160
     ACTAGACGAC ATTGACTATG AAGATCAGTC CAAACGGCTT CAACTCATTA ACGTTCGGCA     32220
     AGCATACGAA ATGGCAGACG CTGCCCTTCG ATCGTCTGAT CAATTCGATC TGATCATGCT     32280
     AGACTGCCCT CTCGTTTTGA ACCGCAGCAT GGTTCCTTTA CGGGAAGATG AGAGCGACGC     32340
     TGCATTTCGG GAAGCTTTTA TCGCTGCAAC AGACGCAATT AAAAACTTTT GGAATAATCA     32400
     TCGCGATCGC CTACTTCCCT GGAATCCAAA CGGCACAGCA GTTCTGGGCT TAGCCTCTCA     32460
     ACGGTTTGGT GCAATTGTTT ATGTTGCTCG TCAGGATCTG CGAACAGAGG CAGGGCGACA     32520
     GCAAATTCTG GATACCGAAG GAGTTGATGA AACTCAAATT CAAGCAATCT CCAAACTTAG     32580
     CAAATCAATT TCTGGGATTG GTGAACGGCG CTTCGTACAC GGCATTTTGA GCAGCTATAC     32640
     CCGTACAGCC GCTTTTCGAA TGAATGTTCA ATCCCCCCGC ATGGAGCCGA TAGAAATAAC     32700
     CAAGTTGGGG GTAATTGGCT TCCATTTCAA AGCAGCCCAC AGCATGACTC CACGCTTACT     32760
     TCAACTCATT GGCGATTCCC CCTTATGGAC TCGTCCCATG TTGGATAAAG TATGTAGCCA     32820
     AGTGATGGCT TTGACTGTGG TAGGCGGTGC CCAAGCAGCC CCATTGCCAA TTCAGCTTGC     32880
     TGAACGAGAA CAACAGGCAC TCGATAAATT CCTCGAGTAC TACAACCAGG GAGTGTTGCA     32940
     AGAAATTAAA CGCAAAGAGA TCGAGGATCT TTGGTTATCG GATTTTGATA GCCCCATTTA     33000
     AGCGAGGAGA AAGATAGTGA AACATCAGGT ACTGGGCAAA TTAATAGGGA ACACAGGCGA     33060
     TCCCAATAAT CTAACAATGA CCCTGGCTTC CTCATTTGCA GGCAAACGAG GTGAGTTTGT     33120
     TCGTATCCGC CATAAAGAGC GAGAAGACCA GAGCGTTGAT GTTCTAGGAC GGATTGTTAG     33180
     CGTTGTTCGG AGCAATGTCC TGTATAACTC TGATATGGGG TCTTCGGTTG TTGAATTAGA     33240
     GTTATTACCG GGTGCTCAGG TTACTGGAGA GCGGGTTATG GCTCGGTTAG AGCTAATTGG     33300
     CTACAAAGAC CCATCCACTG GACAAATCAA AATTCCCAGA CGGGCACTTG ACCCTGGTGC     33360
     CAATGTTGAA ACTGTTGATT ACTACTTTCT CAGTTCCTTC TATGAATTTG ATGAACAAAC     33420
     CAGCCTTCAC ATTGGCAACC TTGTAGGTTA CGAAAGCGGG GAGAACACTG TTCCTGTCTA     33480
     TCTTGACGTG AATCGCTTAG TGACAGAGCA CTTAGCAGTT CTAGCAATGA CAGGGGCAGG     33540
     AAAATCTTAC ACCGTAGGTC GCATTATTGA GCGGCTAGTT GTTTTGAATA ATGGAACAGT     33600
     CGTAGTTTTC GACCCACATG GAGAATATGG CAGAGCACTG CAGGGTGGCA ATCTTCAGTT     33660
     CAATCTAACC TTCAGCTCGA TTGAAGATGC ACGCGATCGC CGTACCATTG AGGAGATTCA     33720
     AGAGGGCTTC AAACATCTAG CCAGTGCTGG AATGGGCATT GTGGTTTATA CCCCTCAAAC     33780
     CCGAGACTTT AGGGAGAAAT ATGCTGGAAA GAACAAGGAA CTTGCCTTGC AGTTCGATCG     33840
     GTTTGAAATG GATGACGTCA GCGAAATTCT TCCTGGGTTA ACAGAACCAC AGCAGCGTGT     33900
     TTTAGACGTT GCGATTCGCT ACTGGCGGTT GATGGAAAAA GCAGAACCCA GAGACATTAA     33960
     CCGTTTGCGG TATTACCTTG GAGACGGGTT GGAAGAATTA AGAGAATGGG ATGAGCTGAG     34020
     TACAGCAGAA GCAACAGCGC TCAATAGTCG TAGTGCCGCA GTTGCCTCAC TCCGGCTCTC     34080
     TCGTTTGTTG AATGAAGCCC AAAGTTTCTA CTCTGCTGCT CTACCTCGCC CTACTGATCT     34140
     CTATGAAATG GTAGGACGTC CTGCTGACAA GCGCGGAAGA CTTGTCATCG TTGACCTACA     34200
     AGGCTTAAGT GATACGGCTA AACAAGTCAT TACTGCCCTG ATTTCGAGTG AGGTTCTACG     34260
     GCTCGCCTCC AGCAAAACTG ACCCAATCCG TCCATGTTTC TTGGTTTATG AAGAAGGACA     34320
     TAATTTTGCA CCAGCCGGAC AAGACGCAGT GAGTCATCGA ATTATTAAAA AGATTGCGAG     34380
     TGAAGGACGA AAATTTGGAG TTGGGTTTGC GATCGTCAGC CAACGTCCTT CAAAACTCGA     34440
     TTCTGACGTA ACTTCGCAAT GCAACACATT GATTGCGATG CGCCTAAAAA ACCCTGATGA     34500
     TCAGCGATTC ATCACCAAAA CATCGGACAT GGTGAGCAAA GCAGATATCG AAGAACTGCC     34560
     CAGTCTGTCC ACAGGCGAAG CCTTAATCTA CGGGCGTTCT ATCCCTGCTC CTCTTTTAGT     34620
     GAAAGTAGGT ACAAAGGCAC TGTTGCATGG AGGACAATCT CCAGAGGTTC TTGAGGTTTG     34680
     GGGGAAGTTT AATGGTGCTT CAACTTGAGG AAACTCTTGC CACCAA                    34726
//

If you have problems or comments...

PBIL Back to PBIL home page