(data stored in ACNUC8465 zone)

HOGENOMDNA: CYAP4_4

ID   CYAP4_4; SV 1; empty ; DNA; empty ; PRO; 179973 BP.
XX
AC   NC_011885;
XX
PR   Project: 59435;
XX
DE   Cyanothece sp. PCC 7425 plasmid pP742502, complete sequence.
XX
OS   Cyanothece sp. PCC 7425
OC   Bacteria; Cyanobacteria; Chroococcales; Cyanothece.
XX
RN   [1]
RP   1-179973
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Complete sequence of plasmid2 Cyanothece sp. PCC 7425";
RL   Unpublished
XX
RN   [2]
RP   1-179973
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (09-JAN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-179973
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Meineke,L., Brettin,T.,
RA   Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Liberton,M., Stoeckel,J., Banerjee,A., Singh,A., Page,L.,
RA   Sato,H., Zhao,L., Sherman,L., Pakrasi,H. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (06-JAN-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001346.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082850
CC   Source DNA and bacteria available from Himadri Pakrasi
CC   (pakrasi@biology2.wustl.edu)
CC   Contacts: Himadri Pakrasi (pakrasi@biology2.wustl.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..179973
FT                   /strain="PCC 7425"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cyanothece sp. PCC 7425"
FT                   /plasmid="pP742502"
FT                   /db_xref="taxon:395961"
FT   gene            complement(153..1703)
FT                   /db_xref="GeneID:7291291"
FT                   /locus_tag="Cyan7425_0001"
FT   CDS_pept        complement(153..1703)
FT                   /locus_tag="Cyan7425_0001"
FT                   /gene_family="HOG000035498" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   amr:AM1_1243 2-succinylbenzoate--CoA ligase"
FT                   /db_xref="GI:220910611"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:7291291"
FT                   /translation="MLSLIRKLYRTKLLTPMGLFYLLEALLTTGMNLMALLRLAAQLHP
FT                   ERLAVIDEHDHYSYRQLWQQAEALAMTLQSEYGIQQQQNIAVACRNHAACIKAIFAGSR
FT                   LGAHIYLLNPEMSPNQIQATLDRLAIDFYIYDHPPDQPFPPWLEVAVQQRQALPAYHAT
FT                   ASAIDQLPLSPEVVNRHLKPVKTGNIIVMTGGTTGTPKPASRKPSMVKFLPPFIALLEQ
FT                   VHLDRYRSLYIATPIYHGFGLAALLIGIVLGVELYVTSRFQTEQACSLIASHQIEVVTL
FT                   VPLMLQRMLRDNPATLSALKCILTGGAALSPVLAQDTLAQLGPILFNLYGTSEAGFCIL
FT                   GTSRILRKNPASIGQPVGGVQVKIVRDGSQEHSNKYGNNQIGRLCIRSAWSTAANSWIE
FT                   TGDLAYQDTEGNIFLCGRVDDMIVSGGENVYPIDLETILSQHPDIEAAVVLGIPDPEFG
FT                   QRLKAVVVTKQPTMLSEDLLRVWLRPRVARYQMPAVIEFHRELPYTALGKLDRKSLRE"
FT                   /protein_id="YP_002485921.1"
FT   misc_feature    complement(156..1703)
FT                   /note="acyl-CoA synthetase; Validated; Region: PRK07788"
FT                   /db_xref="CDD:181117"
FT                   /locus_tag="Cyan7425_0001"
FT   sig_peptide     complement(1581..1703)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.730 at
FT                   residue 41"
FT                   /locus_tag="Cyan7425_0001"
FT   misc_feature    complement(156..1538)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Cyan7425_0001"
FT   gene            complement(1714..2535)
FT                   /db_xref="GeneID:7291292"
FT                   /locus_tag="Cyan7425_0002"
FT   CDS_pept        complement(1714..2535)
FT                   /locus_tag="Cyan7425_0002"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   amr:AM1_1244 short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="GI:220910612"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:7291292"
FT                   /translation="MRILFFPFLSFSDTQLQRHLRGKTVLITGASYGIGECLVTRLAGT
FT                   QAELLLVARTKDKLVELKQRVESQGGHAEIFPCDLRNAVEVQALINTLQQRPGGIDIFV
FT                   SNAGKSIRRSIFDSLDRYHDFTRTMYLNYFAPVQLMLGLIPALVARRGQVINISAVNVL
FT                   LIPTPQWSAYQASKTAFDQWFRCVSPELNAQNVRTTSIYLPLVRTRMIEPTLMYRHLPA
FT                   MQPQQVAQLICQAMLSRRSTYAPWWLLIGQLGSVLFRSLWEIGLNYYCKHK"
FT                   /protein_id="YP_002485922.1"
FT   misc_feature    complement(1753..2481)
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="Cyan7425_0002"
FT   misc_feature    complement(1816..2472)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Cyan7425_0002"
FT   gene            2793..3974
FT                   /db_xref="GeneID:7291293"
FT                   /locus_tag="Cyan7425_0003"
FT   CDS_pept        2793..3974
FT                   /locus_tag="Cyan7425_0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /codon_start="1"
FT                   /product="WD-40 repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: mar:MAE_38240 WD
FT                   repeat-containing protein"
FT                   /db_xref="GI:220910613"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="GeneID:7291293"
FT                   /translation="MKFVQNPISRIILIVIAVSATLGIIYGINQLGGWLWRDTSLVCRK
FT                   EKLNALDVTADGKTLITGGKEIRVWDIVSGKKLYDSTTVGSTVKKMAGLSPATISTLNI
FT                   TPDQRLFITAASSLGGIGTQGQHEIQIWDLVNRQLLRTLKGHRDRVRFLAVSPDSHTLV
FT                   SQDDSGVIQVWNLATGQVRQTLNTERRQRFPIVLSPDGKVFASMNKQGTVTFWNITTGQ
FT                   AVGKLQADPSHTPLAISDNNQTLLIQNAGDVKQFRDIATGRELTRLKGSYIEFPFTVDP
FT                   RGEQVLIQTNTDLKLYNLLTGVELKTFNMNNFYNPISITPDGQSFLTIDSQDNYVLWNI
FT                   ATGAKIHQLEGKASRGEYEITTAQILVNGDRNGNDLTLWNLTTGERIRKFCNQ"
FT                   /protein_id="YP_002485923.1"
FT   misc_feature    3087..3857
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="Cyan7425_0003"
FT   misc_feature    order(3129..3131,3141..3143,3186..3191,3225..3230,
FT                   3282..3284,3294..3296,3312..3317,3351..3356,3405..3407,
FT                   3420..3422,3438..3443,3501..3503,3516..3518,3534..3536,
FT                   3564..3566,3600..3605,3654..3656,3663..3665,3681..3686,
FT                   3720..3722,3771..3773,3786..3788,3804..3809,3843..3848)
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="Cyan7425_0003"
FT   gene            complement(4029..4403)
FT                   /db_xref="GeneID:7291294"
FT                   /locus_tag="Cyan7425_0004"
FT                   /pseudo
FT   gene            4736..6010
FT                   /db_xref="GeneID:7291295"
FT                   /locus_tag="Cyan7425_0005"
FT   CDS_pept        4736..6010
FT                   /locus_tag="Cyan7425_0005"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /codon_start="1"
FT                   /product="transposase mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase mutator type; KEGG: ajs:Ajs_2156
FT                   transposase, mutator type"
FT                   /db_xref="GI:220910614"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:7291295"
FT                   /translation="MSNDNLIAFQAPDPPASFSDALTELVRNGARQIIAQAVEAELQGF
FT                   LAQYESLQDDQGRQAVVRNGYLPERTIVTGVGEVAIQVPKVRDRSGRGIKFNSTLLPPY
FT                   LKRVQSVEEVLPWLYLKGISTGDFSEALASLLGAQAAGLSASTISRLKAKWIKEHQQWQ
FT                   QRSLLGKRYVYLWADGIYFNIRNEDDRQCILVVIGVTNTGSKELLGLEAGFRESELSWK
FT                   PLLLRLQDQGLKQSPELAVGDGALGFWKALAQVFPTTRVQRCWVHKTANVLNHLPKGQQ
FT                   PKAKSALHEIYMAETQAEAQTAFDRFIKTYDAKYPKAVACLSKDREALLAFYDFPAEHW
FT                   VHLRTTNPIESTFATVRLRTDKTRGCVSQESILSLVFKLVQSAQKRWLRIRGFKHLAEV
FT                   IEGVKFKDGLRADQQLDFKDSRNAA"
FT                   /protein_id="YP_002485924.1"
FT   misc_feature    4793..5905
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Cyan7425_0005"
FT   misc_feature    5312..5554
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Cyan7425_0005"
FT   gene            complement(6042..6425)
FT                   /db_xref="GeneID:7291296"
FT                   /locus_tag="Cyan7425_0006"
FT   CDS_pept        complement(6042..6425)
FT                   /locus_tag="Cyan7425_0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910615"
FT                   /db_xref="GeneID:7291296"
FT                   /translation="MNIDSLIRNFYGDLSRDLLIYMVAVAIAALVTWVVWFRQSIKHRR
FT                   AWLAAAIVLTVIGSSLVGAAYSYRVGIPAKLEADLASAQTNLNAARQAIIDRYGAERGV
FT                   PHFQKLATIWTVAGGMAIAVMLT"
FT                   /protein_id="YP_002485925.1"
FT   gene            complement(6511..7413)
FT                   /db_xref="GeneID:7291297"
FT                   /locus_tag="Cyan7425_0007"
FT   CDS_pept        complement(6511..7413)
FT                   /locus_tag="Cyan7425_0007"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bid:Bind_0029 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="GI:220910616"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:7291297"
FT                   /translation="MVVKHGVALVTGASSGIGKATAIALKSAGFTTYATARNPQTLSDL
FT                   ALKGCHILQLDVTDEASMLAAVRSIEAKHGAISVLVNNAGYSQIGPLEELTMEEIRRQF
FT                   ETNVFGLLRMCQLVLPGMRSQGYGRIINVSSMGGNFTTPGNGAYHASKYAVESFTDALR
FT                   YEVQPFGVDVVSVQPTGVRTPFVEKLYALMPKTGSDSPYAAFKRNIEAQIRQMFRGNAW
FT                   GILNPEDVAKVIVQAVFVRRPQTRYTVGLSGKIFIWVRRLLSDRAWDALMSRMFPMGEV
FT                   SDSKKRRKVTLTQDINALN"
FT                   /protein_id="YP_002485926.1"
FT   misc_feature    complement(6586..7404)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Cyan7425_0007"
FT   misc_feature    complement(6586..7398)
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="Cyan7425_0007"
FT   gene            complement(7483..8070)
FT                   /db_xref="GeneID:7291298"
FT                   /locus_tag="Cyan7425_0008"
FT   CDS_pept        complement(7483..8070)
FT                   /locus_tag="Cyan7425_0008"
FT                   /gene_family="HOG000024431" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hau:Haur_5205
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:220910617"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:7291298"
FT                   /translation="MSAKAKSGDSREQLLQLAEALFGERGYTAVTLRDIADAFKVRQAA
FT                   LYYHFPGGKEELFVEVIKRSLMRHLHGLNRAISQAEPNLSSQLNQMADWLLAQPPLDMT
FT                   RLARSDLPALSLDHAQTLMALGEISLVQPIQQVLTEAYERGEIRLVDSKLMATMFLSLV
FT                   DTAHDMHRYKNIPKQVLAKDMIDILLDGMRRR"
FT                   /protein_id="YP_002485927.1"
FT   misc_feature    complement(7486..8070)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cyan7425_0008"
FT   misc_feature    complement(7888..8031)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cyan7425_0008"
FT   gene            complement(8135..9406)
FT                   /db_xref="GeneID:7291299"
FT                   /locus_tag="Cyan7425_0009"
FT   CDS_pept        complement(8135..9406)
FT                   /locus_tag="Cyan7425_0009"
FT                   /gene_family="HOG000147074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 28"
FT                   /transl_table="11"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   glycosyl transferase family 28; KEGG: hau:Haur_2083 sterol
FT                   3-beta-glucosyltransferase"
FT                   /db_xref="GI:220910618"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="GeneID:7291299"
FT                   /translation="MYIAIIALGSQGDVQPYIALGKGLKAGGHDVRLLTHENFEGQVTS
FT                   HGLAFYPMQGNVQELIETPEMRELAEKGNFITLTLRTAKESEKVSIRWAQAGLEACRGM
FT                   DLLIAGVGGLYLALAISEKLEIPLLPAFVFPFTPTKTFPGILFSQSMGRFGGTVNWLSH
FT                   QVLRQIIWQGSRAGDTAARRQVLNLPAASLFGPHQSPYLHRLPTLYGFSPSVIAQPSDW
FT                   QNTFVTGYWFLDAAPDWTPPSDLENFLQAGSPPVYIGFGSMGNRNPEETASLVLQALDK
FT                   TGQRAILSAGWSGMRTENLPDTAFLVNSVPHAWLFPRVAAVVHHGGAGTTAAGLRAGVP
FT                   TVIIPFFGDQGFWGQRVANLGVGTAPIPRKQLTVERLAQAIQTAVGDRTMRQHAADLGV
FT                   KIRNEDGVANAVAIIQKLEVAGNA"
FT                   /protein_id="YP_002485928.1"
FT   misc_feature    complement(8156..9406)
FT                   /note="Glycosyl transferases, related to
FT                   UDP-glucuronosyltransferase [Carbohydrate transport and
FT                   metabolism / Signal transduction mechanisms]; Region:
FT                   COG1819"
FT                   /db_xref="CDD:32004"
FT                   /locus_tag="Cyan7425_0009"
FT   misc_feature    complement(8156..9406)
FT                   /note="This family includes the Gtfs, a group of homologous
FT                   glycosyltransferases involved in the final stages of the
FT                   biosynthesis of antibiotics vancomycin and related
FT                   chloroeremomycin. Gtfs transfer sugar moieties from an
FT                   activated NDP-sugar donor to the...; Region: GT1_Gtf_like;
FT                   cd03784"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0009"
FT   misc_feature    complement(order(8162..8164,8171..8176,9092..9094,
FT                   9326..9328,9404..9406))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0009"
FT   misc_feature    complement(order(8408..8410,8417..8422,8426..8428,
FT                   8432..8434,8621..8623,8789..8791,8882..8884,8894..8899,
FT                   8906..8908,9362..9364,9368..9373))
FT                   /note="active site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0009"
FT   misc_feature    complement(order(8417..8422,8426..8428,8432..8434,
FT                   8621..8623,9371..9373))
FT                   /note="TDP-binding site; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0009"
FT   misc_feature    complement(9368..9370)
FT                   /note="acceptor substrate-binding pocket; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0009"
FT   gene            9543..11093
FT                   /db_xref="GeneID:7291300"
FT                   /locus_tag="Cyan7425_0010"
FT                   /pseudo
FT   gene            complement(9764..10564)
FT                   /db_xref="GeneID:7291301"
FT                   /locus_tag="Cyan7425_0011"
FT   CDS_pept        complement(9764..10564)
FT                   /locus_tag="Cyan7425_0011"
FT                   /gene_family="HOG000254171" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   amr:AM1_1358 IS4 family transposase"
FT                   /db_xref="GI:220910619"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7291301"
FT                   /translation="MIRQSYDTDLTDEQWELLKPLIPPPRPGGRPRCLDIREVLNGIFY
FT                   LLSNGIKWRSMPHDFPNWHSIYTYFRAWEADGTWKRLNQTLRTEVRVAAGRKAQPSAGS
FT                   VDSQSVKTARGGEDIGFDGGKKVKGRKRTILVDTMGLLLGVCVHSAKRSDHQGMVLLAT
FT                   FWAAFWSCLKVIWVDSTFAGKNFIATIAQHFGWSLEHLKPTKTEPGFQVIPKRWVVERT
FT                   YAWFGHYRRLSKDYEFLTTTSEMMLFAAMVHLMVRRLKPKNQAR"
FT                   /protein_id="YP_002485929.1"
FT   misc_feature    complement(10184..10552)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Cyan7425_0011"
FT   misc_feature    complement(9797..10276)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Cyan7425_0011"
FT   gene            complement(11175..11630)
FT                   /db_xref="GeneID:7291302"
FT                   /locus_tag="Cyan7425_0012"
FT   CDS_pept        complement(11175..11630)
FT                   /locus_tag="Cyan7425_0012"
FT                   /gene_family="HOG000291750" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF606"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   cbb:CLD_3705 hypothetical protein"
FT                   /db_xref="GI:220910620"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="GeneID:7291302"
FT                   /translation="MDSRTIYLLAALLGGAILPVQVAINTLLRRYVGEPMQVTFISYLA
FT                   GTLASLVICFLARYPLPAATALAQTSWWMWIGGCLGTLYVWSTIFATPKIGAALALALT
FT                   IAGQMIAALFLDHYGAIGLTKYAASPTRITGAVLVVLGVSLVAYAKR"
FT                   /protein_id="YP_002485930.1"
FT   sig_peptide     complement(11562..11630)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.965 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0012"
FT   misc_feature    complement(11232..11576)
FT                   /note="Protein of unknown function, DUF606; Region: DUF606;
FT                   cl01273"
FT                   /db_xref="CDD:154308"
FT                   /locus_tag="Cyan7425_0012"
FT   gene            complement(11747..12913)
FT                   /db_xref="GeneID:7291303"
FT                   /locus_tag="Cyan7425_0013"
FT   CDS_pept        complement(11747..12913)
FT                   /locus_tag="Cyan7425_0013"
FT                   /gene_family="HOG000237023" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   atc:AGR_C_4286 hypothetical protein"
FT                   /db_xref="GI:220910621"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:7291303"
FT                   /translation="MPLKTSSLLVKATLLLSSSLTVMAGATIAPSLPAMRDYFAVTPNA
FT                   DYWVRLVLTVPALFIAIGAPFVGTVIDRFGRKPLLASSVLLYGIAGTSGAVLNAIGMIL
FT                   VGRVLLGLSVAGIMTTATALIADYYTGAARAQFLGFQAGFMGLGGVLFLSLGGFLADIN
FT                   WRMPFLIYLLALLILPLVVLVLPEPNYTEVGQNAGIDETEVFPWQIANLTYLAAFLSQI
FT                   VFYLIPVQLPFYLKQLANATASQSGLAIALATLFSAASAIAYKQIKARLSFVGIYAIAF
FT                   LAMAVGYLVISVSPTYAMVLVGLAIAGAGLGLLMPNMNVCLTSVTPVSLRGRVLGGLTT
FT                   AFFLGQFVSPILSPPLSSAVGLDVTYRLAGGLMAAMGAAALGLGWRWR"
FT                   /protein_id="YP_002485931.1"
FT   sig_peptide     complement(12839..12913)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.853 at
FT                   residue 25"
FT                   /locus_tag="Cyan7425_0013"
FT   misc_feature    complement(11816..12880)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Cyan7425_0013"
FT   misc_feature    complement(11864..12874)
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="Cyan7425_0013"
FT   misc_feature    complement(order(11876..11878,11885..11890,11897..11902,
FT                   11909..11914,11945..11947,11954..11959,11969..11971,
FT                   11978..11983,11990..11992,12131..12133,12143..12145,
FT                   12152..12154,12164..12166,12176..12178,12218..12220,
FT                   12227..12232,12239..12244,12251..12253,12470..12472,
FT                   12488..12493,12497..12502,12536..12538,12545..12550,
FT                   12557..12562,12569..12574,12710..12715,12719..12724,
FT                   12734..12736,12743..12748,12755..12757,12815..12820,
FT                   12824..12832,12839..12841))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Cyan7425_0013"
FT   gene            complement(12919..13656)
FT                   /db_xref="GeneID:7291304"
FT                   /locus_tag="Cyan7425_0014"
FT   CDS_pept        complement(12919..13656)
FT                   /locus_tag="Cyan7425_0014"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility domain; KEGG: gme:Gmet_0361 short chain
FT                   dehydrogenase"
FT                   /db_xref="GI:220910622"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:7291304"
FT                   /translation="MQVQGSIALVTGANGGIGQYYIQGLQTAGASRIYAGVRNPDSLKD
FT                   IVATDPDRIIPIPLDITDEASVQAAAETYSDVNLLINNAGVGFNQRLVADLNFDKVRSE
FT                   IEVNYLGTLRMCLAFAPVLKANGGGAIVNMLTMLAKVNFPLNASYCASKAAALLATQGI
FT                   RAELASQKTLVVGVMPGTVDTKMSKDFPPPKVAPEEVVRAALQAVIDGVEDVYPGEQAQ
FT                   EMQAQLLQDPKAVEKWMAGILAS"
FT                   /protein_id="YP_002485932.1"
FT   misc_feature    complement(12946..13656)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Cyan7425_0014"
FT   misc_feature    complement(13042..13656)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Cyan7425_0014"
FT   gene            13799..14122
FT                   /db_xref="GeneID:7291305"
FT                   /locus_tag="Cyan7425_0015"
FT   CDS_pept        13799..14122
FT                   /locus_tag="Cyan7425_0015"
FT                   /gene_family="HOG000293547" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: gvi:glr4204
FT                   transcriptional regulatory protein MarR family"
FT                   /db_xref="GI:220910623"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:7291305"
FT                   /translation="MTSQPTQGTVFVQTTLKVLGGKWRILILWHLKDEKKRFSELKRLM
FT                   PEITEKMLIQQLRELEKDGIVNRTVYSEVPPKVEYSFTEYGLTLKPVLQVLCNWGENHM
FT                   KRI"
FT                   /protein_id="YP_002485933.1"
FT   misc_feature    13850..14119
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Cyan7425_0015"
FT   gene            complement(14396..14569)
FT                   /db_xref="GeneID:7291306"
FT                   /locus_tag="Cyan7425_0016"
FT   CDS_pept        complement(14396..14569)
FT                   /locus_tag="Cyan7425_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910624"
FT                   /db_xref="GeneID:7291306"
FT                   /translation="MTTEVLHAKKNLVTPVALTAMASVLASLLMMTSTVQPSPTNSIPE
FT                   VIPSADRAFMLT"
FT                   /protein_id="YP_002485934.1"
FT   sig_peptide     complement(14462..14569)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.544 at
FT                   residue 36"
FT                   /locus_tag="Cyan7425_0016"
FT   gene            complement(14808..15547)
FT                   /db_xref="GeneID:7291307"
FT                   /locus_tag="Cyan7425_0017"
FT                   /pseudo
FT   gene            complement(15711..16082)
FT                   /db_xref="GeneID:7291308"
FT                   /locus_tag="Cyan7425_0018"
FT   CDS_pept        complement(15711..16082)
FT                   /locus_tag="Cyan7425_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:alr8563"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:alr8563 unknown protein"
FT                   /db_xref="GI:220910625"
FT                   /db_xref="GeneID:7291308"
FT                   /translation="MKKQARLIENDPLTATDKVLSGYEQFNKPERQQSDQSASQQVNTS
FT                   ESKEVSKPAIRKSTFQLSEEVLQRLDTFHLQLQLELGKANAPYKEVIVEAAIAHLLNTE
FT                   DREGLIRTLQKRQQQRNQT"
FT                   /protein_id="YP_002485935.1"
FT   gene            complement(16079..16831)
FT                   /db_xref="GeneID:7291309"
FT                   /locus_tag="Cyan7425_0019"
FT   CDS_pept        complement(16079..16831)
FT                   /locus_tag="Cyan7425_0019"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ana:alr8562 chromosome partitioning protein, ParA family
FT                   ATPase"
FT                   /db_xref="GI:220910626"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7291309"
FT                   /translation="MLIAIANQKGGVGKTTSTICLGGVLSKSSSCLLIDLDPQGNLSTG
FT                   LGETLADGQLSSYEVITEQAEALDAIVTTKSGLSLLPADITLAKAEPEMLTKVGNFFLL
FT                   RERLEKVTARFEHILIDCPPSLGLLTVNALATADAVLIPVQCQFFALKGLSALQETIQS
FT                   VQKRLHPELKILGVLPTMAEMNTLMTQDVLASLKNRFQDIPVFDPVPKSIRFAESNVAG
FT                   ESIHQYSSEQKLIKPYEAIARMMTGGKP"
FT                   /protein_id="YP_002485936.1"
FT   misc_feature    complement(16103..16831)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Cyan7425_0019"
FT   misc_feature    complement(<16715..16825)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_0019"
FT   misc_feature    complement(16787..16807)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_0019"
FT   misc_feature    complement(16787..16789)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_0019"
FT   misc_feature    complement(16292..>16489)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_0019"
FT   misc_feature    complement(16469..16471)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Cyan7425_0019"
FT   gene            complement(17125..17331)
FT                   /db_xref="GeneID:7291310"
FT                   /locus_tag="Cyan7425_0020"
FT   CDS_pept        complement(17125..17331)
FT                   /locus_tag="Cyan7425_0020"
FT                   /gene_family="HOG000065001" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06150"
FT                   /codon_start="1"
FT                   /product="ChaB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ChaB family protein; KEGG: ftn:FTN_1126 cation
FT                   transport regulator"
FT                   /db_xref="GI:220910627"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="GeneID:7291310"
FT                   /translation="MPYNQLDDLPQSVTEHLPHHAQEIYQAAFNNAWEEYDQDEERAHR
FT                   IAWAAVKHQYIKNESTGYWEAKH"
FT                   /protein_id="YP_002485937.1"
FT   misc_feature    complement(17131..17307)
FT                   /note="ChaB; Region: ChaB; cl01887"
FT                   /db_xref="CDD:186488"
FT                   /locus_tag="Cyan7425_0020"
FT   gene            17518..17859
FT                   /db_xref="GeneID:7291311"
FT                   /locus_tag="Cyan7425_0021"
FT   CDS_pept        17518..17859
FT                   /locus_tag="Cyan7425_0021"
FT                   /gene_family="HOG000069477" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gll3045"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gll3045 unknown protein"
FT                   /db_xref="GI:220910628"
FT                   /db_xref="GeneID:7291311"
FT                   /translation="MSGKTISAYTDTATAERVAALAKLEGRSTAQIGGLALKFFTRLPV
FT                   EARTALHQIELLGEPGDLEAVLRDITRTLLHRQYEIAQRQVVEQMQIEHLEPLETEDDF
FT                   LAAAIRLTQ"
FT                   /protein_id="YP_002485938.1"
FT   gene            17869..18408
FT                   /db_xref="GeneID:7291312"
FT                   /locus_tag="Cyan7425_0022"
FT   CDS_pept        17869..18408
FT                   /locus_tag="Cyan7425_0022"
FT                   /gene_family="HOG000069478" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gll3044"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gll3044 unknown protein"
FT                   /db_xref="GI:220910629"
FT                   /db_xref="GeneID:7291312"
FT                   /translation="MNASLRFCLDLNIWCAALLAERKGRQGTAAQTLVQMVRLGTCPLG
FT                   PVQLVISWGMLNRLRLVLERDLGVIPETADLLIETIGGYAHLGPAGISPQLILGGTGVL
FT                   ALRDQEDAHVLEVAIAGRANLLITANFKDFLSKDTDVVVPEQHAIHNAPGHRFHIVHPY
FT                   LTLDWLRSGTIPPLSA"
FT                   /protein_id="YP_002485939.1"
FT   misc_feature    17881..18306
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_0022"
FT   gene            complement(19132..19557)
FT                   /db_xref="GeneID:7291313"
FT                   /locus_tag="Cyan7425_0023"
FT   CDS_pept        complement(19132..19557)
FT                   /locus_tag="Cyan7425_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910630"
FT                   /db_xref="GeneID:7291313"
FT                   /translation="MGKWRWRGTFLLSIISAIAPLWAQCAEYQGKNIDGLVFSGQAFSY
FT                   SLGGLYSAQVKFEQNDAILKFVNGSQLRLRLDSETITDLSNIQGYVKPPLFSLGLYTPD
FT                   ITDYSPLMRSPSPYAGQWRIDINSPSVNPSLFPAKHE"
FT                   /protein_id="YP_002485940.1"
FT   sig_peptide     complement(19486..19557)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.954 at
FT                   residue 24"
FT                   /locus_tag="Cyan7425_0023"
FT   gene            complement(19835..20587)
FT                   /db_xref="GeneID:7291314"
FT                   /locus_tag="Cyan7425_0024"
FT   CDS_pept        complement(19835..20587)
FT                   /locus_tag="Cyan7425_0024"
FT                   /gene_family="HOG000153217" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:cce_2354"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_2354 hypothetical protein"
FT                   /db_xref="GI:220910631"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="GeneID:7291314"
FT                   /translation="MWYLIARNGVIPRYRLLPRLFQEFIIDQAIASIELTPVEIASYQS
FT                   RIEQQPTSQFPTGDRTLADTLLSPPPDNSLRQYRLEKFKQLTWNRQIESYFLKRKKQLD
FT                   AAVYSLIRTREEGLVHELYFRLEEGEQTFAELAPLYSQGGEAKTQGLVGPVEMGRLHPT
FT                   VAQFLQNSQPGQLFAPVHLGEWWLIIKLEQWLPAQLDSTMHQRLLNELFEQWLQEQLQQ
FT                   VINQSHLTLETFLVPQFQHGFNVQMINS"
FT                   /protein_id="YP_002485941.1"
FT   misc_feature    complement(19988..>20515)
FT                   /note="Parvulin-like peptidyl-prolyl isomerase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: SurA; COG0760"
FT                   /db_xref="CDD:31103"
FT                   /locus_tag="Cyan7425_0024"
FT   misc_feature    complement(20012..>20227)
FT                   /note="PPIC-type PPIASE domain; Region: Rotamase; cl08278"
FT                   /db_xref="CDD:186815"
FT                   /locus_tag="Cyan7425_0024"
FT   gene            complement(20639..23659)
FT                   /db_xref="GeneID:7291315"
FT                   /locus_tag="Cyan7425_0025"
FT   CDS_pept        complement(20639..23659)
FT                   /locus_tag="Cyan7425_0025"
FT                   /gene_family="HOG000222430" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   amr:AM1_6180 Tn3 family transposase"
FT                   /db_xref="GI:220910632"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7291315"
FT                   /translation="MPSSQETAYPRLKSSLSAKELAAIYTPSPEELMLSGQVTRSQASR
FT                   LGFLVLLKTFQRLGYAVPMADVPVTITRHIAMAAGLPPRPDAWSAYDASTSRKRHLTVI
FT                   RQYLNLQVFGQTARQRMNEVMADAARTKHDLVDLINVSIEELVRQRFELPAFSTLLKAS
FT                   RQARNQVTQALYQQVVSSLIQEERRQVNQLFEAEAATHTTPWQRLKQDSGRSTLTHLQV
FT                   LIDRLKWLSSLRLEKAVLQSIPDSKRRHFAAEAQTLGASEMKELPVGKRYTLAITLLNQ
FT                   QYARVLDDLAEMFIKQIQHLHHRSKAALAQYRVEQQPNTDGLIATLRDLVLAYQTEGDI
FT                   PQRFAAISTVVGEHSQALLDQCEAHLTYQGNNHFPLFQKFYKSHRATLFRLLELLPLRS
FT                   STQDDSLIEAVAFIQSQRAGRSSWVATVKKEVTGTSEEQAVPLLDLSWIEGKWWFLVTG
FT                   QRHRTPYPSQVHRRHFEACVFSQVRLELKSGDLYIEGSDAYGDYYSQLITWEDYQASVA
FT                   DYGQLVNLPVEGQAFVNHVQQWLELQTQTTDQAFPANTEVEYKKDRLVIHRRKPQPPKG
FT                   LAKLKALVSERLTPVNLLDVLTDTELWLHWTRSFKPISGYDAKLKQPTARYLATTFCYG
FT                   CNIGPSQTARSLSEFDRRQLADIHHRHIDDLKLHSAIEVVINAYNRFALPAHWGTGKHA
FT                   SVDGTQWDVYEQNLLAEYHIRYGGYGGIGYYHVSDTYIALFSHFIPCGVFEAVYLLDGL
FT                   LKNTSNIQPDIIHGDTHAQSTTVFGLSYLLGITLMPRIRSWQDLKFYRSEPTTRCTHID
FT                   NLFSDSVNWNLIKTHLPDMLRVTLSIKAGKITASTILRKLGTNSSKNKLYQAFQELGYA
FT                   IRTGFLLRYIHDADLRTVIQTATNKSESFNGFLKWLAFGGEGVIATNDRDEQRKLVKYN
FT                   HLVANCLIFYNVFELSRILHELIQEGVKIEPETIAALSPYWTQHINRFGRYSLDMDRCP
FT                   PPIDFGIPVVSQKSSNQ"
FT                   /protein_id="YP_002485942.1"
FT   misc_feature    complement(20717..23659)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Cyan7425_0025"
FT   misc_feature    complement(20798..21706)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Cyan7425_0025"
FT   gene            complement(24176..24433)
FT                   /db_xref="GeneID:7291316"
FT                   /locus_tag="Cyan7425_0026"
FT   CDS_pept        complement(24176..24433)
FT                   /locus_tag="Cyan7425_0026"
FT                   /gene_family="HOG000088073" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_F5308"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_F5308 hypothetical protein"
FT                   /db_xref="GI:220910633"
FT                   /db_xref="GeneID:7291316"
FT                   /translation="MKLSYRGIQYDYQPRQGNTGKPAPAAQAQPYTLTYRGTSYQINPD
FT                   APKPQTVTFPNGYDLIYRGNRYHVPSNQTRQPAAVLAQSL"
FT                   /protein_id="YP_002485943.1"
FT   gene            complement(24838..28479)
FT                   /db_xref="GeneID:7291317"
FT                   /locus_tag="Cyan7425_0027"
FT   CDS_pept        complement(24838..28479)
FT                   /locus_tag="Cyan7425_0027"
FT                   /gene_family="HOG000023052" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /codon_start="1"
FT                   /product="WD-40 repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: WD-40 repeat protein; NB-ARC domain protein;
FT                   KEGG: npu:Npun_F0353 WD-40 repeat-containing protein"
FT                   /db_xref="GI:220910634"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="GeneID:7291317"
FT                   /translation="MEIEQALNLASDLLVQHGLRPLTDVETLILRGAWEQNTYEEIAES
FT                   TGYSDSYLRKDVGPKLWRDLSLVLGEPVSKTNFKAALARQWTHKLQSSTPVAQPITRDY
FT                   YPRCNTDWGEAIDVSIFFGRSQEQETLSQWIFSDRCRFILLLGMGGIGKTALSIKVGQN
FT                   VQSDFEFVIWRSLRNALPALDLLVDVLKFLSQQQDIEVALSVDAAISQLLQYLRSHRCL
FT                   LILDNAEALLQAGDRHCNYRPGYEGYSRLFQQVGETSHLSCLMVTSRERPQDLATKFGQ
FT                   QLPMRCLTISGLSYQDGQALFSSVGQFSGTFPEWQSIIDRYAGNPLALKIVASFITEVF
FT                   AGDLSQLLTFLGQSSCIFDDIRELLDQQFRRLSAQERELMIWLAIKREPVNLTELPEDL
FT                   LHPASPPQLLQVLAALQGRSLIEKINHQFTQQPVLMEYVTSCLIDQITQEICCWQPGTP
FT                   IHSQCLLQQYALIQVQAKDYVRETQIRLILQPVLDQLMHRFGDVAAIERHLQQMLQAMR
FT                   AAPSQARGYAAGNIINMLRQLGVDLSGYSFAQLTVWQADLQGLTLYDVDFSGADLSKSR
FT                   FSQTFGWIVAIAFSPDGEYWAACDSAGSIHLWFYAREQRQTTVKAHENFIFTLAISPDS
FT                   RLLVSGSIDGMVKLWEVRTGQCLYTLNAHAKIVWSVVFSKDGKWFASSCEDGTIKIWDC
FT                   KTGECLQTLRANQSSVRSIAFTSDSRYLVSACEDHQLRLWDLTQGECIRTFEGHSHTVW
FT                   TVDISPDDQYVISGGNDYVVKLWDLQSGRCLQDYEGHTLQIWSVAFSPDGQTIASGSMD
FT                   QTVRLWNIEERQCKACFRGHSSMVMAVAFSADGKTLASGGMDRLIKHWDLSSKACAKTW
FT                   SGFKNIIWSVAFSPEGETIASSSLDGILRIWQVDNSQCIQTMKHPAEVHAIAFSPGGIR
FT                   QSNSGQASPEQSGQRLVSGNMHTKSTLKLWEVQTGSCLMTIPAHIGKVNSVCFNHDGSL
FT                   IASGGDDKNVQIFNLRHQRVEKLLQGHKAVVWSVAFSPNGRLLASGSFDQTVRIWDVRS
FT                   WQCLHILSGHTNALTTIVFHPSLPCIATASSDAMVKLWSLETGQCYHTLSDHHNVVMGI
FT                   AFSPDGQTFTTGSYDKTVRVWDVESWQCQTIFQANSLVHSVAFSPNGQTLVSGGDNGTL
FT                   QLWDLKTRQCIKVIKLPELYAGMNIRGVKGLAEAQESMLLNLGAIAK"
FT                   /protein_id="YP_002485944.1"
FT   misc_feature    complement(<27478..28056)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cyan7425_0027"
FT   misc_feature    complement(25357..26682)
FT                   /note="FOG: WD40 repeat [General function prediction only];
FT                   Region: COG2319"
FT                   /db_xref="CDD:32473"
FT                   /locus_tag="Cyan7425_0027"
FT   misc_feature    complement(25771..26628)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="Cyan7425_0027"
FT   misc_feature    complement(order(25771..25776,25792..25794,25804..25806,
FT                   25858..25863,25897..25902,25918..25920,25933..25935,
FT                   25984..25989,26023..26028,26044..26046,26056..26058,
FT                   26110..26115,26149..26154,26170..26172,26185..26187,
FT                   26236..26238,26275..26280,26296..26298,26311..26313,
FT                   26362..26367,26401..26406,26422..26424,26434..26436,
FT                   26488..26493,26527..26532,26548..26550,26560..26562,
FT                   26614..26616))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="Cyan7425_0027"
FT   misc_feature    complement(24970..25881)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cd00200"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="Cyan7425_0027"
FT   misc_feature    complement(order(24970..24975,24991..24993,25003..25005,
FT                   25057..25062,25093..25098,25114..25116,25129..25131,
FT                   25180..25185,25219..25224,25240..25242,25252..25254,
FT                   25306..25311,25345..25350,25366..25368,25381..25383,
FT                   25432..25434,25471..25476,25492..25494,25507..25509,
FT                   25558..25563,25597..25602,25618..25620,25636..25638,
FT                   25735..25737,25771..25776,25792..25794,25804..25806,
FT                   25858..25860))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="Cyan7425_0027"
FT   gene            29132..30151
FT                   /db_xref="GeneID:7291318"
FT                   /locus_tag="Cyan7425_0028"
FT   CDS_pept        29132..30151
FT                   /locus_tag="Cyan7425_0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sgr:SGR_6526 hypothetical protein"
FT                   /db_xref="GI:220910635"
FT                   /db_xref="GeneID:7291318"
FT                   /translation="MKLKNQENVRDNFMRFQFLRLVTLAPLSLVGLAVPTVHSVRSAGV
FT                   PTGINSPSADLFTPMRGKLAAKDETANLEPVIRQFPPDSTSTTALRSVSVLASNLGNAE
FT                   DVFARITTTAQTFYVTDSTGRRLVRVRTNTSPPQVSSFATNLPTGTLGVTGVGSFFYVT
FT                   HTGGRISRISSTGTVTPFVSGLSRLGRPAALSTGNLVVFETIDDRLLRISLTAKISNIF
FT                   ENDTLSDPIDVVPRGTKYALVDLNKGCLYIATPPSGLSTIACGLGRPESLVPLDTDSYI
FT                   VSDSAGDRLLRVRVSTGRVTTVLRAGVATDPQGLALDRDKNIIVADGSSERLLRVRLR"
FT                   /protein_id="YP_002485945.1"
FT   sig_peptide     29132..29260
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.531 at
FT                   residue 43"
FT                   /locus_tag="Cyan7425_0028"
FT   gene            30209..30334
FT                   /db_xref="GeneID:7291319"
FT                   /locus_tag="Cyan7425_0029"
FT   CDS_pept        30209..30334
FT                   /locus_tag="Cyan7425_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910636"
FT                   /db_xref="GeneID:7291319"
FT                   /translation="MSAQLSFPLQVVNLILYGFADRFVVFAPGSVLEVEGRDITL"
FT                   /protein_id="YP_002485946.1"
FT   gene            30347..30559
FT                   /db_xref="GeneID:7291320"
FT                   /locus_tag="Cyan7425_0030"
FT   CDS_pept        30347..30559
FT                   /locus_tag="Cyan7425_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910637"
FT                   /db_xref="GeneID:7291320"
FT                   /translation="MLEGERDHRLTDLAADVPATGWIESGKVKGKEFRQIWWRGVERDG
FT                   KKTTIYIGKEGSPVHKRAVVAQQAN"
FT                   /protein_id="YP_002485947.1"
FT   gene            30699..30899
FT                   /db_xref="GeneID:7291321"
FT                   /locus_tag="Cyan7425_0031"
FT   CDS_pept        30699..30899
FT                   /locus_tag="Cyan7425_0031"
FT                   /gene_family="HOG000088057" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:asr8513"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:asr8513 unknown protein"
FT                   /db_xref="GI:220910638"
FT                   /db_xref="GeneID:7291321"
FT                   /translation="MKVLALAFAIGTVCVSLSPAEAQVVIKGTKCHPDSPQGFCCPNDG
FT                   RPSGPYCPARPITTNTNTQNQ"
FT                   /protein_id="YP_002485948.1"
FT   sig_peptide     30699..30767
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0031"
FT   gene            31580..32305
FT                   /db_xref="GeneID:7291322"
FT                   /locus_tag="Cyan7425_0032"
FT   CDS_pept        31580..32305
FT                   /locus_tag="Cyan7425_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910639"
FT                   /db_xref="GeneID:7291322"
FT                   /translation="MGINLNNLQGCTTALATGLLTIGLLVVDKQSASATQQLFCDGRMK
FT                   NGWAYTAEFLNGRFTQIRWQRSGQPPQTTNLTFSSTNAQGQPIYTGAFQAATTVTLVDL
FT                   SGGNVQSGSQISVRVEEWGSSVGTCGISTGGNAPPSPPLISQRFFCDGRMKNGWAYTAE
FT                   FSDRRFTLIRWQRSGQPPQTTNLTFSSTNAQGQPIYTGAFQAATTVTLVDLSGGNVRPG
FT                   SEVSIGVEEWGWSRGRCRR"
FT                   /protein_id="YP_002485949.1"
FT   gene            32620..32802
FT                   /db_xref="GeneID:7291323"
FT                   /locus_tag="Cyan7425_0033"
FT                   /pseudo
FT   gene            complement(32840..33361)
FT                   /db_xref="GeneID:7291324"
FT                   /locus_tag="Cyan7425_0034"
FT   CDS_pept        complement(32840..33361)
FT                   /locus_tag="Cyan7425_0034"
FT                   /gene_family="HOG000036700" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:all7668"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all7668 unknown protein"
FT                   /db_xref="GI:220910640"
FT                   /db_xref="GeneID:7291324"
FT                   /translation="MKICNNAALIEWVNQQPLASMVTCLGDGHDGVWNIISHIATAEQR
FT                   LEILDWYHLVENLHKVGGSIKRLNQAEALLWQGQVDAAIALFSDCKRKQAKNFCEYLRH
FT                   HHHRIINYEYFQAEGLYSIGSGAVESAIKQIGRRIQLSGAQWHRQNISQVLAHRCAYLN
FT                   GLIGSPLPVN"
FT                   /protein_id="YP_002485950.1"
FT   gene            complement(33431..35071)
FT                   /db_xref="GeneID:7291325"
FT                   /locus_tag="Cyan7425_0035"
FT   CDS_pept        complement(33431..35071)
FT                   /locus_tag="Cyan7425_0035"
FT                   /gene_family="HOG000121685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /codon_start="1"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: amr:AM1_B0353 transposase"
FT                   /db_xref="GI:220910641"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="GeneID:7291325"
FT                   /translation="MELLQSLLPDPIHLRLESWTLDRAQKQLTLTIRATQSTTPCPLCQ
FT                   GLTQRIHSRYQRTLRDLPCAHYAVKLRLQVRKFFCTNPLCQRRIFTERLPQVTLPWARR
FT                   TVRLAEQFVAIGLALGGAAGVRLSRTLGHPMSLNCLLHLVSQRPLPALAVPKTLGVDDF
FT                   AFRKGQTYGTVLVDLDQHRPIALLPDREANTLAEWLKQHPGVEVLSRDRSRSYKQGMSE
FT                   GAAEAVQVADRFHLLQNLAEVLESFFATQSKALKTVDLAHHRTPEPELEKPTQALIQRQ
FT                   QRAQQRRERRLANYEQVHQLRQQGFSVPDIAHHLAMGERTVFRYLASPEFPEWQPHPRH
FT                   TRKSSLDPYKTYLIEQWNGGQRQTKLLFVQIQQQGYRGSYATVARYTHYLRQVQRQSLN
FT                   VQYGRGQVPPHLSHPRPPLSARRATWLVLKPAKQRSEDQQALLARLHEHPDLTGAIDLV
FT                   QGFAQLVRQRQSEQLDPWLEQATSSSLSLFQRFAKSLQEDYAAVKAGVTLHISNGQVEG
FT                   QINRLKMLKRQMYGRAGLPLLSRRFLLAC"
FT                   /protein_id="YP_002485951.1"
FT   misc_feature    complement(<34334..35050)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="Cyan7425_0035"
FT   misc_feature    complement(34331..34600)
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="Cyan7425_0035"
FT   misc_feature    complement(33434..34564)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="Cyan7425_0035"
FT   gene            35238..36767
FT                   /db_xref="GeneID:7291326"
FT                   /locus_tag="Cyan7425_0036"
FT                   /pseudo
FT   gene            36780..37064
FT                   /db_xref="GeneID:7291327"
FT                   /locus_tag="Cyan7425_0037"
FT   CDS_pept        36780..37064
FT                   /locus_tag="Cyan7425_0037"
FT                   /gene_family="HOG000088152" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08483"
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB ATP binding domain protein; KEGG:
FT                   amr:AM1_B0006 transposase-associated ATP-binding protein,
FT                   putative"
FT                   /db_xref="GI:220910642"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="GeneID:7291327"
FT                   /translation="MNPSTVEQLKALRLSGMLEAWSEQATTPTYHDLSFDERFSLLVER
FT                   EHHRRAQQRLQRRLKQAQLSTTASVSDIDFSVPWGLVKSKVRAMFICGV"
FT                   /protein_id="YP_002485952.1"
FT   misc_feature    36843..36917
FT                   /note="IstB-like ATP binding N-terminal; Region: IstB_N;
FT                   pfam08483"
FT                   /db_xref="CDD:117060"
FT                   /locus_tag="Cyan7425_0037"
FT   gene            37130..38404
FT                   /db_xref="GeneID:7291328"
FT                   /locus_tag="Cyan7425_0038"
FT   CDS_pept        37130..38404
FT                   /locus_tag="Cyan7425_0038"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /codon_start="1"
FT                   /product="transposase mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase mutator type; KEGG: ajs:Ajs_2156
FT                   transposase, mutator type"
FT                   /db_xref="GI:220910643"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:7291328"
FT                   /translation="MSNDNLIAFQAPDPPASFSDALTELVRNGARQIIAQAVEAELQGF
FT                   LAQYESLQDDQGRQAVVRNGYLPERTIVTGVGEVAIQVPKVRDRSGRGIKFNSTLLPPY
FT                   LKRVQSVEEVLPWLYLKGISTGDFSEALASLLGAQAAGLSASTISRLKAKWIKEHQQWQ
FT                   QRSLLGKRYVYLWADGIYFNIRNEDDRQCILVVIGVTNTGSKELLGLEAGFRESELSWK
FT                   PLLLRLQDQGLKQSPELAVGDGALGFWKALAQVFPTTRVQRCWVHKTANVLNHLPKGQQ
FT                   PKAKSALHEIYMAETQAEAQTAFDRFIKTYDAKYPKAVACLSKDREALLAFYDFPAEHW
FT                   VHLRTTNPIESTFATVRLRTDKTRGCVSQESILSLVFKLVQSAQKRWLRIRGFKHLAEV
FT                   IEGVKFKDGLRADQQLDFKDSRNAA"
FT                   /protein_id="YP_002485953.1"
FT   misc_feature    37187..38299
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Cyan7425_0038"
FT   misc_feature    37706..37948
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Cyan7425_0038"
FT   gene            38436..41581
FT                   /db_xref="GeneID:7291329"
FT                   /locus_tag="Cyan7425_0039"
FT                   /pseudo
FT   gene            38788..40338
FT                   /db_xref="GeneID:7291330"
FT                   /locus_tag="Cyan7425_0040"
FT                   /pseudo
FT   gene            40370..41080
FT                   /db_xref="GeneID:7291331"
FT                   /locus_tag="Cyan7425_0041"
FT   CDS_pept        40370..41080
FT                   /locus_tag="Cyan7425_0041"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: amr:AM1_H0075
FT                   transposase-associated ATP-binding protein, putative"
FT                   /db_xref="GI:220910644"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:7291331"
FT                   /translation="MDHLDAIEHQATQQNWSYGQFLLHLCHLEAQRREHVRLQRSLSEA
FT                   QLPAAKSFTNFDFSHCPQFNPAPLMQLAQTTDWLARAQNCILLGPSGVGKTHLAASLAR
FT                   RCIELGKRVKFFAATALVQQLQDAKLQLQLYPLLKKLDRYDLLVLDDLGYVKKNETETS
FT                   VLFELIAHRYERKSLLITANQPFSQWDSIFSDSMMTVAAIDRLVHHGVIIDVQAPSYRK
FT                   AAASQRLTQSAATA"
FT                   /protein_id="YP_002485954.1"
FT   misc_feature    40397..41053
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Cyan7425_0041"
FT   misc_feature    40601..>40708
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0041"
FT   misc_feature    40634..40657
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0041"
FT   misc_feature    40637..40660
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0041"
FT   gene            41593..41760
FT                   /db_xref="GeneID:7291332"
FT                   /locus_tag="Cyan7425_0042"
FT   CDS_pept        41593..41760
FT                   /locus_tag="Cyan7425_0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:alr8066 hypothetical protein"
FT                   /db_xref="GI:220910645"
FT                   /db_xref="GeneID:7291332"
FT                   /translation="MQLRQFDSLQEFCDRAQDYLLQYEAEHNLSLGMLYTLQQNDRKFA
FT                   WSNVSGTGYL"
FT                   /protein_id="YP_002485955.1"
FT   gene            complement(41738..42817)
FT                   /db_xref="GeneID:7291333"
FT                   /locus_tag="Cyan7425_0043"
FT   CDS_pept        complement(41738..42817)
FT                   /locus_tag="Cyan7425_0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr0148 unknown protein"
FT                   /db_xref="GI:220910646"
FT                   /db_xref="GeneID:7291333"
FT                   /translation="MSEPLSPPPPSPSSPQAAPVDRFYQAIGTIQGIILLDEPAKVQIG
FT                   DQVFPIFCPPKLKRKITPDQPQVLRVYPKGHQDGLRFQLSRIPKIFDPTPRFTLNGCWC
FT                   STAGGDRLMIFRNLRSGMKKNWRPVGLPLSWENAPPTDGRFWQIQALLKEGKLVVIHAE
FT                   GPYPPPPRYNPFAPPPTNPQPQSKTRTGSPDIPPPPPLSSEDIRAMATPAKVEVTCKIN
FT                   EVPPHRLVATGVVEFFLADGDRIFTVRLKQKQFKKLAENGFTHWVGAISGQLGAATPTG
FT                   FELNNASLQVFERKPKGQDNANPEQPGQPTEPATAQSTAPPADKVKKDVQQTTATKANH
FT                   LATTRPAQVQGKFKDIQFR"
FT                   /protein_id="YP_002485956.1"
FT   gene            43392..46295
FT                   /db_xref="GeneID:7291334"
FT                   /locus_tag="Cyan7425_0044"
FT   CDS_pept        43392..46295
FT                   /locus_tag="Cyan7425_0044"
FT                   /gene_family="HOG000037237" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_B0281"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0281 hypothetical protein"
FT                   /db_xref="GI:220910647"
FT                   /db_xref="GeneID:7291334"
FT                   /translation="MVLQALQPSASESILDSRLEEFETLTQLEWTIGSAIDPELFHSTV
FT                   TVVADTQVDPYSHEVSYPIHEALNWKITRFGHQARATLCGALILNDDGSVWQVKLSQPR
FT                   LDREKGKSRKYEVPVGTQSRAWFPHQFPIPLWKHIASRWGLTLSRQDIYLGLRTWLIHH
FT                   PELPVIICEGAKKAACLLSLGYVALALPGIFNGYRKGNQGLIPDLAAIALPGRPIYICF
FT                   DHDLKPRTIENVNLATKRLGTFFAQAGCTVRVIALPGPEKGVDDFVVAQGKEAFAALYA
FT                   AAPLLQDWQSHKRWQLTLSPSLKLNRQFLGDLPYPSSGFALIKSPKGTGKTQALQPLIQ
FT                   EATRNGRRVIVITHRIQLGRSICAGLGLDWIEEMHQSETRGLLGFGLCIDSLHPSSQAR
FT                   FNPQDWRGAIVILDELEQIVWHALNSQTCYEKRVLILETLKELIQTVYNSGGLIIGQDA
FT                   DLSDVSVNYLLGLVGAPVVNPWLVVNEWTSQQPCSVSFYHTPDPSPLIIQLSDSIEAGA
FT                   IFVCVDAQKPKSRWGSINLEAYFQQQFPHKRILRIDSETVADPQHPAYGIVERLHTAVR
FT                   DYDLIIATPTIGTGVDLNVQGHFVAVFGIFQGTTPDAEARQALARVRESVPRYIWARPF
FT                   GAGKIGNGSCDYREVARSTTRNLELNLHLLKEIDFDLDRSYDPITLRTWAKMAARVNTS
FT                   LWDFRAELQRGLQAEGHQVTVLQAGECLASTPVKPALMQIQAQHREQEAHQVCSAEEIT
FT                   ATSYQQLKAKRSKSAQERSMERKYALQQRYGVEVTPGLVLKDADGWYPKIRLHYYLLND
FT                   IELVQHRDRQELKGHLERGNQKLALQDIRLLGAQVQALRSLGLPELLAAGREVRGSDAL
FT                   VQQIASLAVGYARDLKTVLNLTFTDAMTPIQIVQTLLSKLGLKLRRLKQERLPDGTRER
FT                   VYQYEAPTDGREAIFSAWAARELEWKERFGTPLYIDF"
FT                   /protein_id="YP_002485957.1"
FT   misc_feature    43893..44165
FT                   /note="Topoisomerase-primase domain. This is a nucleotidyl
FT                   transferase/hydrolase domain found in type IA, type IIA and
FT                   type IIB topoisomerases, bacterial DnaG-type primases,
FT                   small primase-like proteins from bacteria and archaea, OLD
FT                   family nucleases from...; Region: TOPRIM; cl00718"
FT                   /db_xref="CDD:186161"
FT                   /locus_tag="Cyan7425_0044"
FT   misc_feature    <44340..>44465
FT                   /note="bifunctional ATP-dependent DNA helicase/DNA
FT                   polymerase III subunit epsilon; Validated; Region:
FT                   PRK08074"
FT                   /db_xref="CDD:181223"
FT                   /locus_tag="Cyan7425_0044"
FT   gene            46600..47456
FT                   /db_xref="GeneID:7291335"
FT                   /locus_tag="Cyan7425_0045"
FT                   /pseudo
FT   gene            47456..47827
FT                   /db_xref="GeneID:7291336"
FT                   /locus_tag="Cyan7425_0046"
FT   CDS_pept        47456..47827
FT                   /locus_tag="Cyan7425_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_B0113"
FT                   /codon_start="1"
FT                   /product="ParB family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0113 ParB family protein"
FT                   /db_xref="GI:220910648"
FT                   /db_xref="GeneID:7291336"
FT                   /translation="MARPKPIGASQIFAEAGQTQKVHQLSSRVEELEAEIIQLKSQELA
FT                   NQEKIELEAKIEELTQRLSAQGGIQEIEITRIQRNIFQPRQTFPQSELKAFAELLKQEG
FT                   QHTPVILMPWKDTYLIFGN"
FT                   /protein_id="YP_002485958.1"
FT   misc_feature    47666..>47818
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Cyan7425_0046"
FT   gene            complement(47881..49359)
FT                   /db_xref="GeneID:7291337"
FT                   /locus_tag="Cyan7425_0047"
FT   CDS_pept        complement(47881..49359)
FT                   /locus_tag="Cyan7425_0047"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: ava:Ava_C0187
FT                   transposase IS66"
FT                   /db_xref="GI:220910649"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291337"
FT                   /translation="MEPSDAHLAARMAAPEFDPEEMGVRYWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEELKETLRKLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   YGFETVDHRLALSLAQCLVCGNALERDETTPVKRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSAALPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYPIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVESLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYHAGNLTVEQLQTQRLILEAELTDVLDHPPKTGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGQNAVAELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002485959.1"
FT   misc_feature    complement(48439..48948)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0047"
FT   gene            complement(49413..49574)
FT                   /db_xref="GeneID:7291338"
FT                   /locus_tag="Cyan7425_0048"
FT   CDS_pept        complement(49413..49574)
FT                   /locus_tag="Cyan7425_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:glr2490"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr2490 hypothetical protein"
FT                   /db_xref="GI:220910650"
FT                   /db_xref="GeneID:7291338"
FT                   /translation="MATPLQSPLTDIWPSLPVADWQDTNTTLHLWTQIIGKIRLSLAPK
FT                   VNRSWSAQ"
FT                   /protein_id="YP_002485960.1"
FT   gene            complement(49716..50069)
FT                   /db_xref="GeneID:7291339"
FT                   /locus_tag="Cyan7425_0049"
FT   CDS_pept        complement(49716..50069)
FT                   /locus_tag="Cyan7425_0049"
FT                   /gene_family="HOG000087957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00448"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="SMART: response regulator receiver; KEGG:
FT                   xcv:XCV2147 VirG-like two-component system regulatory
FT                   protein"
FT                   /db_xref="GI:220910651"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:7291339"
FT                   /translation="MKVLIVDDSTAGLFISLELESYGCEAKLVRTIAAAKFEIAKNQPD
FT                   FLVTELFLKDENSLDFAEYRHLFPVILANGYKSTLDDEIKNNVDACLEKPFKSLDLIEI
FT                   VNRLLRRDFQPDF"
FT                   /protein_id="YP_002485961.1"
FT   misc_feature    complement(49743..50060)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0049"
FT   misc_feature    complement(order(49785..49790,49797..49799,49896..49898,
FT                   49920..49922,50046..50051))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0049"
FT   misc_feature    complement(49920..49922)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0049"
FT   misc_feature    complement(order(49896..49904,49908..49913))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0049"
FT   misc_feature    complement(49782..49790)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0049"
FT   gene            complement(50133..50342)
FT                   /db_xref="GeneID:7291340"
FT                   /locus_tag="Cyan7425_0050"
FT   CDS_pept        complement(50133..50342)
FT                   /locus_tag="Cyan7425_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910652"
FT                   /db_xref="GeneID:7291340"
FT                   /translation="MGFVYCYHWVTIFKESEDSYLCLVDFPSSSAPIELPETFNSEQAA
FT                   IDGAKIWISNRLGYCYRGQINRTR"
FT                   /protein_id="YP_002485962.1"
FT   gene            50644..50748
FT                   /db_xref="GeneID:7291341"
FT                   /locus_tag="Cyan7425_0051"
FT   CDS_pept        50644..50748
FT                   /locus_tag="Cyan7425_0051"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910653"
FT                   /db_xref="GeneID:7291341"
FT                   /translation="MFLVKTKVLLVDEDFINGTLFSSYLKNMDFKLNR"
FT                   /protein_id="YP_002485963.1"
FT   gene            50799..51032
FT                   /db_xref="GeneID:7291342"
FT                   /locus_tag="Cyan7425_0052"
FT   CDS_pept        50799..51032
FT                   /locus_tag="Cyan7425_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910654"
FT                   /db_xref="GeneID:7291342"
FT                   /translation="MITEVFSEEQHCLGLLEFCKSRQVPVIVLTGYTDPYEQEVQEFVE
FT                   AYYKKPTNPRKILTTLLSLANTSRVSHHLNIA"
FT                   /protein_id="YP_002485964.1"
FT   gene            51210..51383
FT                   /db_xref="GeneID:7291343"
FT                   /locus_tag="Cyan7425_0053"
FT   CDS_pept        51210..51383
FT                   /locus_tag="Cyan7425_0053"
FT                   /gene_family="HOG000087981" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910655"
FT                   /db_xref="GeneID:7291343"
FT                   /translation="MKVPRINLPALILSFTIVGLIADILLALGLRAGGVAQSANWVAAT
FT                   IQAPAIAGVAPR"
FT                   /protein_id="YP_002485965.1"
FT   sig_peptide     51210..51278
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.482 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0053"
FT   gene            complement(51615..51965)
FT                   /db_xref="GeneID:7291344"
FT                   /locus_tag="Cyan7425_0054"
FT   CDS_pept        complement(51615..51965)
FT                   /locus_tag="Cyan7425_0054"
FT                   /gene_family="HOG000035443" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_1361 hypothetical protein"
FT                   /db_xref="GI:220910656"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="GeneID:7291344"
FT                   /translation="MGELVFQKGMKPIGNYLVEAGLLCQAQVETILRDQEYSGLQFGEV
FT                   AVLRGWVKQQTIEFLFNKIVLPEREAFKSCLARKARQAEPQAIQPPCKDTTSIPQKASC
FT                   QKYQDDEIAWVG"
FT                   /protein_id="YP_002485966.1"
FT   misc_feature    complement(<51756..51929)
FT                   /note="chain length determinant protein tyrosine kinase
FT                   EpsG; Region: EpsG; TIGR03029"
FT                   /db_xref="CDD:132074"
FT                   /locus_tag="Cyan7425_0054"
FT   gene            52368..52661
FT                   /db_xref="GeneID:7291345"
FT                   /locus_tag="Cyan7425_0055"
FT   CDS_pept        52368..52661
FT                   /locus_tag="Cyan7425_0055"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910657"
FT                   /db_xref="GeneID:7291345"
FT                   /translation="MIKPWRTAPQTLPTGRRNEEVSRQMRLSEDIAISNLQSLEIPQNC
FT                   LTTWVHLNRVGEQVPEDLAQTVKCQSQSYSHLQPIIKRPVFCRYPNYAPLSI"
FT                   /protein_id="YP_002485967.1"
FT   gene            complement(52667..53263)
FT                   /db_xref="GeneID:7291346"
FT                   /locus_tag="Cyan7425_0056"
FT   CDS_pept        complement(52667..53263)
FT                   /locus_tag="Cyan7425_0056"
FT                   /gene_family="HOG000267483" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ana:alr0810
FT                   transcriptional regulator"
FT                   /db_xref="GI:220910658"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:7291346"
FT                   /translation="MPKEIRQSAKAEQILQGAIQEFLRDGYAATTMARIAATAAVSKET
FT                   LYTYFESKEKLFAAIVQHIAEQHLQQVFASEPLPPDPVEQLRILAAKSIAPENLDPMRM
FT                   NFYRLIVGESGRFPELARFYVEQFEKPGLEVSASLLQAIPQLRGSDPEALAWIISGTLS
FT                   YYYQMTEMLKGKDVMDMTFDRLVETLIELLFGDSN"
FT                   /protein_id="YP_002485968.1"
FT   misc_feature    complement(52685..53263)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cyan7425_0056"
FT   misc_feature    complement(53084..53224)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cyan7425_0056"
FT   misc_feature    complement(<52775..53062)
FT                   /note="formate dehydrogenase accessory protein FdhE;
FT                   Provisional; Region: PRK03564; cl11689"
FT                   /db_xref="CDD:187146"
FT                   /locus_tag="Cyan7425_0056"
FT   gene            53460..54743
FT                   /db_xref="GeneID:7291347"
FT                   /locus_tag="Cyan7425_0057"
FT   CDS_pept        53460..54743
FT                   /locus_tag="Cyan7425_0057"
FT                   /gene_family="HOG000147074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 28"
FT                   /transl_table="11"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   glycosyl transferase family 28; KEGG: rpe:RPE_2215 glycosyl
FT                   transferase, family 28"
FT                   /db_xref="GI:220910659"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="GeneID:7291347"
FT                   /translation="MRITILTTGSRGDVQPLIALGQGLKQAGYRVKIATHDTFQVMVQH
FT                   HGLEFAAIAGDVQALMASEAGQQMLKSKNPIYLIQQYARMVKPLVIQAMMDSWAACQDS
FT                   DAIIFTATAVWGYDIAEAFGIPCFFASLMPQTANPDFPYPSVSPDLQLGRVLNQWSYPL
FT                   LMEAFGTVFRQPLNQFRRSQLQLPPIAFGTIYRRIERTSTPVLYGYSPIVVPKPQNWSD
FT                   HHHVTGYWFLESTTDWQASQALLDFLTAGSPPVYIGFGSMGGGDATQTQMILDALKQTG
FT                   QRGILLTGWGGIAQTNLPDDVLLLNSVPHSWLFPKMAAIVHHGGAGTTAAALRAGVPSV
FT                   VVPFFGDQPFWGDRVMKLGTSPSPIPKAQLTTERLAAAMTTMVTNPVMQQQAKAVGATI
FT                   RAENGVQQAISVIERDLATSKYRFAQCV"
FT                   /protein_id="YP_002485969.1"
FT   misc_feature    53460..54719
FT                   /note="Glycosyl transferases, related to
FT                   UDP-glucuronosyltransferase [Carbohydrate transport and
FT                   metabolism / Signal transduction mechanisms]; Region:
FT                   COG1819"
FT                   /db_xref="CDD:32004"
FT                   /locus_tag="Cyan7425_0057"
FT   misc_feature    53460..54701
FT                   /note="This family includes the Gtfs, a group of homologous
FT                   glycosyltransferases involved in the final stages of the
FT                   biosynthesis of antibiotics vancomycin and related
FT                   chloroeremomycin. Gtfs transfer sugar moieties from an
FT                   activated NDP-sugar donor to the...; Region: GT1_Gtf_like;
FT                   cd03784"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0057"
FT   misc_feature    order(53460..53462,53538..53540,53772..53774,54684..54689,
FT                   54696..54698)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0057"
FT   misc_feature    order(53493..53498,53502..53504,53952..53954,53961..53966,
FT                   53976..53978,54069..54071,54240..54242,54426..54428,
FT                   54432..54434,54438..54443,54450..54452)
FT                   /note="active site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0057"
FT   misc_feature    order(53493..53495,54240..54242,54426..54428,54432..54434,
FT                   54438..54443)
FT                   /note="TDP-binding site; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0057"
FT   misc_feature    53496..53498
FT                   /note="acceptor substrate-binding pocket; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="Cyan7425_0057"
FT   gene            54856..55341
FT                   /db_xref="GeneID:7291348"
FT                   /locus_tag="Cyan7425_0058"
FT                   /pseudo
FT   gene            55371..55841
FT                   /db_xref="GeneID:7291349"
FT                   /locus_tag="Cyan7425_0059"
FT   CDS_pept        55371..55841
FT                   /locus_tag="Cyan7425_0059"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Caur_3138"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cau:Caur_3138 hypothetical protein"
FT                   /db_xref="GI:220910660"
FT                   /db_xref="GeneID:7291349"
FT                   /translation="MSLAHIALDIAIISTGLFTGLLLTMLWIFQPMLDQLSATEYAEWM
FT                   QRFLDVARRSPLNIALMFISLLAPIPALFSFYQTANWLAFGQVLIGVITFFIGMFLVSR
FT                   WFNEPLYDQILGWITEQPPTNWQMARQRWHSLNLIRVCASGSAFLLFLITLS"
FT                   /protein_id="YP_002485970.1"
FT   misc_feature    55449..55835
FT                   /note="Domain of unknown function (DUF1772); Region:
FT                   DUF1772; cl12097"
FT                   /db_xref="CDD:159757"
FT                   /locus_tag="Cyan7425_0059"
FT   gene            55970..56728
FT                   /db_xref="GeneID:7291350"
FT                   /locus_tag="Cyan7425_0060"
FT   CDS_pept        55970..56728
FT                   /locus_tag="Cyan7425_0060"
FT                   /gene_family="HOG000035270" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /codon_start="1"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: sco:SCO1445 hypothetical protein"
FT                   /db_xref="GI:220910661"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:7291350"
FT                   /translation="MNSSKILVTGGTGFLGSQVVDRLQSANCNVQALSHSDRPGTVQAD
FT                   LLTGEGLKQAVAGIDTIIHCASSPTNPRQVDVEGTKRLLQAAEQVGVSHIVYISIVGVD
FT                   RNPFYPYYGMKLETEHIIEQSSIGWTILRATQFHEFVLMLIQSLDRLPVMLMPKGFLLQ
FT                   PIQASEVADRLVELALGAPAGRVADIGGPEVWTAADLARAYFKSTGRKRSVVELPIPGK
FT                   IAQAFRTGAQLCPEQRYGNVGWDEFLNQTL"
FT                   /protein_id="YP_002485971.1"
FT   misc_feature    55982..56704
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="Cyan7425_0060"
FT   misc_feature    55985..>56626
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Cyan7425_0060"
FT   gene            56762..57199
FT                   /db_xref="GeneID:7291351"
FT                   /locus_tag="Cyan7425_0061"
FT   CDS_pept        56762..57199
FT                   /locus_tag="Cyan7425_0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Arth_1829"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_1829 hypothetical protein"
FT                   /db_xref="GI:220910662"
FT                   /db_xref="GeneID:7291351"
FT                   /translation="MNSTSNQQLVRRGWLQCSLWLLAVVPLLIGFWAFFAPHHFYEIFP
FT                   LPGRHWISTLGPYNEHLVQDYGASNLGFGVLLTVAAVLLEQQLVQIALVSWLAFAVPHF
FT                   IFHLTQTHHFSQFDNVTQLGSLGFVALLPISLLFYMTKQKE"
FT                   /protein_id="YP_002485972.1"
FT   gene            complement(57341..57589)
FT                   /db_xref="GeneID:7291352"
FT                   /locus_tag="Cyan7425_0062"
FT                   /pseudo
FT   gene            complement(57628..58833)
FT                   /db_xref="GeneID:7291353"
FT                   /locus_tag="Cyan7425_0063"
FT   CDS_pept        complement(57628..58833)
FT                   /locus_tag="Cyan7425_0063"
FT                   /gene_family="HOG000219186" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: amr:AM1_A0301
FT                   acyl-CoA dehydrogenase, putative"
FT                   /db_xref="GI:220910663"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:7291353"
FT                   /translation="MLLTDQITQDLKYSRLKNYREIATALSNQLATTAVERDLIAGLPN
FT                   DEVQQIRQSGLLPLVVPREYGGIGARWIDAFWTIRELAKADGSIGQLVANHMVLSVLAH
FT                   VIGTPAQAERYYRATAQHHLFWGNALNARDSRLRIEPEGNHYRVNGVKSFGTGVAVADM
FT                   RVFAAIQEGIDFPIVFVIPKEREGVTYNNDWNNMGQRRTASGSFTFQNVLVMPDEILGP
FT                   PSNPHGAFVTFLFVVNQLAKTQVYLGIAQAAFESARAYTVTTARPWLTSGVDSATKDPY
FT                   TLHHYGDLWMELNAAIALTDQAAQRVQAAWEKGDDLSHEERGEIAINVYAAKALATRFG
FT                   LDITTRIFEVNGARATAAKYGFDRYWRDLRTFTLHDPVDYKLRDIGNWVLNQDLPIVTQ
FT                   YS"
FT                   /protein_id="YP_002485973.1"
FT   misc_feature    complement(57649..58776)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Cyan7425_0063"
FT   misc_feature    complement(57649..58773)
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="Cyan7425_0063"
FT   misc_feature    complement(order(58366..58368,58372..58374))
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="Cyan7425_0063"
FT   gene            complement(58902..59888)
FT                   /db_xref="GeneID:7291354"
FT                   /locus_tag="Cyan7425_0064"
FT   CDS_pept        complement(58902..59888)
FT                   /locus_tag="Cyan7425_0064"
FT                   /gene_family="HOG000179103" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /codon_start="1"
FT                   /product="homocysteine S-methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   amr:AM1_0903 homocysteine S-methyltransferase, putative"
FT                   /db_xref="GI:220910664"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="GeneID:7291354"
FT                   /translation="MAQYRNNLPQLSSDLFITDGGIETTLIFREGLELPEFAAFDLFKS
FT                   ASGYQALQKYFRTYARMASTYAVGCILESATWRANPDWGTKLGYDRDALTAVNGQAIAL
FT                   LHEIRHEFETEQSRLVISGCLGPRGDGYIPADAMSETEAEFYHRPQIETFRQAGADLVT
FT                   AITMNYVEEAIGIARGAKTVGIPVVISFTVETDGKLPTGQPLKEAIAQVDKATDAAPAY
FT                   YMLNCAHPTHFMDELRTGETWVERIRGIRANASTKSHAELNESETLDEGNPAELGSLYQ
FT                   QLREHLPHLNVLGGCCGTDDRHIEAICKACSPVLWSYLSNRFFSVAI"
FT                   /protein_id="YP_002485974.1"
FT   misc_feature    complement(58959..59849)
FT                   /note="Homocysteine/selenocysteine methylase
FT                   (S-methylmethionine-dependent) [Amino acid transport and
FT                   metabolism]; Region: MHT1; cl14105"
FT                   /db_xref="CDD:187229"
FT                   /locus_tag="Cyan7425_0064"
FT   misc_feature    complement(58950..59840)
FT                   /note="Homocysteine S-methyltransferase; Region:
FT                   S-methyl_trans; pfam02574"
FT                   /db_xref="CDD:111469"
FT                   /locus_tag="Cyan7425_0064"
FT   gene            complement(59930..60256)
FT                   /db_xref="GeneID:7291355"
FT                   /locus_tag="Cyan7425_0065"
FT   CDS_pept        complement(59930..60256)
FT                   /locus_tag="Cyan7425_0065"
FT                   /gene_family="HOG000087938" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyb:CYB_2135 hypothetical protein"
FT                   /db_xref="GI:220910665"
FT                   /db_xref="GeneID:7291355"
FT                   /translation="MNISLHETRPTTFPVAKHSSPSWLSRIWQWLKDALFEQTELQLLL
FT                   KRDRYGHLWWYAYDPVTGRVGWLSSEDEVRAWIEERYERQDSYPRLKQTYFNQQLTGFF
FT                   HSDR"
FT                   /protein_id="YP_002485975.1"
FT   gene            complement(60237..60416)
FT                   /db_xref="GeneID:7291356"
FT                   /locus_tag="Cyan7425_0066"
FT   CDS_pept        complement(60237..60416)
FT                   /locus_tag="Cyan7425_0066"
FT                   /gene_family="HOG000087939" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910666"
FT                   /db_xref="GeneID:7291356"
FT                   /translation="MKVERKTNVQALALAAGLCITLIINHSELTQSQALGNLSRRQEFN
FT                   WPIIEATVNEHISA"
FT                   /protein_id="YP_002485976.1"
FT   sig_peptide     complement(60324..60416)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.473 at
FT                   residue 31"
FT                   /locus_tag="Cyan7425_0066"
FT   gene            60695..62155
FT                   /db_xref="GeneID:7291357"
FT                   /locus_tag="Cyan7425_0067"
FT   CDS_pept        60695..62155
FT                   /locus_tag="Cyan7425_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: npu:Npun_F5035 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="GI:220910667"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:7291357"
FT                   /translation="MAQDLIPSSYQYSQQAEEALRLIVQGTPCEHVASGKKVFFYPHSI
FT                   RDLCPDDPYLEEFGAESYLGIPLSNSAGEMLGYLAVLDIKPMQPDPGLCISTSLISGVE
FT                   GDYHALAVMQDITQRKHTELAMQQAKEAAEAANQAKSAFLAHMSHELRTPLNAILGFAQ
FT                   LMERDTLLTTAQKESLSIINRSGEHLLEHHLFEPFVQTTTGANAQEGTGLGLTISHQFV
FT                   QLLGGELWVESEVNRGSTFSFDLPVELPYGAIAHIPVPTGRVVGLVSGQPDYRILVVDD
FT                   RAENREPLVQLLSSVGFSTRTATNGWEAIAQWQDWQPDLIWMDMRMPALDGYAATAQIK
FT                   AQSQGAKTVIIALTAAAFEEQQQQIFAAGCDDFVRKPFHEDVIFAKMGEHLQVRYLYAE
FT                   DQSDHRDPAHSKAAQGPSPDLLGVMSSDWIEQLHRAAIAADGGQIEQLLTQIPASHAEL
FT                   ADRLTGWLSEFDFDPILELIESLKGARD"
FT                   /protein_id="YP_002485977.1"
FT   misc_feature    <60971..>61246
FT                   /note="sensory histidine kinase AtoS; Provisional; Region:
FT                   PRK11360"
FT                   /db_xref="CDD:183098"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    61121..61267
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    order(61121..61123,61133..61135,61145..61147,61154..61156,
FT                   61166..61168,61175..61177,61226..61228,61238..61240,
FT                   61247..61249,61259..61261)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    61139..61141
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    <61268..61429
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    order(61328..61339,61385..61387,61391..61393,61406..61411,
FT                   61415..61417)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    order(61328..61330,61334..61336)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    61523..61867
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    order(61532..61537,61664..61666,61688..61690,61754..61756,
FT                   61811..61813,61820..61825)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    61664..61666
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    order(61673..61678,61682..61690)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0067"
FT   misc_feature    61820..61828
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0067"
FT   gene            62155..63615
FT                   /db_xref="GeneID:7291358"
FT                   /locus_tag="Cyan7425_0068"
FT   CDS_pept        62155..63615
FT                   /locus_tag="Cyan7425_0068"
FT                   /gene_family="HOG000088154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ter:Tery_4188 extracellular solute-binding protein"
FT                   /db_xref="GI:220910668"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:7291358"
FT                   /translation="MAVLPPFPQPTPFKSVLLQAKRQQRRWQRGTYLIGLIMSVVMVGC
FT                   TAETPRRLTTSTPTAATKLLTIWWDKGFTLEEDEALRQVVKNWEQQTGQQAKLDFFTTD
FT                   ELPKKAQRALQAGNPPDIMMSHGAEQTLNPRLAWEGQLADVSDVIEPIRDLYPDTILKS
FT                   AYLYNRVADRKSYYAIPIHQATTQIFYWRDLVKKAGKTEKDIPEDWDRFWQFWQQVQNE
FT                   LRQQQPAKIYGLGLPTSAVARDTYETFEQILEAYDVQILDDQGQLRVDDPQVRQGIIRC
FT                   LDWYAQLYRQGYVPPGAIKWLNPDNNRSLLNREIVMTPNNSLSIPAAVKDDPELYQRKL
FT                   GTIGYPNKPNGQPMRYIVIVRQAVIFTTSKHQDQARSFLRYLLQPAVYGQYLKAAGRNL
FT                   PVLKSVWNDPFWTDPKDPHRSTVALNLKNHQTRLYYYVQNPAYSLVSQDRIWGKALKRI
FT                   VIENESPEQATDEAIAQIKLIFKQWPSN"
FT                   /protein_id="YP_002485978.1"
FT   misc_feature    62251..63603
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="Cyan7425_0068"
FT   misc_feature    62374..63315
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Cyan7425_0068"
FT   gene            complement(63680..64336)
FT                   /db_xref="GeneID:7291359"
FT                   /locus_tag="Cyan7425_0069"
FT   CDS_pept        complement(63680..64336)
FT                   /locus_tag="Cyan7425_0069"
FT                   /gene_family="HOG000125755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ana:all1745 glutathione transferase"
FT                   /db_xref="GI:220910669"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="GeneID:7291359"
FT                   /translation="MLKFYYNQVSLNTRRVWVALLEKQIQFQPLEVNLNGEQFSQEFTE
FT                   INPLQQIPVIEDNELRVIDSLAILDYLEAKYPHPSLIPVKPVAIAMVRMVEMITVNELQ
FT                   PAMLPFTRQLLGLDVEPDKLNAAHHRVMTVIQMFENFLDGKRYFVDDKITLADIVAGTL
FT                   VPSLALFGFALEPYPHLKTWLEHLNLRASWQQTTPKPEVIEAALPAIRKILERRS"
FT                   /protein_id="YP_002485979.1"
FT   misc_feature    complement(63743..64333)
FT                   /note="Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: Gst;
FT                   COG0625"
FT                   /db_xref="CDD:30970"
FT                   /locus_tag="Cyan7425_0069"
FT   misc_feature    complement(64109..64333)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Cyan7425_0069"
FT   misc_feature    complement(63776..64066)
FT                   /note="Glutathione S-transferase (GST) family, C-terminal
FT                   alpha helical domain; a large, diverse group of cytosolic
FT                   dimeric proteins involved in cellular detoxification by
FT                   catalyzing the conjugation of  glutathione (GSH) with a
FT                   wide range of endogenous and...; Region: GST_C_family;
FT                   cd00299"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="Cyan7425_0069"
FT   misc_feature    complement(order(63839..63841,63851..63853,63860..63865,
FT                   63872..63874,64040..64042,64061..64063))
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="Cyan7425_0069"
FT   misc_feature    complement(order(63926..63928,64049..64051,64058..64063))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="Cyan7425_0069"
FT   misc_feature    complement(order(63839..63841,63848..63850,64013..64018,
FT                   64025..64030,64040..64042))
FT                   /note="substrate binding pocket (H-site); other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="Cyan7425_0069"
FT   gene            complement(64376..64543)
FT                   /db_xref="GeneID:7291360"
FT                   /locus_tag="Cyan7425_0070"
FT   CDS_pept        complement(64376..64543)
FT                   /locus_tag="Cyan7425_0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910670"
FT                   /db_xref="GeneID:7291360"
FT                   /translation="MIFYQLPTQGANQMSDSDRKAIIRELKHRLYYSNPGPEREAIRRQ
FT                   LDFWLNFQRT"
FT                   /protein_id="YP_002485980.1"
FT   gene            complement(64653..64826)
FT                   /db_xref="GeneID:7291361"
FT                   /locus_tag="Cyan7425_0071"
FT   CDS_pept        complement(64653..64826)
FT                   /locus_tag="Cyan7425_0071"
FT                   /gene_family="HOG000087944" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_2559"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_2559 hypothetical protein"
FT                   /db_xref="GI:220910671"
FT                   /db_xref="GeneID:7291361"
FT                   /translation="MQLSYRGAPYEVRKPGVDMPEVEYSARYRGIAYRINCPIYLTFTQ
FT                   LFLGLRYRGIRY"
FT                   /protein_id="YP_002485981.1"
FT   gene            65037..67469
FT                   /db_xref="GeneID:7291362"
FT                   /locus_tag="Cyan7425_0072"
FT   CDS_pept        65037..67469
FT                   /locus_tag="Cyan7425_0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /codon_start="1"
FT                   /EC_number="2.7.13.3"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: npu:Npun_F5035 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="GI:220910672"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:7291362"
FT                   /translation="MKLWYQPLTDKVASTFLLLSLVAVAAVSGITFVQAREALKQAAFD
FT                   RLEVTADLKEEEIKRWFEDQQQDFLLISQSPDVQRNLKILLNPALPAREHEAAAALLSK
FT                   YWQRAVQLKPSLREIFVINRSNRVLLSTHQQHNGEYVILANVTYFDAVESGNSFAPIFY
FT                   VSPETGKPAVTFATPIRDQAGVRQGVVLAHLNLNRIDQIVRERAGLGRSGETYLVGSLV
FT                   SKNTFISGKPSGQQGEAGVSSQGIDAAMSGISGSDLYQNYADVPVIGVFRWLNDQDIAL
FT                   LVEMKQWEAFAPARQLAITVVLVGLISVALLSICVYWLAKQLSLSRLQLENSSRQLEQK
FT                   AQEAEAANHAKSAFLAHMSHELRTPLNAILGFAQVMERDPLLTHQQQESLAIINRSGEH
FT                   LLGLINDVLEMSKIEAGQIVLHPGAFDLHELLQTLRDMFQGRAEAKQLALNVNLAADLP
FT                   RYVISDEGKLRQVLINLLSNAVKFTDQGTVTLEAAYQHHTGANYLTFAVADTGRGIAPE
FT                   EQEHLFQPFFQSAAGLKTEEGTGLGLSISRQFVDLMGGQISANSQLGQGTVFKFEIKVE
FT                   LAAPVVSDRPVSGRVIGLGPGQSEYRILVVDDRQENRDPLIVLLNAVGFQTQTASNGKE
FT                   AIERWQTWHPQLIWMDMLMPVMDGYTATRTIKSQPGGKDTVIIALTATAFEEQQAQILA
FT                   AGCDDFVRKPFREEVIFEKMAAHLGVEYVYASPLPIATQSKTEAALLLAPETLQVMPSD
FT                   WLARLHQAAIQADAELMAQLLSEVPLEQSQLAQSIALLAEAYRFDEIIDLTRPTSRT"
FT                   /product="histidine kinase"
FT                   /protein_id="YP_002485982.1"
FT   sig_peptide     65037..65144
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.655 at
FT                   residue 36"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    <65526..>65846
FT                   /note="L-serine deaminase [Amino acid transport and
FT                   metabolism]; Region: SdaA; COG1760"
FT                   /db_xref="CDD:31946"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66096..66272
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    order(66096..66098,66108..66110,66120..66122,66129..66131,
FT                   66141..66143,66150..66152,66201..66203,66213..66215,
FT                   66222..66224,66234..66236,66243..66245,66255..66257)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66114..66116
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66438..66755
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    order(66456..66458,66468..66470,66477..66479,66555..66557,
FT                   66561..66563,66567..66569,66573..66578,66654..66665,
FT                   66711..66713,66717..66719,66732..66737,66741..66743)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66468..66470
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    order(66567..66569,66573..66575,66654..66656,66660..66662)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66846..67190
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    order(66855..66860,66987..66989,67011..67013,67077..67079,
FT                   67134..67136,67143..67148)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    66987..66989
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    order(66996..67001,67005..67013)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0072"
FT   misc_feature    67143..67151
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0072"
FT   gene            complement(67597..67800)
FT                   /db_xref="GeneID:7291363"
FT                   /locus_tag="Cyan7425_0073"
FT                   /pseudo
FT   gene            67799..68536
FT                   /db_xref="GeneID:7291364"
FT                   /locus_tag="Cyan7425_0074"
FT                   /pseudo
FT   gene            complement(68605..69405)
FT                   /db_xref="GeneID:7291365"
FT                   /locus_tag="Cyan7425_0075"
FT   CDS_pept        complement(68605..69405)
FT                   /locus_tag="Cyan7425_0075"
FT                   /gene_family="HOG000023289" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   amr:AM1_F0037 hypothetical protein"
FT                   /db_xref="GI:220910673"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:7291365"
FT                   /translation="MPKRRTTAELLDAAHLAGAAIQAQDRAAEARNELEQSRSSTLPLA
FT                   KILNRTQDTRELSDQHVNELAESIIILGLLEPLVVDNRGRLLAGGHRRAAIAAVKEMNP
FT                   EAYTTHFPNDLIPVRVVDFDAEENPDLALQVEVTENEKRRDYTPNEVKALAERLRNAGF
FT                   VDLKGRPAKGEKALRPALEVIIGKSIRTVRRYLNESPEESVTDVRLLGEADNDATITSL
FT                   RRLKTELNRWQRAHPEPDIAELQTINKDIARLLKHVEAALKKVN"
FT                   /protein_id="YP_002485983.1"
FT   gene            complement(69413..70144)
FT                   /db_xref="GeneID:7291366"
FT                   /locus_tag="Cyan7425_0076"
FT   CDS_pept        complement(69413..70144)
FT                   /locus_tag="Cyan7425_0076"
FT                   /gene_family="HOG000023288" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   amr:AM1_F0036 CobQ/CobB/MinD/ParA domain-containing
FT                   protein"
FT                   /db_xref="GI:220910674"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7291366"
FT                   /translation="MIQYRVAVAARKGGVGKTTIACGIASVLAKKGNKVLVIDLDPQSN
FT                   AAYALGVDPTAPGTAELLMGSNPKPLEAAPGLFVLAGGPNLTNQIIQSLHPEDLADAVK
FT                   DMAYTAIILDCPPGNETLERLGLVASHSTLVVTNAHPFAILGANRVIGVLESYRSRERR
FT                   GPKQWALVLSQIDERRALDKELPIQLALSYPNIKHFIVHQDTNLSQAGAQQIPLMDYAP
FT                   RSRSAQELAVLSEWIIETAHD"
FT                   /protein_id="YP_002485984.1"
FT   misc_feature    complement(69428..70135)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Cyan7425_0076"
FT   misc_feature    complement(<69674..70111)
FT                   /note="ArsA ATPase functionas as an efflux pump located on
FT                   the inner membrane of the cell. This ATP-driven oxyanion
FT                   pump catalyzes the extrusion of arsenite, antimonite and
FT                   arsenate. Maintenance of a low intracellular concentration
FT                   of oxyanion produces...; Region: ArsA; cd02035"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0076"
FT   misc_feature    complement(70088..70111)
FT                   /note="P loop; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0076"
FT   misc_feature    complement(order(69803..69805,70022..70024,70088..70099,
FT                   70103..70105))
FT                   /note="Nucleotide binding site; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0076"
FT   misc_feature    complement(order(69782..69805,70016..70024))
FT                   /note="DTAP/Switch II; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0076"
FT   misc_feature    complement(70016..70024)
FT                   /note="Switch I; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0076"
FT   gene            70512..70940
FT                   /db_xref="GeneID:7291367"
FT                   /locus_tag="Cyan7425_0077"
FT   CDS_pept        70512..70940
FT                   /locus_tag="Cyan7425_0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910675"
FT                   /db_xref="GeneID:7291367"
FT                   /translation="MRYWVQYHSYEKMGGLPSGPSETVSNCKIVTDKDIVLDTISDTVF
FT                   LIVGVSENPKQYLLWERFICDDVADDGVPPWKYSATGKGWVLMQRRGREPLLNHEPGFR
FT                   EYLSYTGNFSRGFHEVTDHPFLEVLLRLSERCKPPSKN"
FT                   /protein_id="YP_002485985.1"
FT   gene            71811..74699
FT                   /db_xref="GeneID:7291368"
FT                   /locus_tag="Cyan7425_0078"
FT   CDS_pept        71811..74699
FT                   /locus_tag="Cyan7425_0078"
FT                   /gene_family="HOG000037237" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_B0281"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0281 hypothetical protein"
FT                   /db_xref="GI:220910676"
FT                   /db_xref="GeneID:7291368"
FT                   /translation="MVLQTLSPDCITDSSLEGFATRTRLEWTVGSAIDLELFGATVQVV
FT                   SDTEVDPYSREVSYPIHEALNWKVTRFGQQARATLFGALILNDDGTVWQVKLNQPRVDQ
FT                   ERGKSRKYEVPVGTQSRAWLPHQFPLTLWQRIANRYGLKLSEADLSLGFRAWLIQHPEI
FT                   AITICEGAKKAACLLSLGYAAIALPGIFNGYRKNNQGLIPDLAAIAVPGRPISICFDHD
FT                   LKPRTIENVNLATKRLGMLFLESGCTVRVIPLPGPEKGVDDFVVAQGAEAFAQLHENAP
FT                   LLQQWNSQKLWELTLQPTHKLNQPYLGNLPYPSSGFAFIKSPKGTGKTQALQSLIREAT
FT                   RNGRRVIVITHRIQLGRSICAGLGIDWIEEMHQSETRGLLGFGLCIDSLHASSQARFNP
FT                   QDWRGAILILDELEQIIWHALNSQTCFEKRVLILETLKELIQTVYNSDGLIIGQDADLS
FT                   DVSVNYLMGLVESPILHPWLVVNEWRSLQPCPVSFYHTPDPAPLIAQLEALLETGAVFL
FT                   CVDAQKPKSRWGSINLEAYFKQKFPQKRILRIDSETVADPQHPACGIVERLNTAALHYD
FT                   LIIATPTIGTGVDLNVQGHFVAVFGIFQGTTPDAEARQALARVREPVPRYVWARSFGAS
FT                   KIGNGSCDYREVARSTTRNLELNLHLLKDIDFDLDQSYDPITLRTWAKMAARVNASLWN
FT                   FREELQRGLQSEGNQVTILQPGECLSSAPIKPALIQIQTHHQEQEAHQIAAAEDISESD
FT                   YQQLKAKRSKSAPERARERKFALKQRYGVEVTPDLVLKDADGWYAQIRLHYYLLNEIEL
FT                   VQQRDRQEFKGHLERGNQKLALQDVRLLGAQVETLRSLGIAQLLLAGQEIRGSDSRIQH
FT                   LAALTVEYARDLKTVLNLTFTEAMTPIQIVQALLSKLGLKLKRLRQERLPDGTRERVYQ
FT                   YQSPTDGRETVFRSWKARDEAWAISLGTPLCT"
FT                   /protein_id="YP_002485986.1"
FT   misc_feature    <72453..72725
FT                   /note="DNA primase, catalytic core; Region: dnaG;
FT                   TIGR01391"
FT                   /db_xref="CDD:162334"
FT                   /locus_tag="Cyan7425_0078"
FT   misc_feature    <72717..>73157
FT                   /note="Type IV secretory pathway, VirB4 components
FT                   [Intracellular trafficking and secretion]; Region: VirB4;
FT                   COG3451"
FT                   /db_xref="CDD:33254"
FT                   /locus_tag="Cyan7425_0078"
FT   misc_feature    72777..>72863
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Cyan7425_0078"
FT   gene            75399..78419
FT                   /db_xref="GeneID:7291369"
FT                   /locus_tag="Cyan7425_0079"
FT   CDS_pept        75399..78419
FT                   /locus_tag="Cyan7425_0079"
FT                   /gene_family="HOG000222430" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   amr:AM1_6180 Tn3 family transposase"
FT                   /db_xref="GI:220910677"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7291369"
FT                   /translation="MPSSQETAYPRLKSSLSAKELAAIYTPSPEELMLSGQVTRSQASR
FT                   LGFLVLLKTFQRLGYAVPMADVPVTITRHIAMAAGLPPRPDAWSAYDASTSRKRHLTVI
FT                   RQYLNLQVFGQTARQRMNEVMADAARTKHDLVDLINVSIEELVRQRFELPAFSTLLKAS
FT                   RQARNQVTQALYQQVVSSLIQEERRQVNQLFEAEAATHTTPWQRLKQDSGRSTLTHLQV
FT                   LIDRLKWLSSLRLEKAVLQSIPDSKRRHFAAEAQTLGASEMKELPVGKRYTLAITLLNQ
FT                   QYARVLDDLAEMFIKQIQHLHHRSKAALAQYRVEQQPNTDGLIATLRDLVLAYQTEGDI
FT                   PQRFAAISTVVGEHSQALLDQCEAHLTYQGNNHFPLFQKFYKSHRATLFRLLELLPLRS
FT                   STQDDSLIEAVAFIQSQRAGRSSWVATVKKEVTGTSEEQAVPLLDLSWIEGKWWFLVTG
FT                   QRHRTPYPSQVHRRHFEACVFSQVRLELKSGDLYIEGSDAYGDYYSQLITWEDYQASVA
FT                   DYGQLVNLPVEGQAFVNHVQQWLELQTQTTDQAFPANTEVEYKKDRLVIHRRKPQPPKG
FT                   LAKLKALVSERLTPVNLLDVLTDTELWLHWTRSFKPISGYDAKLKQPTARYLATTFCYG
FT                   CNIGPSQTARSLSEFDRRQLADIHHRHIDDLKLHSAIEVVINAYNRFALPAHWGTGKHA
FT                   SVDGTQWDVYEQNLLAEYHIRYGGYGGIGYYHVSDTYIALFSHFIPCGVFEAVYLLDGL
FT                   LKNTSNIQPDIIHGDTHAQSTTVFGLSYLLGITLMPRIRSWQDLKFYRSEPTTRCTHID
FT                   NLFSDSVNWNLIKTHLPDMLRVTLSIKAGKITASTILRKLGTNSSKNKLYQAFQELGYA
FT                   IRTGFLLRYIHDADLRTVIQTATNKSESFNGFLKWLAFGGEGVIATNDRDEQRKLVKYN
FT                   HLVANCLIFYNVFELSRILHELIQEGVKIEPETIAALSPYWTQHINRFGRYSLDMDRCP
FT                   PPIDFGIPVVSQKSSNQ"
FT                   /protein_id="YP_002485987.1"
FT   misc_feature    75399..78341
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Cyan7425_0079"
FT   misc_feature    77352..78260
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Cyan7425_0079"
FT   gene            78473..78727
FT                   /db_xref="GeneID:7291370"
FT                   /locus_tag="Cyan7425_0080"
FT                   /pseudo
FT   gene            79193..80440
FT                   /db_xref="GeneID:7291371"
FT                   /locus_tag="Cyan7425_0081"
FT   CDS_pept        79193..80440
FT                   /locus_tag="Cyan7425_0081"
FT                   /gene_family="HOG000072820" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01142"
FT                   /codon_start="1"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylglycinamide formyltransferase
FT                   2; PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; KEGG: amr:AM1_0769
FT                   phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="GI:220910678"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:7291371"
FT                   /translation="MANLSPWGTSLTSTAQRLLLLGSGELGKEVAIEAMRLGLEVIAVD
FT                   SYVNAPAMQVAHRSHVINMLDGVQVRRIVEQEQPGLIVPEVEAIATATLVELEQEGWRV
FT                   VPTAKATQLTMNREGIRRLAAEELGLKTSPYRFAETEAEYQQAIAELGFPCVVKPVMSS
FT                   SGKGQSTLRSEADIQPAWEYAQAGGRTKGGRVIVEGFVPFDTEITLLTVCSASGTHFCP
FT                   PIGHIQISGDYRESWQPCALHPQTLEQCQEIAEKITTALGGWGIFGVELFIQGTSEIEQ
FT                   TVYFSEVSPRPHDTGMVTLISQNMSEFELHVRATTGLPIGEITLIQPGASAVILANVVG
FT                   DNPRFTGICEALQVPTSKVRLFGKPRAYRNRRMGVALALGDTVEQARERAKASAATVTV
FT                   LVDDAGEVDPKNWTRG"
FT                   /protein_id="YP_002485988.1"
FT   misc_feature    79214..80389
FT                   /note="phosphoribosylglycinamide formyltransferase 2;
FT                   Validated; Region: purT; PRK09288"
FT                   /db_xref="CDD:181759"
FT                   /locus_tag="Cyan7425_0081"
FT   misc_feature    79565..80101
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Cyan7425_0081"
FT   gene            80726..81878
FT                   /db_xref="GeneID:7291372"
FT                   /locus_tag="Cyan7425_0082"
FT                   /pseudo
FT   gene            complement(82197..83363)
FT                   /db_xref="GeneID:7291373"
FT                   /locus_tag="Cyan7425_0083"
FT   CDS_pept        complement(82197..83363)
FT                   /locus_tag="Cyan7425_0083"
FT                   /gene_family="HOG000042098" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cyt:cce_5138 transposase"
FT                   /db_xref="GI:220910679"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7291373"
FT                   /translation="MPPTVNRESLSACLEQYFGEITDPRVERTRAHQLLDIIAIALFAV
FT                   LAGADSWVGIETYGQAKRAWLETFLALPNGIPSHDTFARVFARLDPEALETRFQHWVKG
FT                   VVSTLGAQVIAIDGKTAKGSYDREGGVKALQLVSAWASEHRLVLGQCAVDTKSNEITAI
FT                   PVLLEQLALAGCIVSIDAMGTHQTIAAQIHKQQADYILALKGNQPTLFKQAQQWFEEFQ
FT                   TGSNAGAEYTQHQQCETAHHRIESRRVFQVPVEQVFTPKQGRDWAGLRSLVVIQSQRCL
FT                   WNKDTTETRYFLSSLSTDAATFAHYIRAHWGIENQLHWCLDVVFNEDKSRIRKDHAPRN
FT                   FSLLRRLTLNLLHRDSSKGSLVMKRYRAGLDDQFMMQLLTPLLLLDEA"
FT                   /protein_id="YP_002485989.1"
FT   misc_feature    complement(82620..83039)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Cyan7425_0083"
FT   misc_feature    complement(<82743..82919)
FT                   /note="Transposase [DNA replication, recombination, and
FT                   repair]; Region: COG5433"
FT                   /db_xref="CDD:34992"
FT                   /locus_tag="Cyan7425_0083"
FT   misc_feature    complement(82338..>82514)
FT                   /note="Transposase [DNA replication, recombination, and
FT                   repair]; Region: COG5433"
FT                   /db_xref="CDD:34992"
FT                   /locus_tag="Cyan7425_0083"
FT   gene            complement(83593..86822)
FT                   /db_xref="GeneID:7291374"
FT                   /locus_tag="Cyan7425_0084"
FT                   /pseudo
FT   gene            complement(83966..84676)
FT                   /db_xref="GeneID:7291375"
FT                   /locus_tag="Cyan7425_0085"
FT   CDS_pept        complement(83966..84676)
FT                   /locus_tag="Cyan7425_0085"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: amr:AM1_H0075
FT                   transposase-associated ATP-binding protein, putative"
FT                   /db_xref="GI:220910680"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:7291375"
FT                   /translation="MDHLDAIEHQATQQNWSYGQFLLHLCHLEAQRREHVRLQRSLSEA
FT                   QLPAAKSFTNFDFSHCPQFNPAPLMQLAQTTDWLARAQNCILLGPSGVGKTHLAASLAR
FT                   RCIELGKRVKFFAATALVQQLQDAKLQLQLYPLLKKLDRYDLLVLDDLGYVKKNETETS
FT                   VLFELIAHRYERKSLLITANQPFSQWDSIFSDSMMTVAAIDRLVHHGVIIDVQAPSYRK
FT                   AAASQRLTQSAATA"
FT                   /protein_id="YP_002485990.1"
FT   misc_feature    complement(83993..84649)
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Cyan7425_0085"
FT   misc_feature    complement(<84338..84445)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0085"
FT   misc_feature    complement(84389..84412)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0085"
FT   misc_feature    complement(84386..84409)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cyan7425_0085"
FT   gene            complement(84708..86258)
FT                   /db_xref="GeneID:7291376"
FT                   /locus_tag="Cyan7425_0086"
FT                   /pseudo
FT   gene            86846..87055
FT                   /db_xref="GeneID:7291377"
FT                   /locus_tag="Cyan7425_0087"
FT   CDS_pept        86846..87055
FT                   /locus_tag="Cyan7425_0087"
FT                   /gene_family="HOG000022594" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gsl3522"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gsl3522 hypothetical protein"
FT                   /db_xref="GI:220910681"
FT                   /db_xref="GeneID:7291377"
FT                   /translation="MTPEDQAQLQQSLDTIAQILYRHTPTEQLQTLEGIEHAIRQQTQE
FT                   LVLPQLGIFLLQQRQQRRKDTREP"
FT                   /protein_id="YP_002485991.1"
FT   gene            87222..88862
FT                   /db_xref="GeneID:7291378"
FT                   /locus_tag="Cyan7425_0088"
FT   CDS_pept        87222..88862
FT                   /locus_tag="Cyan7425_0088"
FT                   /gene_family="HOG000121685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /codon_start="1"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: amr:AM1_B0353 transposase"
FT                   /db_xref="GI:220910682"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="GeneID:7291378"
FT                   /translation="MELLQSLLPDPIHLRLESWTLDRAQKQLTLTIRATQSTTPCPLCQ
FT                   GLTQRIHSRYQRTLRDLPCAHYAVKLRLQVRKFFCTNPLCQRRIFTERLPQVTLPWARR
FT                   TVRLAEQFVAIGLALGGAAGVRLSRTLGHPMSLNCLLHLVSQRPLPALAVPKTLGVDDF
FT                   AFRKGQTYGTVLVDLDQHRPIALLPDREANTLAEWLKQHPGVEVLSRDRSRSYKQGMSE
FT                   GAAEAVQVADRFHLLQNLAEVLESFFATQSKALKTVDLAHHRTPEPELEKPTQALIQRQ
FT                   QRAQQRRERRLANYEQVHQLRQQGFSVPDIAHHLAMGERTVFRYLASPEFPEWQPHPRH
FT                   TRKSSLDPYKTYLIEQWNGGQRQTKLLFVQIQQQGYRGSYATVARYTHYLRQVQRQSLN
FT                   VQYGRGQVPPHLSHPRPPLSARRATWLVLKPAKQRSEDQQALLARLHEHPDLTGAIDLV
FT                   QGFAQLVRQRQSEQLDPWLEQATSSSLSLFQRFAKSLQEDYAAVKAGVTLHISNGQVEG
FT                   QINRLKMLKRQMYGRAGLPLLSRRFLLAC"
FT                   /protein_id="YP_002485992.1"
FT   misc_feature    87243..>87959
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="Cyan7425_0088"
FT   misc_feature    87693..87962
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="Cyan7425_0088"
FT   misc_feature    87729..88859
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="Cyan7425_0088"
FT   gene            88952..89239
FT                   /db_xref="GeneID:7291379"
FT                   /locus_tag="Cyan7425_0089"
FT                   /pseudo
FT   gene            89412..89669
FT                   /db_xref="GeneID:7291380"
FT                   /locus_tag="Cyan7425_0090"
FT   CDS_pept        89412..89669
FT                   /locus_tag="Cyan7425_0090"
FT                   /gene_family="HOG000264153" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpro_2394"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1272"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_2394 protein of unknown function
FT                   DUF1272"
FT                   /db_xref="GI:220910683"
FT                   /db_xref="GeneID:7291380"
FT                   /translation="MIQLCPNCKCCNRDLLTDSPDAKIYSFECTFCVTCAESLLYGHCP
FT                   NYNGELIVRPRRPASKLFKYPASLERVFKPTVCGNFKLIK"
FT                   /protein_id="YP_002485993.1"
FT   misc_feature    89412..89648
FT                   /note="Protein of unknown function (DUF1272); Region:
FT                   DUF1272; cl01568"
FT                   /db_xref="CDD:154476"
FT                   /locus_tag="Cyan7425_0090"
FT   gene            89725..90066
FT                   /db_xref="GeneID:7291381"
FT                   /locus_tag="Cyan7425_0091"
FT   CDS_pept        89725..90066
FT                   /locus_tag="Cyan7425_0091"
FT                   /gene_family="HOG000288134" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   nmu:Nmul_A2100 cupin region"
FT                   /db_xref="GI:220910684"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:7291381"
FT                   /translation="MQASASELLQRLPGKVSEQWPIGERFVTAFTHGTMSVEFYAPIDR
FT                   DQQTPHSQDELYFIHSGHGELTIDGERHRCEAGMVFFVPAGVEHRFEHFSSDFSTWVVF
FT                   WGAQGGEES"
FT                   /protein_id="YP_002485994.1"
FT   misc_feature    <89875..90000
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Cyan7425_0091"
FT   gene            90086..90286
FT                   /db_xref="GeneID:7291382"
FT                   /locus_tag="Cyan7425_0092"
FT                   /pseudo
FT   gene            complement(90324..90635)
FT                   /db_xref="GeneID:7291383"
FT                   /locus_tag="Cyan7425_0093"
FT                   /pseudo
FT   gene            complement(90723..91139)
FT                   /db_xref="GeneID:7291384"
FT                   /locus_tag="Cyan7425_0094"
FT   CDS_pept        complement(90723..91139)
FT                   /locus_tag="Cyan7425_0094"
FT                   /gene_family="HOG000266334" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pnu:Pnuc_2038 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:220910685"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:7291384"
FT                   /translation="MSIEYRINTPVSVDQFIDLLIRSTLGERRPIHDSECMEGMIANSN
FT                   LIISAWESDKLVGIARSMTDFYYACYLSDLAVCQSHQKGGIGKRLQIITQSQLGPQCKL
FT                   ILIAAPNANSYYEHLGFTNNPRCWVLERDASINS"
FT                   /protein_id="YP_002485995.1"
FT   misc_feature    complement(90774..90992)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:185998"
FT                   /locus_tag="Cyan7425_0094"
FT   gene            91255..92256
FT                   /db_xref="GeneID:7291385"
FT                   /locus_tag="Cyan7425_0095"
FT   CDS_pept        91255..92256
FT                   /locus_tag="Cyan7425_0095"
FT                   /gene_family="HOG000106819" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cpha266_0024"
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: cph:Cpha266_0024 transposase"
FT                   /db_xref="GI:220910686"
FT                   /db_xref="GeneID:7291385"
FT                   /translation="MAASFRPTDHVCVLRSYIRHRDSLIKTACVHLQRMQKALTQMNVQ
FT                   LHQVVSDLSGTTGMAMIRAIVAGKRNLQALAALRHPRSQRSEAEIAQALDGDYRQEHVF
FT                   VLQQELQLYDVYQAHIAACDQQIEQCLGGFDVHVDLSEHPLPPPKYKRNKPQDNQPAFD
FT                   LRTYLYQISGVDFTQIDGMGVLKVQTILSEVGLDPSCFPSVKHFTSWLGLCPGSRITGG
FT                   QSKNSATRPVVNRAANAFRMAAQAAGKSHSALGAFYRRLRTRLGAPKAITATAHKIAHL
FT                   FYHLWSTRQSYVDPGEHYYEQRYRERILKQLQKRAQALGLELVHQPPAEAIS"
FT                   /protein_id="YP_002485996.1"
FT   misc_feature    91780..>91935
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Cyan7425_0095"
FT   gene            92443..92916
FT                   /db_xref="GeneID:7291386"
FT                   /locus_tag="Cyan7425_0096"
FT   CDS_pept        92443..92916
FT                   /locus_tag="Cyan7425_0096"
FT                   /gene_family="HOG000252320" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04229"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0157"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0157; KEGG:
FT                   amr:AM1_2289 hypothetical protein"
FT                   /db_xref="GI:220910687"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="GeneID:7291386"
FT                   /translation="MRKVEVLPHNPKWREMFEVEATRIADALGSNVCRIHHIGSTAIPG
FT                   IYAKPIIDLLPEVQELTKVDECSLVMELLGYEGMGEFGIEGRRYFRKLNFEGIRTHHVH
FT                   IFTVGSKQVQRHLAFRDYMIAHPDEAQRYSDLKRRLAKENPTNIVVGQRNKKG"
FT                   /protein_id="YP_002485997.1"
FT   misc_feature    92443..92886
FT                   /note="Uncharacterized protein family (UPF0157); Region:
FT                   UPF0157; cl00987"
FT                   /db_xref="CDD:154127"
FT                   /locus_tag="Cyan7425_0096"
FT   gene            92960..94438
FT                   /db_xref="GeneID:7291387"
FT                   /locus_tag="Cyan7425_0097"
FT   CDS_pept        92960..94438
FT                   /locus_tag="Cyan7425_0097"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: ava:Ava_C0187
FT                   transposase IS66"
FT                   /db_xref="GI:220910688"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291387"
FT                   /translation="MEPSDAHLAARMAAPEFDPEEMGVRYWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEELKETLRKLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   YGFETVDHRLALSLAQCLVCGNALERDETTPVKRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSAALPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYPIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVESLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYHAGNLTVEQLQTQRLILEAELTDVLDHPPKTGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGQNAVAELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002485998.1"
FT   misc_feature    93371..93880
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0097"
FT   gene            94618..95199
FT                   /db_xref="GeneID:7291388"
FT                   /locus_tag="Cyan7425_0098"
FT   CDS_pept        94618..95199
FT                   /locus_tag="Cyan7425_0098"
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rci:RCIX2172 hypothetical protein"
FT                   /db_xref="GI:220910689"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="GeneID:7291388"
FT                   /translation="MKNICVYCGSNFGGRQSYREAAKNLGVEMAKRDIALIYGGGNVGL
FT                   MGVIADAVLAAGGNVVGVIPQALVDKEVAHTGLRDLRIVHSMHERKSLMAELSDAFIAL
FT                   PGGLGTLEEFFEVATWTQLGFHRKACGLLNIDGFYNGMLTFLNQATEEGFIRPQHRNII
FT                   LTAEDPVELIDMLSCFEVPLVHKWIGREQQ"
FT                   /protein_id="YP_002485999.1"
FT   misc_feature    94621..95139
FT                   /note="DNA recombination-mediator protein A; Region:
FT                   DNA_processg_A; cl00695"
FT                   /db_xref="CDD:153941"
FT                   /locus_tag="Cyan7425_0098"
FT   gene            95218..96081
FT                   /db_xref="GeneID:7291389"
FT                   /locus_tag="Cyan7425_0099"
FT   CDS_pept        95218..96081
FT                   /locus_tag="Cyan7425_0099"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00342"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: swd:Swoo_1190 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="GI:220910690"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:7291389"
FT                   /translation="MRSPIQHFQYQVIPPHPLLVPYIRCYWVLRVPAGQPTRRELILPD
FT                   GYAELILNYGESYRWQDQARQVEQIIKTVHLVGERDTSILVDLPRGLNQIGVKFKPAGL
FT                   FALLHQPLEQLANQIVSPSQLGNSSIQVLGEQVFDAPTDEARIEQLNTFFLKRLLLNPL
FT                   DPLIEKSLKIILVHKGNLRIDDLKAHLDVHYKTLERKFKTYVGLTPKVFARIVRFKYTY
FT                   KQFHAISAQDPVFFLDAGYYDQNHFIKDFKYFLHTTPSAYVRNQHSVSDEIVRRGLAKR
FT                   SILSSL"
FT                   /protein_id="YP_002486000.1"
FT   misc_feature    95755..96003
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Cyan7425_0099"
FT   gene            96169..96879
FT                   /db_xref="GeneID:7291390"
FT                   /locus_tag="Cyan7425_0100"
FT   CDS_pept        96169..96879
FT                   /locus_tag="Cyan7425_0100"
FT                   /gene_family="HOG000166647" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /codon_start="1"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: cyt:cce_3508 putative oxidoreductase iron-sulphur
FT                   binding subunit, IorA"
FT                   /db_xref="GI:220910691"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:7291390"
FT                   /translation="MSLESRKLLGTSRRRFLGQALTAAGTAIVAPKVLEHADAQPSSLD
FT                   RHSPIQGETPVRLTINGHPHTIRIEPRVTLLDVLREQLALTGTKKGCDHGQCGACTVLV
FT                   DGDRIYACLALAIMQEGRAITTIEGLARGEQLHPVQAAFIEQDGFQCGYCTPGQICASV
FT                   ALLSEVSRGCASAVTADLTRPPQLPTLSGAEIKERLSGNLCRCSAYNGIVAAVQQAAGQ
FT                   TPPPSAATILVQEG"
FT                   /protein_id="YP_002486001.1"
FT   misc_feature    96328..96804
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs [Energy production and
FT                   conversion]; Region: CoxS; COG2080"
FT                   /db_xref="CDD:32263"
FT                   /locus_tag="Cyan7425_0100"
FT   misc_feature    96334..>96483
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Cyan7425_0100"
FT   misc_feature    order(96430..96435,96442..96444,96451..96453,96457..96468)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Cyan7425_0100"
FT   misc_feature    order(96442..96444,96457..96459,96466..96468)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Cyan7425_0100"
FT   misc_feature    96544..96804
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="Cyan7425_0100"
FT   gene            96881..97876
FT                   /db_xref="GeneID:7291391"
FT                   /locus_tag="Cyan7425_0101"
FT   CDS_pept        96881..97876
FT                   /locus_tag="Cyan7425_0101"
FT                   /gene_family="HOG000244727" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /codon_start="1"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   cyt:cce_3509 hypothetical protein"
FT                   /db_xref="GI:220910692"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="GeneID:7291391"
FT                   /translation="MNNFSYVRAMSVQDAVRRLQAAQNAQFIAGGTNLVDRLKVFLDQP
FT                   AQLIDISRLDLKQIEAAREGGMQIGALATNTAVADHPQIRRDYPLLSRAILSGASQQIR
FT                   NVATVGGNVLQQTRCPYYYDRAFACNKRQPGSGCAARMGMNRTHAILGASDRCVAVHPS
FT                   DMCVALAALDAVVEVESHRGRRRIAFSDVHRLPGDTPEQDTNLEPGELIRAVLLPPLPF
FT                   AKTGVYLKLRDRTSYAFALVSVAAAVEIKSGLITDVRLALGGVAHKPWRSASAEAFLRG
FT                   KPATAETFLQTANLVLQEAQPLTHNRFKVEMTKRAIQRALTLAAPVGGET"
FT                   /protein_id="YP_002486002.1"
FT   misc_feature    96881..97867
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM homologs [Energy production and
FT                   conversion]; Region: CoxM; COG1319"
FT                   /db_xref="CDD:31510"
FT                   /locus_tag="Cyan7425_0101"
FT   misc_feature    96884..97540
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Cyan7425_0101"
FT   misc_feature    97562..97843
FT                   /note="CO dehydrogenase flavoprotein C-terminal domain;
FT                   Region: CO_deh_flav_C; pfam03450"
FT                   /db_xref="CDD:146206"
FT                   /locus_tag="Cyan7425_0101"
FT   gene            97873..99996
FT                   /db_xref="GeneID:7291392"
FT                   /locus_tag="Cyan7425_0102"
FT   CDS_pept        97873..99996
FT                   /locus_tag="Cyan7425_0102"
FT                   /gene_family="HOG000244716" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /codon_start="1"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: cyt:cce_3510 putative carbon
FT                   monoxide dehydrogenase molybdoprotein"
FT                   /db_xref="GI:220910693"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="GeneID:7291392"
FT                   /translation="MNRVIGSSVSRRDGVAKVTGTATYTAENRIAGLVHGYLVTSTIAK
FT                   GRISAISTQGAEQAPGVLAVVTHKNMPRVFTPANDFKSSKLNEARLPLSDDQIHYGGQI
FT                   IALVVADTLERARYAAQLISMQYEPHPPLVDPQQASYEALSEVEFRKGNLAAGIAGTSF
FT                   GSANPGEITIDETYTTAKELHAAMEPHAVIAHWQGDSLTIYEGSQWVMLHQRTYADLFG
FT                   LPSEKVRLITPYIGGAFGSKCFPWPHSILCAAVARQINRPLKMVVTRRQLTTNAGHRAA
FT                   TEQNLRLVARQDGKLVAISHTVNSYTSMVDRFIVDCTATTPVMYAAPHLQLQQELGRLN
FT                   VSTPTYMRAPSENPGMWALESAMDELAWTLNIDPVELRLKNETTGHQRSGLPFSAKHFA
FT                   ECLRVGAERFGWSDRPKEPRSLVHEGQLVGWGMAAATFPAMRGNTTVKVRLLPDGTVHI
FT                   LTAGNDMGTGAYTMVAITAAEALGIPVEQVKVELGDSLFPDGGLAGGSQMTASLAPAVL
FT                   KACQEVLKAANCPTATHACTVLRQSGRAAFEAIASSAPDEQAQKWAFQSWGAHFCEVMV
FT                   DEEIGRLQVSRWVSVMDIGRVINAKSAASQVRGSVIMGIGEALMEEYHLDPKTGYPVVY
FT                   DLATYHYPTHADVPWIDVTFVGQPDLTFNPLGVRGVGEVGITGVAAAVANAVYHATGKR
FT                   FRNLPITPDKLMA"
FT                   /protein_id="YP_002486003.1"
FT   misc_feature    97873..99993
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit CoxL/CutL homologs [Energy production and
FT                   conversion]; Region: CoxL; COG1529"
FT                   /db_xref="CDD:31718"
FT                   /locus_tag="Cyan7425_0102"
FT   misc_feature    97927..98265
FT                   /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
FT                   hammerhead domain; Region: Ald_Xan_dh_C; pfam01315"
FT                   /db_xref="CDD:144787"
FT                   /locus_tag="Cyan7425_0102"
FT   misc_feature    98317..99819
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="Cyan7425_0102"
FT   gene            100001..101158
FT                   /db_xref="GeneID:7291393"
FT                   /locus_tag="Cyan7425_0103"
FT   CDS_pept        100001..101158
FT                   /locus_tag="Cyan7425_0103"
FT                   /gene_family="HOG000244666" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.4.1.1"
FT                   /codon_start="1"
FT                   /EC_number="1.4.1.1"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   ava:Ava_C0125 hypothetical protein"
FT                   /db_xref="GI:220910694"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="GeneID:7291393"
FT                   /translation="MSELKQILQAFEQSQQVGKRTVLVTVVRTSGSVYRRPGVRMLLTE
FT                   DGQMIGAISSGCLEADILERSRPLLANHGDPILLRYDTTSNDDIVFGFGMGCNGVVEVL
FT                   IESLSQDAAVRQLTFMQDCLHTQQMGAIATVFAVKNLPDVNVGDRLMVKSGRMINQIAN
FT                   IDVAERIAADTNKTLLEQQNFVQSYTLSSGKVDVLIEIIRPSVPLLVFGAGYDAIPVVQ
FT                   FARTLGWHVTVIDHRPKYLTRERFPQADQLLYCSPDSSNTYHRLLTPETVAVVMTHRYL
FT                   TDLVFLKTLIPARPRYLGVLGPKRRMQQLWQDLAQEGISLTPEQNQQLYTPTGLDIGAE
FT                   TPEEIALAIVAEIQAVIRHRPGCFLRDRIGSIHSSPQLACLELAS"
FT                   /product="Alanine dehydrogenase"
FT                   /protein_id="YP_002486004.1"
FT   misc_feature    100034..100246
FT                   /note="XdhC and CoxI family; Region: XdhC_CoxI; pfam02625"
FT                   /db_xref="CDD:145661"
FT                   /locus_tag="Cyan7425_0103"
FT   misc_feature    100349..101119
FT                   /note="Xanthine and CO dehydrogenases maturation factor,
FT                   XdhC/CoxF family [Posttranslational modification, protein
FT                   turnover, chaperones]; Region: XdhC; COG1975"
FT                   /db_xref="CDD:32158"
FT                   /locus_tag="Cyan7425_0103"
FT   gene            101137..101751
FT                   /db_xref="GeneID:7291394"
FT                   /locus_tag="Cyan7425_0104"
FT   CDS_pept        101137..101751
FT                   /locus_tag="Cyan7425_0104"
FT                   /gene_family="HOG000280424" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_C0124"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_C0124 hypothetical protein"
FT                   /db_xref="GI:220910695"
FT                   /db_xref="GeneID:7291394"
FT                   /translation="MSGIGILVLAAGASKRLGHPKQLLPFRGRPLIFEIAKVAVLSGCQ
FT                   PVGVVLGAYAESIEPHLANLDVHIIYNEYWLAGMSSSIQCGLRELLAISPDLEAILLMV
FT                   CDQPFVSPHLIHQLIFGYKTFNYPIVTSEYGGIKGVPALFHKDFFPNLAMLQGDIGAKS
FT                   IIRQHHSHCFSIPFEQGAIDLDMPQDLSILSLLIPQLQVPL"
FT                   /protein_id="YP_002486005.1"
FT   misc_feature    101137..101670
FT                   /note="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein MobA; Reviewed; Region: mobA; PRK00317"
FT                   /db_xref="CDD:178976"
FT                   /locus_tag="Cyan7425_0104"
FT   misc_feature    101146..101703
FT                   /note="GT_2_like_f is a subfamily of the
FT                   glycosyltransferase family 2 (GT-2) with unknown function;
FT                   Region: GT_2_like_f; cd04182"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="Cyan7425_0104"
FT   misc_feature    order(101161..101163,101167..101169,101452..101454)
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="Cyan7425_0104"
FT   misc_feature    order(101452..101454,101683..101685,101689..101691)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="Cyan7425_0104"
FT   gene            102135..102371
FT                   /db_xref="GeneID:7291395"
FT                   /locus_tag="Cyan7425_0105"
FT   CDS_pept        102135..102371
FT                   /locus_tag="Cyan7425_0105"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910696"
FT                   /db_xref="GeneID:7291395"
FT                   /translation="MIIEPIELFMSRAIYTTWNLTERILRTQISGVLREEQLEEWKHSL
FT                   EEASCQISQHLNFAMLVNIQGYEVGDQEKAIRN"
FT                   /protein_id="YP_002486006.1"
FT   gene            complement(102425..103903)
FT                   /db_xref="GeneID:7291396"
FT                   /locus_tag="Cyan7425_0106"
FT   CDS_pept        complement(102425..103903)
FT                   /locus_tag="Cyan7425_0106"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: ava:Ava_C0187
FT                   transposase IS66"
FT                   /db_xref="GI:220910697"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291396"
FT                   /translation="MEPSDAHLAARMAAPEFDPEEMGVRYWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEELKETLRKLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   YGFETVDHRLALSLAQCLVCGNALERDETTPVKRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSAALPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYPIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVESLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYHAGNLTVEQLQTQRLILEAELTDVLDHPPKTGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGQNAVAELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002486007.1"
FT   misc_feature    complement(102983..103492)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0106"
FT   gene            104244..105020
FT                   /db_xref="GeneID:7291397"
FT                   /locus_tag="Cyan7425_0107"
FT   CDS_pept        104244..105020
FT                   /locus_tag="Cyan7425_0107"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ter:Tery_2914 short chain
FT                   dehydrogenase"
FT                   /db_xref="GI:220910698"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:7291397"
FT                   /translation="MNLSTFENHIVLVTGGSSGIGRATVLAFANQGATVVFASRGVEAG
FT                   MALQTEINQSGGQSMYLQADMAKSADIQAMITKTIDKYGRIDHAINNAGANVPLAPTDK
FT                   LTESEADYSLDVNLKGVWLCMKYQLQHMAQQGNGTIVNVSSINGLSGTPIGALYTATKH
FT                   GVVGLTRSTALEYIGQGIRINAVCPGLVHTRRLELRWSEMPPEERTKSMRHLAESIPIR
FT                   RFARPEEVAAAIVWLSSEQSSYVVGQALVIDGGLTA"
FT                   /protein_id="YP_002486008.1"
FT   misc_feature    104253..105017
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Cyan7425_0107"
FT   misc_feature    104253..105011
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Cyan7425_0107"
FT   gene            105065..105277
FT                   /db_xref="GeneID:7291398"
FT                   /locus_tag="Cyan7425_0108"
FT                   /pseudo
FT   gene            complement(105614..106189)
FT                   /db_xref="GeneID:7291399"
FT                   /locus_tag="Cyan7425_0109"
FT   CDS_pept        complement(105614..106189)
FT                   /locus_tag="Cyan7425_0109"
FT                   /gene_family="HOG000078796" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_A0066"
FT                   /codon_start="1"
FT                   /product="riboflavin biosynthesis protein RibD
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_A0066 riboflavin biosynthesis protein
FT                   RibD domain-containing protein"
FT                   /db_xref="GI:220910699"
FT                   /db_xref="GeneID:7291399"
FT                   /translation="MRILTYYVACSVDGFIAHTDGSHDGFSQNSEYFEDLFSFFPETVP
FT                   SHLRNLMNIHAENKWFDTVLMGRKTYEVGLKDGVTSPYSHMKQYLFSNSMGQSPDENVE
FT                   LISENSIQFVKTLKSGLGKGIWLCGGANLATELFANRLIDQLILKVNPFLMGSGIPLFS
FT                   GVIQQTALELTDRKIYNNGVLLLYYKVK"
FT                   /protein_id="YP_002486009.1"
FT   misc_feature    complement(105650..106183)
FT                   /note="Dihydrofolate reductase (DHFR). Reduces
FT                   7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as
FT                   a cofactor. This is an essential step in the biosynthesis
FT                   of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate
FT                   is required to regenerate 5,10-...; Region: DHFR; cl00161"
FT                   /db_xref="CDD:185804"
FT                   /locus_tag="Cyan7425_0109"
FT   gene            complement(106630..106806)
FT                   /db_xref="GeneID:7291400"
FT                   /locus_tag="Cyan7425_0110"
FT   CDS_pept        complement(106630..106806)
FT                   /locus_tag="Cyan7425_0110"
FT                   /gene_family="HOG000088145" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910700"
FT                   /db_xref="GeneID:7291400"
FT                   /translation="MNPTETSFGQSEELSKEMSLEEKMGLEIGELHRIAGGTRSPMTAV
FT                   VVKSQCIGNLTNG"
FT                   /protein_id="YP_002486010.1"
FT   gene            complement(106874..107032)
FT                   /db_xref="GeneID:7291401"
FT                   /locus_tag="Cyan7425_0111"
FT   CDS_pept        complement(106874..107032)
FT                   /locus_tag="Cyan7425_0111"
FT                   /gene_family="HOG000088146" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910701"
FT                   /db_xref="GeneID:7291401"
FT                   /translation="MNAKIFSQLSDEQFNQIKVGEDEDLELDVNDLKGIAGGAIYMKVE
FT                   GIQGRCN"
FT                   /protein_id="YP_002486011.1"
FT   gene            107448..107576
FT                   /db_xref="GeneID:7291402"
FT                   /locus_tag="Cyan7425_0112"
FT   CDS_pept        107448..107576
FT                   /locus_tag="Cyan7425_0112"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910702"
FT                   /db_xref="GeneID:7291402"
FT                   /translation="MNTKTTKEALIAKVADKMKAEVIGCILGAEPVSAATAFCQIL"
FT                   /protein_id="YP_002486012.1"
FT   gene            107694..108053
FT                   /db_xref="GeneID:7291403"
FT                   /locus_tag="Cyan7425_0113"
FT   CDS_pept        107694..108053
FT                   /locus_tag="Cyan7425_0113"
FT                   /gene_family="HOG000088147" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ton:TON_1554 hypothetical protein"
FT                   /db_xref="GI:220910703"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:7291403"
FT                   /translation="MTKYVTTEDQRWQGIDVRGVTMEACRLWEGDYNVRSGFFRMPKGM
FT                   QVPMHHHPYWVQVLVMSGKMEVEAEGEEIHTIAAGGYYFVEPGESHVETAVEDTLLLVV
FT                   SEEEREELRLRPSTH"
FT                   /protein_id="YP_002486013.1"
FT   misc_feature    <107778..107990
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="Cyan7425_0113"
FT   gene            complement(108060..108437)
FT                   /db_xref="GeneID:7291404"
FT                   /locus_tag="Cyan7425_0114"
FT                   /pseudo
FT   gene            108437..109023
FT                   /db_xref="GeneID:7291405"
FT                   /locus_tag="Cyan7425_0115"
FT                   /pseudo
FT   gene            109198..112254
FT                   /db_xref="GeneID:7291406"
FT                   /locus_tag="Cyan7425_0116"
FT   CDS_pept        109198..112254
FT                   /locus_tag="Cyan7425_0116"
FT                   /gene_family="HOG000156427" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   shw:Sputw3181_0442 transposase Tn3 family protein"
FT                   /db_xref="GI:220910704"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7291406"
FT                   /translation="MAEQIAVPTQKRLQILREDEIADLYGLPHFTPEEQSEYFALSPRE
FT                   TAAIEQLHSIKSRIYAILQLGYFKVRHLFFVFKLPAVAADVRYIQARYFPKFKLTEFEP
FT                   TKVTRLKHQRIILELCHYRTCAETERQALINKAQQAARVCGKPIYIFRELMHYLEEERI
FT                   IAPGYSFMQDVVGQAIAYEQDRLVAVVQQHLTTADTEALNRLIENAPGLYEITQLKREP
FT                   KDFSLGEVKREIGRSDQIQPLYHLAQKLLPALEISRESIKYYASLVTYYSVFRLKQLAE
FT                   GTVHVYLLCFVYHRYQQAQDNLINSLIYNVRRYVEESKIAAKEQVYEYQVESNQNLQKV
FT                   GQILKLFTDDTIAETTPFQEVQTRAFEILERQKLAFLAEHIATQASFDETAFQWEHVDT
FT                   LARQFKCNLRPILQAIEFASALGYAPVLKALQVLKAAAQKGRPLSQYRPDSFPTQFIPD
FT                   STKCYLYASAAAGGHLLTDRYEFLVYRLLRNGLESGDIFCRDSVRFRSFEDDLLSEQQW
FT                   KAKTELMTATGLKILKQPIQEHLTALEQQLKSRLAQVNQHLSAGENPHFEVKKRGSTIQ
FT                   WTLQSPGIRESINHPMFSTLKHVNLSSILHFVNQYCQFSEAFEHRLGRYVKQKSDDSTL
FT                   IACLIAWGTNMGLGRMGETSDISYYALANVSDNFLRPETLRKANDLVSNAIAELPIFRH
FT                   HDIGGTLHSSSDGQKFESQIQTVNARHSPKYFGLKKGIVSYTLIANHVPVNARIIGANE
FT                   HESHYVFDLLFNNTTEVQPTIHSTDTHGSNEVNFAILHIFGYQFAPRYRDIHHKVSHAL
FT                   YGFKHPSQYGDVLLKPIRKINTQLIMNEWDNIQRIMVSLALKTTTQSIIVSKLSAYVRK
FT                   NKTRQALWEYDNIIKSLYLLDYVDSAPLRQNIQRALNRGESYHQLRRAVSYANFGKLRF
FT                   KTEYEQQIWGDCARLLTNCIIYYNAFILSDLLTHSDSCGDTARVALLSQVSPVAWQHIN
FT                   FYGRYEFSKQPEIIDMETILQQLIQLPLK"
FT                   /protein_id="YP_002486014.1"
FT   misc_feature    109309..112179
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Cyan7425_0116"
FT   misc_feature    111145..112098
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Cyan7425_0116"
FT   gene            complement(112612..113415)
FT                   /db_xref="GeneID:7291407"
FT                   /locus_tag="Cyan7425_0117"
FT   CDS_pept        complement(112612..113415)
FT                   /locus_tag="Cyan7425_0117"
FT                   /gene_family="HOG000023289" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   amr:AM1_F0037 hypothetical protein"
FT                   /db_xref="GI:220910705"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:7291407"
FT                   /translation="MARARNAAQVFASGTQAAEALGQQDQLLEQKSQSDRAQRTSLLLG
FT                   QIHQRLEDTRPLREKHVQDLAESIAALGLIEPLVVDSKGVLLAGGHRLAALQLLKQTQP
FT                   ESYWQQCPDDLIPVRMMSFDAATEPERALQVELAENEKRVNYSRDQIEKLATRLRQLNY
FT                   RDIPGRPKAGEKALGPALAVAIGVSTRYVRRVLNDQYENTRNSVPNFNKLKLLQKIEAN
FT                   LEELSSLLPDGPSNRADQDLAKALPRFLDKVKASLKVEQKTIQKK"
FT                   /protein_id="YP_002486015.1"
FT   misc_feature    complement(<113116..113286)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Cyan7425_0117"
FT   misc_feature    complement(<112942..113268)
FT                   /note="Stage 0 sporulation protein J (antagonist of Soj)
FT                   containing ParB-like nuclease domain [Transcription];
FT                   Region: Spo0J; COG1475"
FT                   /db_xref="CDD:31664"
FT                   /locus_tag="Cyan7425_0117"
FT   gene            complement(113408..114130)
FT                   /db_xref="GeneID:7291408"
FT                   /locus_tag="Cyan7425_0118"
FT   CDS_pept        complement(113408..114130)
FT                   /locus_tag="Cyan7425_0118"
FT                   /gene_family="HOG000023288" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   amr:AM1_F0036 CobQ/CobB/MinD/ParA domain-containing
FT                   protein"
FT                   /db_xref="GI:220910706"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7291408"
FT                   /translation="MTHQRIAIAARKGGVGKTTVACGLASVLASKGQRVLVIDLDPQSN
FT                   AAYVLGADPTAPGTADLLLGGTPKPLEAAPNLFVLPGGPNLSSHSIQSLDPEDLADVVA
FT                   PLDFDILIFDCPPGVEYLERLGLVAASVALICTDAHPLAVMGAGRVVNDLKIRQQKGRK
FT                   GANRWAFVLTRIDLRRSLDQSLAEQLAQTYPATERMIVHQDSNLAWAAAERIPLMQYEP
FT                   HSKGANDLKAIAEWVLNG"
FT                   /protein_id="YP_002486016.1"
FT   misc_feature    complement(113414..114121)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Cyan7425_0118"
FT   misc_feature    complement(<113666..114097)
FT                   /note="ArsA ATPase functionas as an efflux pump located on
FT                   the inner membrane of the cell. This ATP-driven oxyanion
FT                   pump catalyzes the extrusion of arsenite, antimonite and
FT                   arsenate. Maintenance of a low intracellular concentration
FT                   of oxyanion produces...; Region: ArsA; cd02035"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0118"
FT   misc_feature    complement(114074..114097)
FT                   /note="P loop; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0118"
FT   misc_feature    complement(order(113789..113791,114008..114010,
FT                   114074..114085,114089..114091))
FT                   /note="Nucleotide binding site; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0118"
FT   misc_feature    complement(order(113768..113791,114002..114010))
FT                   /note="DTAP/Switch II; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0118"
FT   misc_feature    complement(114002..114010)
FT                   /note="Switch I; other site"
FT                   /db_xref="CDD:73298"
FT                   /locus_tag="Cyan7425_0118"
FT   gene            114293..115453
FT                   /db_xref="GeneID:7291409"
FT                   /locus_tag="Cyan7425_0119"
FT   CDS_pept        114293..115453
FT                   /locus_tag="Cyan7425_0119"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /codon_start="1"
FT                   /product="transposase mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase mutator type; KEGG: ajs:Ajs_2156
FT                   transposase, mutator type"
FT                   /db_xref="GI:220910707"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:7291409"
FT                   /translation="MSNDNLIAFQAPDPPASFSDALTELVRNGARQIIAQAVEAELQGF
FT                   LAQYESLQDDQGRQAVVRNGYLPEVQSVEEVLPWLYLKGISTGDFSEALASLLGAQAAG
FT                   LSASTISRLKAKWIKEHQQWQQRSLLGKRYVYLWADGIYFNIRNEDDRQCILVVIGVTN
FT                   TGSKELLGLEAGFRESELSWKPLLLRLQDQGLKQSPELAVGDGALGFWKALAQVFPTTR
FT                   VQRCWVHKTANVLNHLPKGQQPKAKSALHEIYMAETQAEAQTAFDRFIKTYDAKYPKAV
FT                   ACLSKDREALLAFYDFPAEHWVHLRTTNPIESTFATVRLRTDKTRGCVSQESILSLVFK
FT                   LVQSAQKRWLRIRGFKHLAEVIEGVKFKDGLRADQQLDFKDSRNAA"
FT                   /protein_id="YP_002486017.1"
FT   misc_feature    114350..115348
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Cyan7425_0119"
FT   misc_feature    114755..114997
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Cyan7425_0119"
FT   gene            115665..115880
FT                   /db_xref="GeneID:7291410"
FT                   /locus_tag="Cyan7425_0120"
FT   CDS_pept        115665..115880
FT                   /locus_tag="Cyan7425_0120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ter:Tery_1072 hypothetical protein"
FT                   /db_xref="GI:220910708"
FT                   /db_xref="GeneID:7291410"
FT                   /translation="MSDNNVEVAVLKGLRELPPERQQEVLDFVDFLKSRTTSNRKSLKG
FT                   ILPDRDLSIEDFQEARRAIWAVEAVE"
FT                   /protein_id="YP_002486018.1"
FT   misc_feature    115683..115847
FT                   /note="Protein of unknown function (DUF2281); Region:
FT                   DUF2281; cl02355"
FT                   /db_xref="CDD:154871"
FT                   /locus_tag="Cyan7425_0120"
FT   gene            115880..116284
FT                   /db_xref="GeneID:7291411"
FT                   /locus_tag="Cyan7425_0121"
FT   CDS_pept        115880..116284
FT                   /locus_tag="Cyan7425_0121"
FT                   /gene_family="HOG000253626" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /codon_start="1"
FT                   /product="PilT protein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   reu:Reut_B4269 PilT protein, N-terminal"
FT                   /db_xref="GI:220910709"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:7291411"
FT                   /translation="MAAVVADTHAIIWYFSASKKLSDLASTAFEEALADGHSVYISAIT
FT                   LVEVIYLVEKGKLLTSDLEAIVQAVSAPDPTVVVVPLDLQVAQAVAQIPRETVPELGDR
FT                   IIAATALHLGVPLVTCDSRIRALTIVETIW"
FT                   /protein_id="YP_002486019.1"
FT   misc_feature    115880..116257
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_0121"
FT   gene            116292..116411
FT                   /db_xref="GeneID:7291412"
FT                   /locus_tag="Cyan7425_0122"
FT   CDS_pept        116292..116411
FT                   /locus_tag="Cyan7425_0122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_1576"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_1576 hypothetical protein"
FT                   /db_xref="GI:220910710"
FT                   /db_xref="GeneID:7291412"
FT                   /translation="MSAVREEVGAEMLTKTVPLLLRSGMTIEQVAKQLKVDIE"
FT                   /protein_id="YP_002486020.1"
FT   gene            complement(116711..118681)
FT                   /db_xref="GeneID:7291413"
FT                   /locus_tag="Cyan7425_0123"
FT   CDS_pept        complement(116711..118681)
FT                   /locus_tag="Cyan7425_0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /codon_start="1"
FT                   /product="TAP domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: rde:RD1_2678 secreted peptidase of alpha/beta
FT                   hydrolase superfamily, putative"
FT                   /db_xref="GI:220910711"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="GeneID:7291413"
FT                   /translation="MIKRLYQLGLMVMVMVIEPVCHATATVAQSAPSYRNTQIPCPTPI
FT                   APEEIDGKTTICGVVTLPEDYRKPNGRQIELTYALLKSKSLSPQPDPLIALHGGPGGSD
FT                   ISLIPYFTMLYSQQRQNRDVILFDQRGSRYSGALLCSPTANILETVIKAPGNAWGKKFE
FT                   NLAKRLKGEADLDGETLALMTLCSSVLSAHGFDLNQYNTANNARDVISLASALGYDQIN
FT                   LYGISYGTYLALRVMRDYPQQIRSVVLDSTIPPNVLKYEASLGIFETPALNLIEDCQND
FT                   AVCNRAYPNLKQRMVSVLKRLVKQPIPLAKADAELVKSSSGKVDVDAIVELFKSINGDA
FT                   RVRIAQYVPLIVSELERGVTTTYVGVVSGKIFTTPAQKTIPLGDPQGLLAKAEELRAQA
FT                   RKLLTEKITLAESQRPSQQWVQQVLNAIETLPQADRVLARGNFYGVGFVQGQPRDRNTL
FT                   AAIIAEIFPAPLRQPLIQSLNTLSPAEIRHTYEVILGILDKASPWEQGISQGAFRSIDC
FT                   QDLVTGSDPARLQSLFKQMTLPELGQSALNAGKQAYAICQNWSAQPAPASDRTAVRSKI
FT                   PTLVLQSRYDTQTTTAMGRPSMVGLENGFFLEFPNGGHGVLQFSQCARDVGVAFVNNPT
FT                   RSPNGECRAILKPQFALPPNP"
FT                   /protein_id="YP_002486021.1"
FT   misc_feature    complement(<117890..118408)
FT                   /note="proline-specific peptidases, Bacillus coagulans-type
FT                   subfamily; Region: pro_imino_pep_2; TIGR01250"
FT                   /db_xref="CDD:162270"
FT                   /locus_tag="Cyan7425_0123"
FT   misc_feature    complement(<117905..118084)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Cyan7425_0123"
FT   misc_feature    complement(116756..117028)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Cyan7425_0123"
FT   gene            complement(118728..118853)
FT                   /db_xref="GeneID:7291414"
FT                   /locus_tag="Cyan7425_0124"
FT   CDS_pept        complement(118728..118853)
FT                   /locus_tag="Cyan7425_0124"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910712"
FT                   /db_xref="GeneID:7291414"
FT                   /translation="MALYGTPSQAEFRSGDGAALSGLLLAVYRPNEMAILISLLD"
FT                   /protein_id="YP_002486022.1"
FT   gene            complement(119167..119547)
FT                   /db_xref="GeneID:7291415"
FT                   /locus_tag="Cyan7425_0125"
FT   CDS_pept        complement(119167..119547)
FT                   /locus_tag="Cyan7425_0125"
FT                   /gene_family="HOG000069269" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:cce_3289"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_3289 hypothetical protein"
FT                   /db_xref="GI:220910713"
FT                   /db_xref="GeneID:7291415"
FT                   /translation="MKPQMTLLAIAVLLGSSSFCPLAQAGSFEISPFQMVQGQEPVAPQ
FT                   HTYMTPKSNNQIAVQITDGEFNFRGVLTRSSGNTYIAQDRQVRVMYDREVGRVVVINVV
FT                   TGKEFYNYPYRDNQRNTSEGAL"
FT                   /protein_id="YP_002486023.1"
FT   sig_peptide     complement(119470..119547)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 26"
FT                   /locus_tag="Cyan7425_0125"
FT   gene            complement(119713..119928)
FT                   /db_xref="GeneID:7291416"
FT                   /locus_tag="Cyan7425_0126"
FT   CDS_pept        complement(119713..119928)
FT                   /locus_tag="Cyan7425_0126"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Swit_0421"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swi:Swit_0421 hypothetical protein"
FT                   /db_xref="GI:220910714"
FT                   /db_xref="GeneID:7291416"
FT                   /translation="MPVLADLVGARAGQAEATLENRGYQFVKTITADPDKYSLWRESGS
FT                   NACVSIRTSQGRYDSIIYVSDADCNP"
FT                   /protein_id="YP_002486024.1"
FT   gene            complement(119916..120515)
FT                   /db_xref="GeneID:7291417"
FT                   /locus_tag="Cyan7425_0127"
FT   CDS_pept        complement(119916..120515)
FT                   /locus_tag="Cyan7425_0127"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910715"
FT                   /db_xref="GeneID:7291417"
FT                   /translation="MKIKTVFRNSAIAAIFLIVSHPLIAKAIPQSSRTACIRSTAEEMG
FT                   VGVFDVAIASVGPVSAESGAVTVNMQNKKTGQTAECRVNTIDNTVLSVKLTNSASSNSA
FT                   GRGPEFWVVTASKTLLKPHLAYCPKQLQITFPRAPSCETWAANRGHLPGVRLNSATIPR
FT                   SRVGPGLPISVHLRLGYPHHLPLQSPLDNPEAQCQF"
FT                   /protein_id="YP_002486025.1"
FT   sig_peptide     complement(120438..120515)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 26"
FT                   /locus_tag="Cyan7425_0127"
FT   gene            complement(120841..121221)
FT                   /db_xref="GeneID:7291418"
FT                   /locus_tag="Cyan7425_0128"
FT   CDS_pept        complement(120841..121221)
FT                   /locus_tag="Cyan7425_0128"
FT                   /gene_family="HOG000233906" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_A0238 hypothetical protein"
FT                   /db_xref="GI:220910716"
FT                   /db_xref="GeneID:7291418"
FT                   /translation="MSKPLLLLSLMITLGLITLPMVAQTQTTSVSQAQSPSDSDINSRS
FT                   LDRAKNLARQAAEKANGGLSKYQAEPSMHGPANQAPYVDNGNGTWTFTFTGGPPGQAPN
FT                   IRTVVTVSKDGSQVQINSNTPL"
FT                   /protein_id="YP_002486026.1"
FT   sig_peptide     complement(121144..121221)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 26"
FT                   /locus_tag="Cyan7425_0128"
FT   gene            complement(121479..122108)
FT                   /db_xref="GeneID:7291419"
FT                   /locus_tag="Cyan7425_0129"
FT   CDS_pept        complement(121479..122108)
FT                   /locus_tag="Cyan7425_0129"
FT                   /gene_family="HOG000069799" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRB0547 hypothetical protein"
FT                   /db_xref="GI:220910717"
FT                   /db_xref="GeneID:7291419"
FT                   /translation="MVGLAKFNFGLAIATIASLGIPVAVYADTVTARCDVYPKGEDRAT
FT                   SSGLCTFSQRQGVIGIQLKNGKRYDLVPANQPNHYRDQNGRAAYQQSGLGDKGQIFRLV
FT                   NESIYVYWDTAPYGQNPGSANSGMAATSSAPEVGTPVAPLSDLVGARAGQAESTIEQRG
FT                   YQFLRTEPSGDAIYSYWREAKTNYCVIIRTANGRYDSIVYGSSSCK"
FT                   /protein_id="YP_002486027.1"
FT   sig_peptide     complement(122025..122108)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 28"
FT                   /locus_tag="Cyan7425_0129"
FT   gene            complement(122453..123157)
FT                   /db_xref="GeneID:7291420"
FT                   /locus_tag="Cyan7425_0130"
FT   CDS_pept        complement(122453..123157)
FT                   /locus_tag="Cyan7425_0130"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ana:alr2428 two-component
FT                   hybrid sensor and regulator"
FT                   /db_xref="GI:220910718"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:7291420"
FT                   /translation="MKILLVEDDPDLATALMKGLTSNLYQVDWADDGAAGLALAQVKAY
FT                   DLVLLDFYLPKLSGLELCRKIRRGSERVTDAAPNQEIPILVLTGESATAQKVLCLDAGA
FT                   DDHVVKPVDLDELLARIRALLRRGMGQRSPILHWGELQLDPSSYEVKFRQQVVPLTSKE
FT                   YAVLELLLRHPTQVFSPAHMIDRLWAGDDSRADATIRFYIQTLRQKLKQVGAEEIIETK
FT                   HGLGYRLKPQES"
FT                   /protein_id="YP_002486028.1"
FT   misc_feature    complement(122459..123157)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(122810..123148)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(order(122825..122830,122837..122839,
FT                   122894..122896,122981..122983,123005..123007,
FT                   123134..123139))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(123005..123007)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(order(122981..122989,122993..122998))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(122822..122830)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(122471..122752)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Cyan7425_0130"
FT   misc_feature    complement(order(122480..122482,122495..122497,
FT                   122528..122533,122555..122557,122564..122566,
FT                   122618..122623,122678..122680))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Cyan7425_0130"
FT   gene            123248..124312
FT                   /db_xref="GeneID:7291421"
FT                   /locus_tag="Cyan7425_0131"
FT   CDS_pept        123248..124312
FT                   /locus_tag="Cyan7425_0131"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02743"
FT                   /codon_start="1"
FT                   /product="Cache domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cache domain protein; KEGG: amr:AM1_0017
FT                   sensor histidine kinase, putative"
FT                   /db_xref="GI:220910719"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="GeneID:7291421"
FT                   /translation="MPAPHIRPLAPIPLRWVLIVPFILQAVGVVALVGYLSYRSGQQAV
FT                   SDLAEQLMVEVGDRTTLYLEKTLEVPHLVNQLNANAIRLGMIPGFDSTNTAFLEQVFLQ
FT                   QIKQFPTISTIAIANERGGMVGSVHNNPGLSVYRTQGFTRGIFSISEIDAMGKEAPALV
FT                   ISKTYDARKRPWYQTPKQAGQATWSPIYHLMARVPLLSVSAGLPFYDKTGKFQGVLATD
FT                   IILDNLNQFLAKLKIGKSGQVFIIERSGLLVASSKAQPWWTLDADKPERVRAIESTNPL
FT                   IQNAMAYLTRSLNLEKINTAQQLVIRQENAHQFVRVIPFRDRQGLDWLIVIVVPESDFM
FT                   AQIQQNTRTTILLS"
FT                   /protein_id="YP_002486029.1"
FT   misc_feature    123851..124027
FT                   /note="Cache domain; Region: Cache_1; pfam02743"
FT                   /db_xref="CDD:145738"
FT                   /locus_tag="Cyan7425_0131"
FT   gene            124382..125860
FT                   /db_xref="GeneID:7291422"
FT                   /locus_tag="Cyan7425_0132"
FT   CDS_pept        124382..125860
FT                   /locus_tag="Cyan7425_0132"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: ava:Ava_C0187
FT                   transposase IS66"
FT                   /db_xref="GI:220910720"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291422"
FT                   /translation="MEPSDAHLAARMAAPEFDPEEMGVRYWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEELKETLRKLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   YGFETVDHRLALSLAQCLVCGNALERDETTPVKRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSAALPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYPIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVESLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYHAGNLTVEQLQTQRLILEAELTDVLDHPPKTGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGQNAVAELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002486030.1"
FT   misc_feature    124793..125302
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0132"
FT   gene            125898..128198
FT                   /db_xref="GeneID:7291226"
FT                   /locus_tag="Cyan7425_0133"
FT   CDS_pept        125898..128198
FT                   /locus_tag="Cyan7425_0133"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /EC_number="2.7.13.3"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_3723 two-component hybrid sensor and
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="GI:220910721"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="GeneID:7291226"
FT                   /translation="MLLAVTNYLLSLLALAGAIAFGIFISNRVNARISQLNQANRELAR
FT                   GNLAHYITQPLPTDSSIAEVQGLTESFNQMAEQLQQFFQTKVEAEANRQSEARFQQLAA
FT                   AVPGMIYTLTQSPDGSQKFEYVSSASRTILELESEQALEDINSVIEQIHPDDRSTYDEV
FT                   SAQSVSLMEPFSLSFRTITPSGQLKWVEASSRPLLNTNGSITWYGILLDVSDRKRAEIA
FT                   LRQYERIVANTTDGIILIDTQFRYQIANQTYLLWYNKSIFEIIGFPVSKIIGQDVFETN
FT                   FRPYLVRCLAGETIESREWFEIPTLGRQFFSVTYSPYLDENLAIAGIVASLRNITSLKL
FT                   AEQELEKAKEEAEKASQAKSLFLANMSHELRTPLNVILIMTQMMNRTANKIPEYQEYID
FT                   LISRNSDHLLKMINDVLDLFKVEAEKASLENSETNLFELLQSIYVTFKQQCTDKHIQIN
FT                   LEIDEKVPRLILVDVQKLQQVLINLIGNAVKFTEHGEITVRVTVELTQDKTKWQDASIP
FT                   LAFTVEDTGVGIAPEEMNQIFDAFAQAAAGRQMTGGTGLGLSISQGLVQLMGGEITVKS
FT                   TLGVGSTFHFVLPVQPVAEAITQSSLSQSVLSLAPGQPAYRILVVDDQEANRMPLIRLL
FT                   SQIGFEVEEAVAGEEAISLWQKWHPHLILMDLRMPGLSGWDATKRIRAEEMDERIRQVK
FT                   REAMGNTSNACPTWPVVIVAVTAQALEGDRKLALAAGCDDYISKPISLDILLKKIAQNL
FT                   NLTYSGFGVYEAQ"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /protein_id="YP_002486031.1"
FT   sig_peptide     125898..125993
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.985 at
FT                   residue 32"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    125958..126140
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    126249..126509
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    126264..126527
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(126273..126275,126285..126287,126303..126305,
FT                   126348..126359,126435..126437,126450..126452)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(126339..126341,126351..126353,126375..126377,
FT                   126384..126389,126471..126473,126477..126479)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    126564..127661
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    126981..127157
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(126981..126983,126993..126995,127005..127007,
FT                   127014..127016,127026..127028,127035..127037,
FT                   127086..127088,127098..127100,127107..127109,
FT                   127119..127121,127128..127130,127140..127142)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    126999..127001
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    127323..127661
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(127341..127343,127353..127355,127362..127364,
FT                   127461..127463,127467..127469,127473..127475,
FT                   127479..127484,127560..127571,127617..127619,
FT                   127623..127625,127638..127643,127647..127649)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    127353..127355
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(127473..127475,127479..127481,127560..127562,
FT                   127566..127568)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    127752..128156
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(127761..127766,127893..127895,127917..127919,
FT                   128043..128045,128100..128102,128109..128114)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    127893..127895
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    order(127902..127907,127911..127919)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0133"
FT   misc_feature    128109..128117
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cyan7425_0133"
FT   gene            128481..129278
FT                   /db_xref="GeneID:7291227"
FT                   /locus_tag="Cyan7425_0134"
FT                   /pseudo
FT   gene            complement(129379..130653)
FT                   /db_xref="GeneID:7291228"
FT                   /locus_tag="Cyan7425_0135"
FT   CDS_pept        complement(129379..130653)
FT                   /locus_tag="Cyan7425_0135"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /codon_start="1"
FT                   /product="transposase mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase mutator type; KEGG: ajs:Ajs_2156
FT                   transposase, mutator type"
FT                   /db_xref="GI:220910722"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:7291228"
FT                   /translation="MSNDNLIAFQAPDPPASFSDALTELVRNGARQIIAQAVEAELQGF
FT                   LAQYESLQDDQGRQAVVRNGYLPERTIVTGVGEVAIQVPKVRDRSGRGIKFNSTLLPPY
FT                   LKRVQSVEEVLPWLYLKGISTGDFSEALASLLGAQAAGLSASTISRLKAKWIKEHQQWQ
FT                   QRSLLGKRYVYLWADGIYFNIRNEDDRQCILVVIGVTNTGSKELLGLEAGFRESELSWK
FT                   PLLLRLQDQGLKQSPELAVGDGALGFWKALAQVFPTTRVQRCWVHKTANVLNHLPKGQQ
FT                   PKAKSALHEIYMAETQAEAQTAFDRFIKTYDAKYPKAVACLSKDREALLAFYDFPAEHW
FT                   VHLRTTNPIESTFATVRLRTDKTRGCVSQESILSLVFKLVQSAQKRWLRIRGFKHLAEV
FT                   IEGVKFKDGLRADQQLDFKDSRNAA"
FT                   /protein_id="YP_002486032.1"
FT   misc_feature    complement(129484..130596)
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Cyan7425_0135"
FT   misc_feature    complement(129835..130077)
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Cyan7425_0135"
FT   gene            131146..131562
FT                   /db_xref="GeneID:7291229"
FT                   /locus_tag="Cyan7425_0136"
FT   CDS_pept        131146..131562
FT                   /locus_tag="Cyan7425_0136"
FT                   /gene_family="HOG000262558" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_1919"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1919 hypothetical protein"
FT                   /db_xref="GI:220910723"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="GeneID:7291229"
FT                   /translation="MRLVLDTDVIIAALRSPGGASAALLQGVRLGRAIALLSVPMALEY
FT                   EAKCTQAQHYSAAGLSDWEAVEFVTAVIALAEPVKIHYLWRPRLKDPNDEMVLEVAVNG
FT                   SADAIVTFNQKDYGAIPGEFGVDVLLPREVIRRI"
FT                   /protein_id="YP_002486033.1"
FT   misc_feature    131146..131550
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_0136"
FT   gene            131565..131855
FT                   /db_xref="GeneID:7291230"
FT                   /locus_tag="Cyan7425_0137"
FT   CDS_pept        131565..131855
FT                   /locus_tag="Cyan7425_0137"
FT                   /gene_family="HOG000138088" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1920 hypothetical protein"
FT                   /db_xref="GI:220910724"
FT                   /db_xref="GeneID:7291230"
FT                   /translation="MDKNDAAPYALRLPRSLKAEVENLSGQDGISMNQFIVMAVAEKVS
FT                   ALEIEKFFEQRRNRANFSVLDRLLTRAGGEPPREGDELDEAPTWLKPPIES"
FT                   /protein_id="YP_002486034.1"
FT   gene            complement(131926..132099)
FT                   /db_xref="GeneID:7291231"
FT                   /locus_tag="Cyan7425_0138"
FT   CDS_pept        complement(131926..132099)
FT                   /locus_tag="Cyan7425_0138"
FT                   /gene_family="HOG000087981" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910725"
FT                   /db_xref="GeneID:7291231"
FT                   /translation="MKATQINVPALILSFAIVGLIADTMPVPGLRARVVTQSANWITAT
FT                   IQAPATAAVAPR"
FT                   /protein_id="YP_002486035.1"
FT   sig_peptide     complement(132031..132099)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.700 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0138"
FT   gene            132265..132426
FT                   /db_xref="GeneID:7291232"
FT                   /locus_tag="Cyan7425_0139"
FT   CDS_pept        132265..132426
FT                   /locus_tag="Cyan7425_0139"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910726"
FT                   /db_xref="GeneID:7291232"
FT                   /translation="MAGAKPFLVLLLIIMALSKFMIGCGQSSGDAYQQCLNEAKNEDEK
FT                   LQSREKLL"
FT                   /protein_id="YP_002486036.1"
FT   sig_peptide     132265..132354
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.638 at
FT                   residue 30"
FT                   /locus_tag="Cyan7425_0139"
FT   gene            complement(132576..132812)
FT                   /db_xref="GeneID:7291233"
FT                   /locus_tag="Cyan7425_0140"
FT   CDS_pept        complement(132576..132812)
FT                   /locus_tag="Cyan7425_0140"
FT                   /gene_family="HOG000087985" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910727"
FT                   /db_xref="GeneID:7291233"
FT                   /translation="MNKKVVAGLLFFSALVLPTLTPLQASAGSRDDYYIVFCRTFSNKP
FT                   YYKVGTFGNHFEAKIAEQRHEWDGKSCYIKRYA"
FT                   /protein_id="YP_002486037.1"
FT   sig_peptide     complement(132729..132812)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.842 at
FT                   residue 28"
FT                   /locus_tag="Cyan7425_0140"
FT   gene            133514..133813
FT                   /db_xref="GeneID:7291234"
FT                   /locus_tag="Cyan7425_0141"
FT   CDS_pept        133514..133813
FT                   /locus_tag="Cyan7425_0141"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910728"
FT                   /db_xref="GeneID:7291234"
FT                   /translation="MMVERRKALYILLGILPWAVWAGMIIVLKALVRTSRDPSLYTGTC
FT                   YKLNGLAVQCSLDQWLLWDATPALDIFTFIGAIVAAALSGYVFIRSKRIGLRNP"
FT                   /protein_id="YP_002486038.1"
FT   sig_peptide     133514..133582
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.768 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0141"
FT   gene            complement(134504..134701)
FT                   /db_xref="GeneID:7291235"
FT                   /locus_tag="Cyan7425_0142"
FT   CDS_pept        complement(134504..134701)
FT                   /locus_tag="Cyan7425_0142"
FT                   /gene_family="HOG000088057" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:asr8513"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:asr8513 unknown protein"
FT                   /db_xref="GI:220910729"
FT                   /db_xref="GeneID:7291235"
FT                   /translation="MKVLALAFAIGTVCVSLSPAEAQVVIKGTKCHPDSPQGFCCPNDG
FT                   RPSGPYCPARPITTNTTTQN"
FT                   /protein_id="YP_002486039.1"
FT   sig_peptide     complement(134633..134701)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT                   /locus_tag="Cyan7425_0142"
FT   gene            complement(134928..137405)
FT                   /db_xref="GeneID:7291236"
FT                   /locus_tag="Cyan7425_0143"
FT   CDS_pept        complement(134928..137405)
FT                   /locus_tag="Cyan7425_0143"
FT                   /gene_family="HOG000072570" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ank:AnaeK_3339 transcriptional regulator, XRE family"
FT                   /db_xref="GI:220910730"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:7291236"
FT                   /translation="MNIDLRGVRERAGLTQSQIAAMLGLSQAQVSRYEQDPGTISTELL
FT                   IRWAQALGTDIPTLLANALPSLTPLEVGDPYAKLRHDLNLLEQYISAAHFSELDTAKSH
FT                   LTPDQLPTPDNLRLQIKRYRQKPNLVLVGRFDSGKSHLANALMGVKCLPSQYQPATRVI
FT                   TFVRHIDDRPTWLSEQVCILDEEFWPKDEKGNFIFDLTTLDSQERYEDYCINSGSLEVL
FT                   REHGLHDHLSEDEIDGHSAVVYIDSPLLKACNVVDFPGYSDKSDEFSGDVKKANSAAQI
FT                   ADLVLYTSPANNFINAEDIQRLSYLLKVLPTPEIAKTDFPKLGNLFIVATHASPSINDS
FT                   QLEQIMKVGPKRFYKELNEFVFSERGQRIGKPITLEEVSDRFFTFWSELPNRCKKLRED
FT                   LTVILDEHFPKVTRHNIECEISEFKYKVPKNISNQILAYQQTIAEIEQRRQELQQLEKE
FT                   QPNFQSKIKLGRKKIHQCISELQSKSKASFQSFFNDLLIASTLEEMIRKRYDNKKEAQE
FT                   YAVGYVVEKLQTKLEVVIKENSEILKKDIDEFLELYEEALLKLPRLNAGSVHIPFDPKG
FT                   AFLGGLVGLGGVGALAVWASALGNLGAYILVAKGVSLLAALGIGVGGVANAVAFVAAIG
FT                   GPIALAVGIVAIAAFIGWALFGESWQSRLAKKIISHFQEQRVLNQYLKGNDDYWNDTSK
FT                   AFDKGADALEEKFNAYMQHLREITSNNPKVKHELELLLNKLKGLKNFFEQIPWVFQFFK
FT                   PPVQSVKSTVESSNFFRISYSNHTICIKSKKTSTSFEIEDDGLWEELKFRVKNGEIELT
FT                   KAEFEGLYYMRKV"
FT                   /protein_id="YP_002486040.1"
FT   misc_feature    complement(137229..137393)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cyan7425_0143"
FT   misc_feature    complement(order(137301..137303,137376..137378,
FT                   137388..137390))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cyan7425_0143"
FT   misc_feature    complement(order(137304..137306,137379..137381))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cyan7425_0143"
FT   misc_feature    complement(order(137298..137303,137313..137315,
FT                   137322..137324,137355..137360))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cyan7425_0143"
FT   misc_feature    complement(136494..137021)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Cyan7425_0143"
FT   gene            complement(138129..138662)
FT                   /db_xref="GeneID:7291237"
FT                   /locus_tag="Cyan7425_0144"
FT   CDS_pept        complement(138129..138662)
FT                   /locus_tag="Cyan7425_0144"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SYNPCC7002_F0007"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syp:SYNPCC7002_F0007 hypothetical protein"
FT                   /db_xref="GI:220910731"
FT                   /db_xref="GeneID:7291237"
FT                   /translation="MHQRFCKTSIHTYAAKIYTDLHPYQRAKNLLQTQSFQVITPTRPV
FT                   AITLGVERCMLKRLAQSQLSRHGWHTAPLLTIQHTLQVAVKQILSPVDIAGTARAWTPA
FT                   LIAVLSSGISPEQLRATGSDHLQQLAELLTVYQTELYQSHGLDPSEILWKASQLESDPR
FT                   AILVYGYFLPSIAD"
FT                   /protein_id="YP_002486041.1"
FT   gene            138924..140147
FT                   /db_xref="GeneID:7291238"
FT                   /locus_tag="Cyan7425_0145"
FT   CDS_pept        138924..140147
FT                   /locus_tag="Cyan7425_0145"
FT                   /gene_family="HOG000005198" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPC_3934"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3934 hypothetical protein"
FT                   /db_xref="GI:220910732"
FT                   /db_xref="GeneID:7291238"
FT                   /translation="MASSFSWLDYSEQDKRKMLDVISLFNEKDTRDELGIGSIRDAFAD
FT                   QLFPGTSTIQTRARYFLFIPWIYQELERRKTPSNQMDARLRQWEVQLIYTLIDARETGV
FT                   IGAQARERLKRLPSNIYWYGLGAWGIRYFPGSQDEYHRSLDTFYPSSRKQRNDDGEPVD
FT                   GRLTCNWHPSLPAAPANFPGVANFTLTRSEAEYLAERIITRHPNSLLAFLVNERESTAV
FT                   VRFAWEHPLWEQFPSHLQKQLSHARNFSETLQGAALLYNLMLAEEKKAQDWIEDYREEL
FT                   QGWAAQLDTRRQSLRQWDLSEFWTTVTAGGAQVSLSTRDFIRRWLTFALNPEIAQTIAS
FT                   HPEARNHIRERELFLKKGQARLSNTQALELWQGESGIAQLDYRWGSAQRILLDILKGFT
FT                   EEEVDAAA"
FT                   /protein_id="YP_002486042.1"
FT   gene            140134..142011
FT                   /db_xref="GeneID:7291239"
FT                   /locus_tag="Cyan7425_0146"
FT   CDS_pept        140134..142011
FT                   /locus_tag="Cyan7425_0146"
FT                   /gene_family="HOG000005199" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPC_3935"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3935 hypothetical protein"
FT                   /db_xref="GI:220910733"
FT                   /db_xref="GeneID:7291239"
FT                   /translation="MLQPNDRAHLFESLRPPEGYSLDCGIGTTFTLDLLALLTAPLAFT
FT                   TFDWADEDGHLARSPQALLATMQQYAERITIFCQTGKIAIPSNRNLLLYSFLEESVVEV
FT                   NAPRAGGLFHPKIWLLRFIAPEHPPQYRFLCLSRNFTFDHCWDTILRLDGQVVEDGKEF
FT                   VANRPLSDFIRALPTLAHHPPLSNRIQTQIDLLGSELRRVEFERPPGFDQLLFHPLGLQ
FT                   GSSTPPIDGHIDRLLVVSPFVSQNRLQKLSKLGKNNILISRPEQLDQIPAPALGGFAQL
FT                   FHVSPAANLNDEADHDPADAAPAPLAGLHAKLYVADSGQKARIWTGSANATDAAFERNV
FT                   EFLVELLGSKQQFGIDSLLAFQDKEVTFRSLLESYIPLEEPVLDENPLADLANWAEVQL
FT                   LQLHLSATVLPIEEPDQYCLQLQFEAVELPEFPAEIQVKCYPMTRRDLATLLDAQPAST
FT                   IDFKPLTCQAITSFFAFEIWTSDSQQKLSSFMLNVPLIGVPAKRRQQILRSLLQDKNQV
FT                   LKLLMFLLSDNKAEVRELLDSFGIDSITSASGLNASNGGSPSLFPLFEAMVRALDRNPM
FT                   KLDQIARLVEDLRQLPEEEQVLPDNFVAIWQPIYTARQKLNVTVQRVRS"
FT                   /protein_id="YP_002486043.1"
FT   gene            complement(141993..143504)
FT                   /db_xref="GeneID:7291240"
FT                   /locus_tag="Cyan7425_0147"
FT   CDS_pept        complement(141993..143504)
FT                   /locus_tag="Cyan7425_0147"
FT                   /gene_family="HOG000058200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: npu:Npun_R3353
FT                   transposase IS66"
FT                   /db_xref="GI:220910734"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291240"
FT                   /translation="MMEPLPVSIEQISDSEWVETPESVKRYLLGRIEQLERQYEELKAE
FT                   NAMLREQLRRNSQNSSKPPSQDQGNRFKPKAKQEKEKKKPRGGQLGHEGHEGKFYPLEA
FT                   CETVTEHYPERCINCGGRLQGKDPEPYRVQQVEIPPVVPVVREHRFHALKCACCGVRTR
FT                   AWDEVIINGCRYGERIVSTVGLLSGQYRQSHRMVQGLLDQLFGVELSTGSINQLRQESS
FT                   TSVASAVEEAHHYVQQQEQVNMDETSFAQGNNDGKNTEGRKGWLWVLVTPWVSYFAVCL
FT                   SRSSQVCQQLLGETFTGIVGSDRYSAYQHLSLEHRQVCWAHLKRDLTQIAERKGVAGEL
FT                   GQALLEQQHLLFEHWYRVRDGTLSRSEFSQTVQPIRERFKQLLTEGAGYEIAPKEKTPL
FT                   AKTVRTCQQLLKIEPALWTFVTTEGIEPTNNAAERALRPAVLWRKNSFGSQSEAGSLFV
FT                   SRMLTVTTSLRAQNRSVLEYLVQACRASRQGLPAPSLLPIQDRTL"
FT                   /protein_id="YP_002486044.1"
FT   misc_feature    complement(142572..143063)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0147"
FT   gene            143580..146264
FT                   /db_xref="GeneID:7291241"
FT                   /locus_tag="Cyan7425_0148"
FT   CDS_pept        143580..146264
FT                   /locus_tag="Cyan7425_0148"
FT                   /gene_family="HOG000005196" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00487"
FT                   /codon_start="1"
FT                   /product="DEAD-like helicase"
FT                   /transl_table="11"
FT                   /note="SMART: DEAD-like helicases; KEGG: rpc:RPC_3936
FT                   helicase-like"
FT                   /db_xref="GI:220910735"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="GeneID:7291241"
FT                   /translation="MKNRAPYPDPEQILKGLKDFQRNTVEYVFRRLYLDKDASDRFLIA
FT                   DEVGLGKTLVARGLIAKAIDYLSLRVDRIDIIYVCSNADIARQNIQRLNITGKKDFSLA
FT                   SRITLLPLELNNLNQNRINFVSFTPGTSFDLKSGTGIEKERALLYWLLYEEWFFRGKAS
FT                   PLNILQGRSRADRFREYINRFRDIFPIDATLAQVFIEKLRHKIQYEEQQGQPDLFTRFT
FT                   ELCEPFSHHTNNISWEDNQKRNQLIGDLRLLLAKACVSALEPDLIILDEFQRFKHLLEP
FT                   ENELNKIAQELFNFSNTHSSTKVVLLSATPYKMYTLAHEAAEENHYEDFLRTIQFLQSN
FT                   QNQTDYLRKLLEQYRRELFRLGQNNYDNLLELKSGLESELRRVMVRTERLAASPERNGM
FT                   LVEIPCSNIKLEPQDLETYLSLQTIARILGHSDTLEYWKSAPYLLNFMDDYELKRSFIQ
FT                   ALDDRDQETSLAHAIATSSALLLSRQDIETYAKVDACNARLRGLLEDTIGVGAWKLLWV
FT                   PPSLPYYKLGGVFSNAKLTQVTKRLVFSSWRIVPKMIASLLSYEAERKMIKSFEQNPQN
FT                   TPEARERRRPLLRFARSKDNKIRLTGMPVLGLLYPSMVLAIEGDPLSFAIKTDAPGIPA
FT                   LEEVQSRIANRIEALLQALNIEPFEAGAEDESWYWVAPILLDRHFEPQATHDWFSLPDL
FT                   ASTWAGKEHEQEADEPDPSLWAEHIKMAKAVVDAPFLSLGKPPKDLSLVLAHMAIGAPG
FT                   IVALRTLSRITANPTLLTNSAVRNYAAQTAWSFRTLFNSPEATALIRGLNPKASYWRSV
FT                   LNYCVNGCLQAVLDEYAHILQESLGLLNQQGEEAEKKNAEETAKEISEAISTALTLRTS
FT                   VMEVDEIVGDTRGRSTVLMAVSG"
FT                   /protein_id="YP_002486045.1"
FT   misc_feature    143673..>143810
FT                   /note="ATP-dependent helicase HepA; Validated; Region:
FT                   PRK04914"
FT                   /db_xref="CDD:179891"
FT                   /locus_tag="Cyan7425_0148"
FT   gene            146261..146692
FT                   /db_xref="GeneID:7291242"
FT                   /locus_tag="Cyan7425_0149"
FT   CDS_pept        146261..146692
FT                   /locus_tag="Cyan7425_0149"
FT                   /gene_family="HOG000254171" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ana:alr5158 transposase"
FT                   /db_xref="GI:220910736"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7291242"
FT                   /translation="MKGRRRHLLVDSLGLLLKVVVTQANAGERLVTAYALMELVEQCPK
FT                   VLQKVKLLWVDGGYSGDAFALAVWLMIQARVEVISRRSEGFEVLPKRWIVERTFGWLNW
FT                   YRRLSKDYEYLPEMSEAAIYAVMTRLMLRRLTVEDQLTL"
FT                   /protein_id="YP_002486046.1"
FT   misc_feature    <146402..146662
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Cyan7425_0149"
FT   gene            complement(146885..147172)
FT                   /db_xref="GeneID:7291243"
FT                   /locus_tag="Cyan7425_0150"
FT   CDS_pept        complement(146885..147172)
FT                   /locus_tag="Cyan7425_0150"
FT                   /gene_family="HOG000226099" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: cya:CYA_0885
FT                   CRISPR-associated Cas2 family protein"
FT                   /db_xref="GI:220910737"
FT                   /db_xref="InterPro:IPR003799"
FT                   /db_xref="GeneID:7291243"
FT                   /translation="MKHLWLVCYDVHNNKRRTKLAKALERHCQRVQYSVFECPLDRETL
FT                   LNLAQKEWLKYINLKEDSLRAYPLPPQLALEQVKVWGGRPVYEKPDYLIY"
FT                   /protein_id="YP_002486047.1"
FT   misc_feature    complement(146957..147163)
FT                   /note="CRISPR associated protein Cas2; Region: CRISPR_Cas2;
FT                   cl11442"
FT                   /db_xref="CDD:164225"
FT                   /locus_tag="Cyan7425_0150"
FT   gene            complement(147169..148179)
FT                   /db_xref="GeneID:7291244"
FT                   /locus_tag="Cyan7425_0151"
FT   CDS_pept        complement(147169..148179)
FT                   /locus_tag="Cyan7425_0151"
FT                   /gene_family="HOG000230559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: ana:alr0381
FT                   hypothetical protein"
FT                   /db_xref="GI:220910738"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="GeneID:7291244"
FT                   /translation="MTALYLTEPGTVVCYQNEVLQVVKQKQIRTCRLAELDIVVVLPGV
FT                   QLTSVAIAQLLDRGIETIFLRGDGGFRGRLQGQFHTNPAVRLAQYRAVETPFGLSLARR
FT                   MVAGKVRNQRTLLQRRNRATQNRYSELTEAIDLIAASLLTLQQASSDLNRDQLMGMEGS
FT                   CARYYYQALRYWFPEQWNFTGRNRQPPLDPINALLSWGYGVLLSRTFSACVQAGLDPYL
FT                   GFFHAIAPYRPNLVLDLMEEFRPIVVDQTVIHLIQTDILGLEDFQPSPTGEGIWLGEVA
FT                   KKLFLGALEQHLNQPLLYPPQNRNLKLSQILLEQCRWLSRCLQSQTPDYEPFTIK"
FT                   /protein_id="YP_002486048.1"
FT   misc_feature    complement(147184..148170)
FT                   /note="CRISPR-associated endonuclease Cas1; Region: cas1;
FT                   TIGR00287"
FT                   /db_xref="CDD:161805"
FT                   /locus_tag="Cyan7425_0151"
FT   misc_feature    complement(147211..148170)
FT                   /note="CRISPR associated protein Cas1; Region: Cas_Cas1;
FT                   cl00656"
FT                   /db_xref="CDD:163892"
FT                   /locus_tag="Cyan7425_0151"
FT   gene            148276..148569
FT                   /db_xref="GeneID:7291245"
FT                   /locus_tag="Cyan7425_0152"
FT   CDS_pept        148276..148569
FT                   /locus_tag="Cyan7425_0152"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all0380 unknown protein"
FT                   /db_xref="GI:220910739"
FT                   /db_xref="GeneID:7291245"
FT                   /translation="MGRRGVRQLFCYRTGIAAIVNAGMTWIVLIIAPLGLFAVILCTLL
FT                   VFLGSLTTGAVSDRLLLNVLEPELPLQVGAERINQQGKLNREEGQKRLPEED"
FT                   /protein_id="YP_002486049.1"
FT   gene            complement(148566..149567)
FT                   /db_xref="GeneID:7291246"
FT                   /locus_tag="Cyan7425_0153"
FT   CDS_pept        complement(148566..149567)
FT                   /locus_tag="Cyan7425_0153"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910740"
FT                   /db_xref="GeneID:7291246"
FT                   /translation="MRYLVTTHADRLPKNIPILMVDGTVPGWLAKLGDHHWDHHRTGGA
FT                   EIQIDEMPFPAEQSLIQTYGIESACIVTTMVDADACCAAAWLQLPASVLTPATISRLKA
FT                   IAWDCDHLHVPPPLQELSEFAANAVATLKLLANQTLQALELPPDRRSWSEEEWECFNSE
FT                   QFRRGTEWLIAAAKGERPYPGAAGEAEPYWQHLAQVERQLLCEKRITLIPTDRGAIGFC
FT                   NLLDLHQPIDPRAFHRGLAQAFGLSGLRPETLVLRDHRRGGYQYTLGCLPVHPETAALD
FT                   YTAGIFERLTLAERLKQPQSGSWGGRRTVGGSAWNTPSQLEPLEVIAQLDAL"
FT                   /protein_id="YP_002486050.1"
FT   gene            149648..150301
FT                   /db_xref="GeneID:7291247"
FT                   /locus_tag="Cyan7425_0154"
FT   CDS_pept        149648..150301
FT                   /locus_tag="Cyan7425_0154"
FT                   /gene_family="HOG000025044" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF820"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ava:Ava_1088 hypothetical protein"
FT                   /db_xref="GI:220910741"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="GeneID:7291247"
FT                   /translation="MVVQIPIRRIQVPPGQRVLLQDVSWEEFEAIVQELGNHRAARVAY
FT                   DEGLLEIMSPLPEHEYFKETISIAIADMAEVLDLNYESYGSTTWRKQATRAGLEPDNCF
FT                   YFQNEARIRGKLQFDLNQDPPPDLALEIDVTSQSLDRFPIYARLEVPELWCYDSGNLKI
FT                   YHLQNGQYIEVPRSAIFPQLDIGALPQLIEANRAAGRLALRRSVRAWVREQVKR"
FT                   /protein_id="YP_002486051.1"
FT   misc_feature    149771..150172
FT                   /note="Domain of unknown function (DUF820). This family
FT                   consists of hypothetical proteins that are greatly expanded
FT                   in cyanobacteria. The proteins are found sporadically in
FT                   other bacteria. They have been predicted to belong to the
FT                   PD-(D/E)xK superfamily of...; Region: DUF820; cd06260"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Cyan7425_0154"
FT   misc_feature    order(149822..149824,149948..149950,150038..150040,
FT                   150068..150070,150080..150082)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="Cyan7425_0154"
FT   gene            complement(150354..150773)
FT                   /db_xref="GeneID:7291248"
FT                   /locus_tag="Cyan7425_0155"
FT   CDS_pept        complement(150354..150773)
FT                   /locus_tag="Cyan7425_0155"
FT                   /gene_family="HOG000121274" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /codon_start="1"
FT                   /product="PilT protein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   npu:Npun_R1163 PilT domain-containing protein"
FT                   /db_xref="GI:220910742"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:7291248"
FT                   /translation="MTLRYLLDTNILSNLMRPRPDAQILAHFQQYQGVLATSAPVLHEL
FT                   QFGCDRLPESSKRSKLEKFINEVVKARIPILPYDENAAIWHSRERARLFQLGKPPSFAD
FT                   SQIAAIAAVNQLTLVTSNVSDFENFQDLEIENWQQ"
FT                   /protein_id="YP_002486052.1"
FT   misc_feature    complement(150360..150770)
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_0155"
FT   gene            complement(150770..151048)
FT                   /db_xref="GeneID:7291249"
FT                   /locus_tag="Cyan7425_0156"
FT   CDS_pept        complement(150770..151048)
FT                   /locus_tag="Cyan7425_0156"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /codon_start="1"
FT                   /product="prevent-host-death family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   npu:Npun_R1164 hypothetical protein"
FT                   /db_xref="GI:220910743"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:7291249"
FT                   /translation="MKQYTIEQLRDNLDEILREFQGDSSVELLQAGKPIAILVKPEVFQ
FT                   QLQQSAQPSLWNAYQQFRQEVDLEEFDDDPDVFANLRDKSPGRNVEL"
FT                   /protein_id="YP_002486053.1"
FT   misc_feature    complement(<150896..151048)
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:186840"
FT                   /locus_tag="Cyan7425_0156"
FT   gene            complement(151167..151820)
FT                   /db_xref="GeneID:7291250"
FT                   /locus_tag="Cyan7425_0157"
FT   CDS_pept        complement(151167..151820)
FT                   /locus_tag="Cyan7425_0157"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CYB_0586"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyb:CYB_0586 hypothetical protein"
FT                   /db_xref="GI:220910744"
FT                   /db_xref="GeneID:7291250"
FT                   /translation="MQAAEGLTEIQWKIADAIANELTRQGSGSLTELRKAVSYLRAYSG
FT                   QEDPGKNFFSYLEALAKNGSKIGHSNQTPEYYKSIQLVYNKYLRRYEEKPADMLQILGW
FT                   AVRFMHYYKTFPIGELPSIPKNLASPKVIAMQEALQQLSTSKLKEGQTLDAKVVNKQVK
FT                   GKQVTYELLGFEFKEREPKNFDLIAEGAIVKVEIKSLKEDGTINHVKFFPASQS"
FT                   /protein_id="YP_002486054.1"
FT   gene            complement(151820..152992)
FT                   /db_xref="GeneID:7291251"
FT                   /locus_tag="Cyan7425_0158"
FT   CDS_pept        complement(151820..152992)
FT                   /locus_tag="Cyan7425_0158"
FT                   /gene_family="HOG000088155" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:all1472"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all1472 unknown protein"
FT                   /db_xref="GI:220910745"
FT                   /db_xref="GeneID:7291251"
FT                   /translation="MTEKPKLKKKPQPVNQPSESHSSMDNDSRKPYKLISFPKDTSGNI
FT                   LLPHREKPAGLDQYKPKYFTGSISLRLNVKTATAVASGLTVLKSDLLENPQGVPLVKPS
FT                   VERNGRLIIPGSSLKGTVRSIYEAITRSCICKVTNNFRIDNRRISIKLPSADHEECKPE
FT                   KRDIQTRQAKVCPACQIFGAMNWQGIVRFADAQCDQEGFEVEFAPSLYKPNLEREGYYS
FT                   NFSSKVVGGRKFFYNFIGSVDQGEKGIDTQRAVVGYTFSTHLNFMNLTKEQLGALFISL
FT                   GKNSSFNFALKVGAGKPIGMGSMTVDILDIELWSQDKNNLLNSTRNIRDRYLSYSLPES
FT                   NSLTGDALNQFMDQAMQAAKNTQLVQQQQLQEIAEVLKYPTERTAPEGMY"
FT                   /protein_id="YP_002486055.1"
FT   misc_feature    complement(<152408..152791)
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="Cyan7425_0158"
FT   gene            complement(152989..153435)
FT                   /db_xref="GeneID:7291252"
FT                   /locus_tag="Cyan7425_0159"
FT   CDS_pept        complement(152989..153435)
FT                   /locus_tag="Cyan7425_0159"
FT                   /gene_family="HOG000088156" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:all1473"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all1473 unknown protein"
FT                   /db_xref="GI:220910746"
FT                   /db_xref="GeneID:7291252"
FT                   /translation="MAFVGVKTVETADELRDLLQQYEDGSSRYFLRWAHEVSGFEKTLP
FT                   TVFPSPEGQLFNQERELRWKQQGQKFNILLLSAEDDEVGFSPINSEHKIQWTIQERNAY
FT                   QYSATTTRFPKGIAENDIKLGQRYFINQKTSIVHFVALTVKEVA"
FT                   /protein_id="YP_002486056.1"
FT   gene            complement(153435..154064)
FT                   /db_xref="GeneID:7291253"
FT                   /locus_tag="Cyan7425_0160"
FT                   /pseudo
FT   gene            154200..155321
FT                   /db_xref="GeneID:7291254"
FT                   /locus_tag="Cyan7425_0161"
FT   CDS_pept        154200..155321
FT                   /locus_tag="Cyan7425_0161"
FT                   /gene_family="HOG000088157" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CYB_0597"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyb:CYB_0597 hypothetical protein"
FT                   /db_xref="GI:220910747"
FT                   /db_xref="GeneID:7291254"
FT                   /translation="MESLTGMNSEILRQEMAKAPFSTVHRSIRQDLSLLAQLQWLRAGE
FT                   RGLFIRQPEAKLPHPGGLSKAELEPSSQSRDLYWLLQEIAFLQPNLSRVINTLWEHHSA
FT                   AREWQAEHTRNTQRLFLHLDFLSEEIAEQVEDYQAGLEELWQQGDRPIRFIYQLAQAKR
FT                   QVKVLVYPVCLHYARRAKYLSAYGIDPYGQENWHNYRLDRIRSSQLDVLDWQHPDIPDF
FT                   LLKLKQQNQLPTPEEVREKLEEAWGLDFYRPAQLLILRFPADFARWYVTEKFNRLKLEK
FT                   LSYPQLVKRIRKEILDSQEQQTLLELVHQRQSSDSNNNYVYFCAQVRVGDINVTMRLRD
FT                   WRPQGEVIAPLQLREQMKREALTELAHYQNGSN"
FT                   /protein_id="YP_002486057.1"
FT   gene            155390..156526
FT                   /db_xref="GeneID:7291255"
FT                   /locus_tag="Cyan7425_0162"
FT   CDS_pept        155390..156526
FT                   /locus_tag="Cyan7425_0162"
FT                   /gene_family="HOG000088158" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   CRISPR-associated protein TM1814; KEGG: ana:alr1482 unknown
FT                   protein"
FT                   /db_xref="GI:220910748"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="GeneID:7291255"
FT                   /translation="MPQRRAKATVNLPALTRWRSDAELVAIALSIKAEQTVTLYPQYVI
FT                   ALHAWFLDQVRQLNPELSAYLHDGESEKAFTLSGLLNTSDKGEHQVFQLQAGQSYQWNL
FT                   TALSRPLVQWFEQWLTVLPAAIDLRSVQLQISSWNMAYPPLTYAELKDEPPPERLTLPL
FT                   TFISTTSFRRKGYHLPLPWPRNVFHSYLRRWNDFSGQPIEQDPFLDWVDDAVVILRHQL
FT                   QSQKVQAGKRGSVTGFTGKVEFGLSPTAEENPEYEQLLFALGQLAPYCGTGHKTTFGLG
FT                   QTRSGWLSESMDLAPPSLQVALGDRIAELTEVFMMQRKRRGGNRATQTAETWATILARR
FT                   ELGESLEQIAADLEMNYETVKTYVKLARKALLSDRSQQ"
FT                   /protein_id="YP_002486058.1"
FT   misc_feature    155882..156241
FT                   /note="CRISPR associated protein Cas6; Region: Cas_Cas6;
FT                   cl11443"
FT                   /db_xref="CDD:164226"
FT                   /locus_tag="Cyan7425_0162"
FT   misc_feature    <156395..156502
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:186312"
FT                   /locus_tag="Cyan7425_0162"
FT   gene            complement(157065..157649)
FT                   /db_xref="GeneID:7291256"
FT                   /locus_tag="Cyan7425_0163"
FT   CDS_pept        complement(157065..157649)
FT                   /locus_tag="Cyan7425_0163"
FT                   /gene_family="HOG000265510" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00471"
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: cyb:CYB_1056 HD domain-containing protein"
FT                   /db_xref="GI:220910749"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="GeneID:7291256"
FT                   /translation="MNFSLNYNNALEYATWLHRSQVRKGTQTPYITHPVAVSLLAIEHG
FT                   ATEIEAIAALLHDALEDGPQYSGRSLMDIQNYITYNFGLEVLEIVEGCTQIETEEQNWW
FT                   ERKQAYIDHLPQASPSVHLVSCCDKLHNLLCILRDYEVVGTEVWQRFSQGREGVMFYYP
FT                   ALARAFAEVGVCKPLLSRLQAAVVQLEKVQI"
FT                   /protein_id="YP_002486059.1"
FT   misc_feature    complement(157224..157565)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:185790"
FT                   /locus_tag="Cyan7425_0163"
FT   gene            complement(157646..158167)
FT                   /db_xref="GeneID:7291257"
FT                   /locus_tag="Cyan7425_0164"
FT   CDS_pept        complement(157646..158167)
FT                   /locus_tag="Cyan7425_0164"
FT                   /gene_family="HOG000086960" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /codon_start="1"
FT                   /product="Appr-1-p processing domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   noc:Noc_1830 Appr-1-p processing"
FT                   /db_xref="GI:220910750"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="GeneID:7291257"
FT                   /translation="MPQTIAERFQIIQGDITQLQVEAIVNAANNELRPGGGVCGAIFAA
FT                   AGYEQLKTACEQIGYCPTGEAVITSGFDLPVDWIIHTVGPIYQGKTEDAELLRQCYRSC
FT                   MQFAGEERVRSLAFPLISTGSYGYPLREAIAIAVDAINAGLAQYPEIEQVYLVCYSQVD
FT                   YQTAVQQVNR"
FT                   /protein_id="YP_002486060.1"
FT   misc_feature    complement(157673..158146)
FT                   /note="Macro domain, Appr-1'-pase_like family. The macro
FT                   domain is a high-affinity ADP-ribose binding module found
FT                   in a variety of proteins as a stand-alone domain or in
FT                   combination with other domains like in histone macroH2A and
FT                   some PARPs (poly ADP-ribose...; Region:
FT                   Macro_Appr_pase_like; cd02908"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_0164"
FT   misc_feature    complement(order(157790..157798,157802..157804,
FT                   158051..158056,158060..158062,158081..158083,
FT                   158120..158125))
FT                   /note="putative ADP-ribose binding site; other site"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_0164"
FT   misc_feature    complement(order(157925..157927,158051..158053,
FT                   158063..158065,158081..158083,158090..158092))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:28848"
FT                   /locus_tag="Cyan7425_0164"
FT   gene            complement(158273..159304)
FT                   /db_xref="GeneID:7291258"
FT                   /locus_tag="Cyan7425_0165"
FT   CDS_pept        complement(158273..159304)
FT                   /locus_tag="Cyan7425_0165"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF88"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   syf:Synpcc7942_1143 hypothetical protein"
FT                   /db_xref="GI:220910751"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="GeneID:7291258"
FT                   /translation="MRTDSAAQSSSSRNNLSYFPLAGSIVGSLVGVFTQQLLLACLPLY
FT                   LNLLLMQIRDRQRYLALVQNQSKQTQAIASWQEQSQQSSQQIQQQLSGLQSRFDQFQSQ
FT                   PAAALTKTHLQPVINQIRELQIENKQFKLRDIPQLQQQIDVVQSSLKDRLDIEPPQVVQ
FT                   PSEPQTPAIFIDAANLEYSARDLNLQLDYQKIYRFLTKGMKQPRVFFYTGERPGDARQK
FT                   KQLDWLTGIGYQLVTKKIVRQPGGTEKANLDVELALDMYRLADTLSRAVLVSGDGDFTQ
FT                   ALQLLKQQGIAVDVISFRSCTSKALIKAANRYIDLEQRTAEICTSGVSPLTAFIPNKLQ
FT                   SAG"
FT                   /protein_id="YP_002486061.1"
FT   misc_feature    complement(158357..158794)
FT                   /note="LabA_like proteins. A well conserved group of
FT                   bacterial proteins with no defined function. LabA, a member
FT                   from Synechococcus elongatus PCC 7942, has been shown to
FT                   play a role in cyanobacterial circadian timing. It is
FT                   required for negative feedback...; Region: LabA_like;
FT                   cd06167"
FT                   /db_xref="CDD:100118"
FT                   /locus_tag="Cyan7425_0165"
FT   misc_feature    complement(order(158471..158473,158477..158479,
FT                   158483..158485,158546..158548,158771..158773,
FT                   158780..158782))
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:100118"
FT                   /locus_tag="Cyan7425_0165"
FT   gene            complement(159388..160623)
FT                   /db_xref="GeneID:7291259"
FT                   /locus_tag="Cyan7425_0166"
FT   CDS_pept        complement(159388..160623)
FT                   /locus_tag="Cyan7425_0166"
FT                   /gene_family="HOG000055032" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /codon_start="1"
FT                   /product="von Willebrand factor type A"
FT                   /transl_table="11"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   syp:SYNPCC7002_G0035 hypothetical protein"
FT                   /db_xref="GI:220910752"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="GeneID:7291259"
FT                   /translation="MTTPQFQLLPLRAAVASDQPTTLDVLVKIIPPVPETRPQRPPLNL
FT                   GLVIDRSGSMQGAKMEVARQAACFAVEQLLPSDRLSVTIFDDRVECPVPSTLVRDKATI
FT                   IRTIQGIHSRGSTALHDGWVQGGIQVSQHLNPAHLNRVILLSDGLANVGETNPDAIAQH
FT                   VHGLAQRGVSTSTMGIGEDYGEDLLEAMARSGAGSFYHIERTEQLAAIFQAELQGLMGT
FT                   LGQTVSLGIEPKQGVVVVEVLNDFEQTPYGRYKLPNLVVGNSIEVVVRLKVPPLAESAD
FT                   LCQFRLAWDQPQQRQRQVLKTALRLPVVSTAQLADFPLNEEVQQQVALLMAARARQEAI
FT                   QQMDRGNYDQALHVLQNVRDQVACMPASPMMQQEVQALSDLEEKMQRRDYKSSRKQALY
FT                   EKHYRQRSRKDL"
FT                   /protein_id="YP_002486062.1"
FT   misc_feature    complement(159988..160497)
FT                   /note="VWA subgroup: Von Willebrand factor type A (vWA)
FT                   domain was originally found in the blood coagulation
FT                   protein von Willebrand factor (vWF). Typically, the vWA
FT                   domain is made up of approximately 200 amino acid residues
FT                   folded into a classic a/b para...; Region: vWA_subgroup;
FT                   cd01465"
FT                   /db_xref="CDD:29238"
FT                   /locus_tag="Cyan7425_0166"
FT   misc_feature    complement(order(160183..160185,160261..160263,
FT                   160462..160464,160468..160470,160474..160476))
FT                   /note="metal ion-dependent adhesion site (MIDAS); other
FT                   site"
FT                   /db_xref="CDD:29238"
FT                   /locus_tag="Cyan7425_0166"
FT   gene            complement(160620..161258)
FT                   /db_xref="GeneID:7291260"
FT                   /locus_tag="Cyan7425_0167"
FT   CDS_pept        complement(160620..161258)
FT                   /locus_tag="Cyan7425_0167"
FT                   /gene_family="HOG000055033" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:tlr0344"
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="KEGG: tel:tlr0344 unknown protein"
FT                   /db_xref="GI:220910753"
FT                   /db_xref="GeneID:7291260"
FT                   /translation="MLSLQQFAQSHPLWTLEQLVETANQLLPQFLPQQESDQRVQEEVN
FT                   PRLVRHYTTLGLIDKPLKEGREARYTYRHLLQLLVIRRLQMEGYSANAINQLTLSKSNP
FT                   ELEALLQGGVQLTVQAANPALAFLQSLQKATPGVVEMAKKAAPLVDQSSTPTSATAPKS
FT                   WMRFEVIPGLELHVREDFIYPSSSQEQQTLLQLIGQLLIQFIHQRRRSK"
FT                   /protein_id="YP_002486063.1"
FT   misc_feature    complement(160968..161132)
FT                   /note="Helix-Turn-Helix DNA binding domain of transcription
FT                   regulators from the MerR superfamily; Region: HTH_MerR-SF;
FT                   cl02600"
FT                   /db_xref="CDD:155005"
FT                   /locus_tag="Cyan7425_0167"
FT   gene            complement(161589..162179)
FT                   /db_xref="GeneID:7291261"
FT                   /locus_tag="Cyan7425_0168"
FT   CDS_pept        complement(161589..162179)
FT                   /locus_tag="Cyan7425_0168"
FT                   /gene_family="HOG000088150" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: viral A-type inclusion protein, putative"
FT                   /db_xref="GI:220910754"
FT                   /db_xref="GeneID:7291261"
FT                   /translation="MRLTLNKANRLLQQLKSRRSYRHYDYLAAMPTFSLTVRLSDCNDE
FT                   LRATLEEQYRRRRDALDNRLQICQDYYRLRESLFVANQRCGISQRLSDIDLCRELLNLY
FT                   KHTQSQYADSKVVPLRVEAIDPQQLREDLKHMEGKTELEIQVITPAEIEQQIQSLTSRI
FT                   DQLEDEITRLNNQETLEIELSEASLQLMGTAAA"
FT                   /protein_id="YP_002486064.1"
FT   gene            complement(162225..162833)
FT                   /db_xref="GeneID:7291262"
FT                   /locus_tag="Cyan7425_0169"
FT   CDS_pept        complement(162225..162833)
FT                   /locus_tag="Cyan7425_0169"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910755"
FT                   /db_xref="GeneID:7291262"
FT                   /translation="MPAFLVCNERTAAAVLSQSTAVIAILSPEINEVAELPVSLWEQNH
FT                   PDRYLRVAYHHCGWSCQLTPPDLKFCDCLRFVETCLQRFGYDLNFALYSHSNSVSAYTL
FT                   ALVLYTYWLQDPQRAIALVEEQSPLKDWEEVDRFLLHHFFQQQPLQKFSRQLWSYCQLR
FT                   QAQRRSFLREQNRSRQQDSRRTQSTPQVQSEDLDWLDLE"
FT                   /protein_id="YP_002486065.1"
FT   gene            complement(162908..163042)
FT                   /db_xref="GeneID:7291263"
FT                   /locus_tag="Cyan7425_0170"
FT   CDS_pept        complement(162908..163042)
FT                   /locus_tag="Cyan7425_0170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910756"
FT                   /db_xref="GeneID:7291263"
FT                   /translation="MRSNLCKFPEASRDDHVHPYFDLTSDSSNESAPPHPSTSYRAVI"
FT                   /protein_id="YP_002486066.1"
FT   gene            complement(163310..163987)
FT                   /db_xref="GeneID:7291264"
FT                   /locus_tag="Cyan7425_0171"
FT   CDS_pept        complement(163310..163987)
FT                   /locus_tag="Cyan7425_0171"
FT                   /gene_family="HOG000023018" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AM1_B0183"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_B0183 hypothetical protein"
FT                   /db_xref="GI:220910757"
FT                   /db_xref="GeneID:7291264"
FT                   /translation="MMQQLELDLWGSLEAAAQVPQTADLRSLYQVLERTLEGQALTNQL
FT                   AIAGNAMVQLSEVYADRAAGMIEAWERRYQPQETVIDLEDCADLFVQSLSLDVSDLFEE
FT                   AEPVAYPIHRKVAERTGSIVGEVAKADLLDWIEETRVEVPPDTATVEQGILNLAHDENV
FT                   QETIAAIAHYLKHRGKVSLQTLRQGLGISLIELWLGLLIGGFRLEQQDPFYQTASLLTA
FT                   QNK"
FT                   /protein_id="YP_002486067.1"
FT   gene            complement(163984..164505)
FT                   /db_xref="GeneID:7291265"
FT                   /locus_tag="Cyan7425_0172"
FT   CDS_pept        complement(163984..164505)
FT                   /locus_tag="Cyan7425_0172"
FT                   /gene_family="HOG000023019" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Npun_BF174"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: npu:Npun_BF174 hypothetical protein"
FT                   /db_xref="GI:220910758"
FT                   /db_xref="GeneID:7291265"
FT                   /translation="MARPDQEKCRLCAKLTAQEAQHRHGPEGDGCWTPQVCYNRRSYYR
FT                   HRGVRNQGRKLRRREARAGAIAGGTVVLELPAPAVPAAVVHWYRVTKDAPLHAIGAELW
FT                   MGNDRTARIEPVHCLGLRESQVKALLIQILALFSQQCGRKVERFRTSVELHPDYCPIRP
FT                   CPLHPEGLGP"
FT                   /protein_id="YP_002486068.1"
FT   gene            complement(164541..164792)
FT                   /db_xref="GeneID:7291266"
FT                   /locus_tag="Cyan7425_0173"
FT   CDS_pept        complement(164541..164792)
FT                   /locus_tag="Cyan7425_0173"
FT                   /gene_family="HOG000149637" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MAE_43230"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_43230 hypothetical protein"
FT                   /db_xref="GI:220910759"
FT                   /db_xref="GeneID:7291266"
FT                   /translation="MPKITLAISDETLQALQTTPEQLSQELLFVGGVKLYELGRLSSGA
FT                   AAVLAGVPRTEFLARLAEYDVNTFSLGAAELAEDLANA"
FT                   /protein_id="YP_002486069.1"
FT   misc_feature    complement(164544..164771)
FT                   /note="Uncharacterized protein family (UPF0175); Region:
FT                   UPF0175; cl01085"
FT                   /db_xref="CDD:154188"
FT                   /locus_tag="Cyan7425_0173"
FT   gene            complement(164985..165353)
FT                   /db_xref="GeneID:7291267"
FT                   /locus_tag="Cyan7425_0174"
FT   CDS_pept        complement(164985..165353)
FT                   /locus_tag="Cyan7425_0174"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mta:Moth_2318 hypothetical protein"
FT                   /db_xref="GI:220910760"
FT                   /db_xref="GeneID:7291267"
FT                   /translation="MSQYTVLVARLQNELSMLDKVVAKAQSQVSKAQQSGDADFYQAAA
FT                   LSLQNYYMGVERIFEEVAKQVDQSLPSGASSHRVLLEQMSLEIPLQVVIPAHCLLFWAI
FT                   GIHQDLHGDPLFPFLIPF"
FT                   /protein_id="YP_002486070.1"
FT   gene            complement(165350..165715)
FT                   /db_xref="GeneID:7291268"
FT                   /locus_tag="Cyan7425_0175"
FT   CDS_pept        complement(165350..165715)
FT                   /locus_tag="Cyan7425_0175"
FT                   /gene_family="HOG000069703" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RoseRS_3517"
FT                   /codon_start="1"
FT                   /product="DNA polymerase beta subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: rrs:RoseRS_3517 DNA polymerase beta subunit"
FT                   /db_xref="GI:220910761"
FT                   /db_xref="GeneID:7291268"
FT                   /translation="MTLPIPSKMQIYIEAARQRQQQRKQFLERRRQQGVALGKEAAKIL
FT                   RQEFEVSRVVLFGSILNETDFHESSDLDLAVWQLNSSDYIKAIARLMELPGFTIDLVEA
FT                   ETASPYLQAAIAQGMEL"
FT                   /protein_id="YP_002486071.1"
FT   misc_feature    complement(165371..165601)
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cyan7425_0175"
FT   misc_feature    complement(order(165416..165418,165422..165424,
FT                   165497..165499,165503..165508,165530..165532,
FT                   165539..165547))
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cyan7425_0175"
FT   misc_feature    complement(order(165497..165499,165503..165508,
FT                   165530..165532,165539..165547))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cyan7425_0175"
FT   misc_feature    complement(order(165416..165418,165497..165499,
FT                   165503..165505))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cyan7425_0175"
FT   misc_feature    complement(order(165416..165418,165422..165424))
FT                   /note="antibiotic binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cyan7425_0175"
FT   gene            166382..166486
FT                   /db_xref="GeneID:7291269"
FT                   /locus_tag="Cyan7425_0176"
FT   CDS_pept        166382..166486
FT                   /locus_tag="Cyan7425_0176"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910762"
FT                   /db_xref="GeneID:7291269"
FT                   /translation="MDEIKAKVIHAQPQLELGYGQTTLNFASNEEEET"
FT                   /protein_id="YP_002486072.1"
FT   gene            166486..166716
FT                   /db_xref="GeneID:7291270"
FT                   /locus_tag="Cyan7425_0177"
FT   CDS_pept        166486..166716
FT                   /locus_tag="Cyan7425_0177"
FT                   /gene_family="HOG000088159" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mhun_1520"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mhu:Mhun_1520 hypothetical protein"
FT                   /db_xref="GI:220910763"
FT                   /db_xref="GeneID:7291270"
FT                   /translation="MLTGIRQKAIVQPGGLIELHSSELPEGATVEVIVLVEASSTAQRS
FT                   LTSFIGAAKGNFATPEDVDQFIRQERDEWHS"
FT                   /protein_id="YP_002486073.1"
FT   gene            166704..167150
FT                   /db_xref="GeneID:7291271"
FT                   /locus_tag="Cyan7425_0178"
FT   CDS_pept        166704..167150
FT                   /locus_tag="Cyan7425_0178"
FT                   /gene_family="HOG000273622" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /codon_start="1"
FT                   /product="PilT protein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   swo:Swol_1837 PilT protein-like protein"
FT                   /db_xref="GI:220910764"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:7291271"
FT                   /translation="MALLNAIQGDRVYLDTNIWIYALEGYPAFSQELTNLFQAIDQGNL
FT                   SAVTSELSLAELLVKPIQTLDVAQQDTYKQAITSSQYLSVIPVQRDILINAAILRATTS
FT                   LKLPDAIHAATALITQCSTFLTNDQRFQTITGLKAVLLSQAITP"
FT                   /protein_id="YP_002486074.1"
FT   misc_feature    166734..167129
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:186835"
FT                   /locus_tag="Cyan7425_0178"
FT   gene            complement(167147..167284)
FT                   /db_xref="GeneID:7291272"
FT                   /locus_tag="Cyan7425_0179"
FT   CDS_pept        complement(167147..167284)
FT                   /locus_tag="Cyan7425_0179"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_B0188"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_B0188 hypothetical protein"
FT                   /db_xref="GI:220910765"
FT                   /db_xref="GeneID:7291272"
FT                   /translation="MRRAEVARPDQEKCCLCAKLTAQEAQHHHGPEGDGCWTPPVCYNP
FT                   "
FT                   /protein_id="YP_002486075.1"
FT   gene            complement(167256..168047)
FT                   /db_xref="GeneID:7291273"
FT                   /locus_tag="Cyan7425_0180"
FT   CDS_pept        complement(167256..168047)
FT                   /locus_tag="Cyan7425_0180"
FT                   /gene_family="HOG000228673" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1814"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   npu:Npun_F6247 hypothetical protein"
FT                   /db_xref="GI:220910766"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="GeneID:7291273"
FT                   /translation="MRFEQHQQVLQLLAAMNRTWLQDLGIGFGGGTLLCLLQGEYRLSY
FT                   DIDLICPEGASYRQLRNAIAAEGTAPLFDPALPLARPPLTDMYAVRFRVGDPAVKVEVI
FT                   CEARIPLEPPVVLPAIPVPCLHPIDQWATKLLANADRWNDASTFARDLIDLCILARRDG
FT                   DIPEIAIAKAEQAYAVLPALVKAIAAFQSNPQVRDRCFAALRIDQPAVVIDGLDQLAVL
FT                   LGSERTQRQFMEIQAELDPSPLGLNDLGEEPKHEEGRSGPS"
FT                   /protein_id="YP_002486076.1"
FT   misc_feature    complement(167421..167966)
FT                   /note="Domain of unknown function (DUF1814); Region:
FT                   DUF1814; cl00973"
FT                   /db_xref="CDD:154118"
FT                   /locus_tag="Cyan7425_0180"
FT   gene            complement(168037..168243)
FT                   /db_xref="GeneID:7291274"
FT                   /locus_tag="Cyan7425_0181"
FT   CDS_pept        complement(168037..168243)
FT                   /locus_tag="Cyan7425_0181"
FT                   /gene_family="HOG000088160" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:gsr1623"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:gsr1623 unknown protein"
FT                   /db_xref="GI:220910767"
FT                   /db_xref="GeneID:7291274"
FT                   /translation="MPCPESLPFLKELCWNIADPSLLSESEMLGIYERHWHYRRGVVLT
FT                   QTEQHWIQYLIATYGAVIESHEV"
FT                   /protein_id="YP_002486077.1"
FT   gene            complement(168441..168794)
FT                   /db_xref="GeneID:7291275"
FT                   /locus_tag="Cyan7425_0182"
FT   CDS_pept        complement(168441..168794)
FT                   /locus_tag="Cyan7425_0182"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_E0014 phage integrase family protein"
FT                   /db_xref="GI:220910768"
FT                   /db_xref="GeneID:7291275"
FT                   /translation="MKAVLPVRLPNASYRSREYLTLAEVNQLIEAAGDRGRHPLRVGKA
FT                   TSLEHRSLNLMMFRHGLRAGKVELLRWDSILAIILPVKPSVDFEQGISPTFLALNQGVE
FT                   NKTTPGSICCSNV"
FT                   /protein_id="YP_002486078.1"
FT   misc_feature    complement(<168558..168749)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Cyan7425_0182"
FT   gene            complement(168868..169752)
FT                   /db_xref="GeneID:7291276"
FT                   /locus_tag="Cyan7425_0183"
FT   CDS_pept        complement(168868..169752)
FT                   /locus_tag="Cyan7425_0183"
FT                   /gene_family="HOG000088161" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:alr7640"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:alr7640 hypothetical protein"
FT                   /db_xref="GI:220910769"
FT                   /db_xref="GeneID:7291276"
FT                   /translation="MNRLMNTLAIVTSLAIIQSCAQVPNAKEEPPITTITQQHSEHSVA
FT                   ETSHSHDSHGNTHSPPSPSTQATLTVPDKIRPNTPVSLQVDVKDQNGNALTQFDRFQEQ
FT                   IMHVIAVSQDLQIFQHLHPTYQGNGRFVVATHFPKSGNYTLFSDYQPAGQAEQVSVLKT
FT                   KVDGDTPFVSQINWSRTKTFGQTIVSFAPAKVAIKAEEDVTLQFNLEDATTQQPITDLQ
FT                   PYLGEKGHLVILRQSKNLSRKDYIHAHAVQNTPANQVHFVTSFPQPGKYKLWGQFNRNG
FT                   NIITADYWVEVIP"
FT                   /protein_id="YP_002486079.1"
FT   sig_peptide     complement(169687..169752)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.669 at
FT                   residue 22"
FT                   /locus_tag="Cyan7425_0183"
FT   gene            170097..171575
FT                   /db_xref="GeneID:7291277"
FT                   /locus_tag="Cyan7425_0184"
FT   CDS_pept        170097..171575
FT                   /locus_tag="Cyan7425_0184"
FT                   /gene_family="HOG000087937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: ava:Ava_C0187
FT                   transposase IS66"
FT                   /db_xref="GI:220910770"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:7291277"
FT                   /translation="MEPSDAHLAARMAAPEFDPEEMGVRYWYEQYLRQRAENAELRRQL
FT                   TQLEGEVEELKETLRKLKERDSGNSSQPPSSDGYKRKSKGLMPRQRKQGPKYGHEGKTR
FT                   YGFETVDHRLALSLAQCLVCGNALERDETTPVKRQQIAELVERPVEVWEYERPVYTCPL
FT                   CGWHGSAALPLGCREDFSYGARLSSLVGWLGYGGHLSWAKQRDLIAIIFGIPLSQGSLA
FT                   KMHRWFCESLYPSYESWWSLIQQPGVRCVDETSYPIDGVNYWMWVATSREVCVLFLAPS
FT                   RSSAEVESLLGKSFEGILSSDCWSAYSPQQATAKQKCLAHIQRELEALSGSRFESNRQF
FT                   ASQVSAIFERARQAYRGYHAGNLTVEQLQTQRLILEAELTDVLDHPPKTGWAADAQALA
FT                   NRFHRYWSDWFTFLRMPEVKPDNNDAERALRPVVIHRKTSGGARSAWGGQLVSLMFSFL
FT                   ETMRLQGQNAVAELFNLLAGVERAPPQLLPSTAE"
FT                   /protein_id="YP_002486080.1"
FT   misc_feature    170508..171017
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Cyan7425_0184"
FT   gene            complement(171912..172925)
FT                   /db_xref="GeneID:7291278"
FT                   /locus_tag="Cyan7425_0185"
FT                   /pseudo
FT   gene            173014..174288
FT                   /db_xref="GeneID:7291279"
FT                   /locus_tag="Cyan7425_0186"
FT   CDS_pept        173014..174288
FT                   /locus_tag="Cyan7425_0186"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /codon_start="1"
FT                   /product="transposase mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase mutator type; KEGG: ajs:Ajs_2156
FT                   transposase, mutator type"
FT                   /db_xref="GI:220910771"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:7291279"
FT                   /translation="MSNDNLIAFQAPDPPASFSDALTELVRNGARQIIAQAVEAELQGF
FT                   LAQYESLQDDQGRQAVVRNGYLPERTIVTGVGEVAIQVPKVRDRSGRGIKFNSTLLPPY
FT                   LKRVQSVEEVLPWLYLKGISTGDFSEALASLLGAQAAGLSASTISRLKAKWIKEHQQWQ
FT                   QRSLLGKRYVYLWADGIYFNIRNEDDRQCILVVIGVTNTGSKELLGLEAGFRESELSWK
FT                   PLLLRLQDQGLKQSPELAVGDGALGFWKALAQVFPTTRVQRCWVHKTANVLNHLPKGQQ
FT                   PKAKSALHEIYMAETQAEAQTAFDRFIKTYDAKYPKAVACLSKDREALLAFYDFPAEHW
FT                   VHLRTTNPIESTFATVRLRTDKTRGCVSQESILSLVFKLVQSAQKRWLRIRGFKHLAEV
FT                   IEGVKFKDGLRADQQLDFKDSRNAA"
FT                   /protein_id="YP_002486081.1"
FT   misc_feature    173071..174183
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Cyan7425_0186"
FT   misc_feature    173590..173832
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Cyan7425_0186"
FT   gene            complement(174405..174578)
FT                   /db_xref="GeneID:7291280"
FT                   /locus_tag="Cyan7425_0187"
FT   CDS_pept        complement(174405..174578)
FT                   /locus_tag="Cyan7425_0187"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910772"
FT                   /db_xref="GeneID:7291280"
FT                   /translation="MAKEKLGGKLVLQLLSSLIKLKSISTLGDFVWIYLWIDLDAEFSC
FT                   HTDIYCLGLMKG"
FT                   /protein_id="YP_002486082.1"
FT   gene            174601..174702
FT                   /db_xref="GeneID:7291281"
FT                   /locus_tag="Cyan7425_0188"
FT   CDS_pept        174601..174702
FT                   /locus_tag="Cyan7425_0188"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910773"
FT                   /db_xref="GeneID:7291281"
FT                   /translation="MLVPGLQAGVIVQAANWVTATIQTPTNASVAPR"
FT                   /protein_id="YP_002486083.1"
FT   gene            complement(174818..175900)
FT                   /db_xref="GeneID:7291282"
FT                   /locus_tag="Cyan7425_0189"
FT   CDS_pept        complement(174818..175900)
FT                   /locus_tag="Cyan7425_0189"
FT                   /gene_family="HOG000063198" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: azo:azo3816
FT                   putative AraC family transcriptional regulator"
FT                   /db_xref="GI:220910774"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:7291282"
FT                   /translation="MTLPQKPPIDVAIVAVPETAGSALYGMVDVLLAAGNLWQTLVRSE
FT                   ETARLFRVRILSVRRDPFVCGNGIPVRPDLSVRDSYTPEIVILPELWLGPDEDMQGRYP
FT                   DLMKWICQQHAKGAFIYSACSGAIMLASTGLLDGCDATSHWGYQDLFRKRFPTIRFKPA
FT                   PNLTFADASGQIVTAGGTTSWHDLAIFIISRHCSPGEALRIAKVYLLKWHSEGQLPYET
FT                   LIRNHVHADSVVTNCEQLLRQCFRESNAIQQIVSQSKIPERTLKRRFKAATGSTLIEYL
FT                   QNLRIEEAKHQFEVSDKSVESICYEVGYEEVSFFRRLFKRLTGITPSQYRRMFQPLLTA
FT                   SNPSEKEISRSRSARSSSLV"
FT                   /protein_id="YP_002486084.1"
FT   misc_feature    complement(174899..175891)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="Cyan7425_0189"
FT   misc_feature    complement(175271..175870)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_2; cd03138"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Cyan7425_0189"
FT   misc_feature    complement(175529..175531)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Cyan7425_0189"
FT   misc_feature    complement(174905..175015)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Cyan7425_0189"
FT   gene            176052..176621
FT                   /db_xref="GeneID:7291283"
FT                   /locus_tag="Cyan7425_0190"
FT   CDS_pept        176052..176621
FT                   /locus_tag="Cyan7425_0190"
FT                   /gene_family="HOG000116585" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /codon_start="1"
FT                   /product="OsmC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OsmC family protein; KEGG: gsu:GSU2788
FT                   hypothetical protein"
FT                   /db_xref="GI:220910775"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="GeneID:7291283"
FT                   /translation="MSQQLMNQTMNGLNVDTLVVTVDAIKQTPSLAQFEFRATNQWING
FT                   GENRSRIKEFYGAGQEDESRTEAFEFTNGEPPVLLGANEGANPVEYLLHALAGCVTTTT
FT                   VVHAAARGIQIDSISTKLVGQIDLQGFLGLNDSVPVGYETIQIEMDIKADCSDEELNEL
FT                   LSFAKDHSPVCNTVCRPVPVTLKRVS"
FT                   /protein_id="YP_002486085.1"
FT   misc_feature    176292..176609
FT                   /note="OsmC-like protein; Region: OsmC; cl00767"
FT                   /db_xref="CDD:186180"
FT                   /locus_tag="Cyan7425_0190"
FT   gene            176722..176883
FT                   /db_xref="GeneID:7291284"
FT                   /locus_tag="Cyan7425_0191"
FT   CDS_pept        176722..176883
FT                   /locus_tag="Cyan7425_0191"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:220910776"
FT                   /db_xref="GeneID:7291284"
FT                   /translation="MEIKILIQPMQEEADQWTLIVSRLTPAEFVKTLGQVALTDQSQLA
FT                   EVDQVYGH"
FT                   /protein_id="YP_002486086.1"
FT   gene            176969..177349
FT                   /db_xref="GeneID:7291285"
FT                   /locus_tag="Cyan7425_0192"
FT   CDS_pept        176969..177349
FT                   /locus_tag="Cyan7425_0192"
FT                   /gene_family="HOG000232012" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ilo:IL1591
FT                   glyoxalase/dioxygenase superfamily protein"
FT                   /db_xref="GI:220910777"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="GeneID:7291285"
FT                   /translation="MKLNHVTLIISNFERSLTFYKTLGLIQIVHAPPRYARFQCPDGDA
FT                   TLSIEVTGELPAPPCVQIFLECSALDRTVADLKIRGLIFEQDPTDMPYLWREARLKDPD
FT                   GHDIRLYFAGDNRLNPPWKIGG"
FT                   /protein_id="YP_002486087.1"
FT   misc_feature    176981..177298
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cd06587"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Cyan7425_0192"
FT   misc_feature    order(176981..176983,176993..176995,177080..177082,
FT                   177110..177112,177152..177154,177263..177265,
FT                   177287..177289,177293..177295)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Cyan7425_0192"
FT   misc_feature    order(176981..176983,177152..177154,177293..177295)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Cyan7425_0192"
FT   gene            177372..177860
FT                   /db_xref="GeneID:7291286"
FT                   /locus_tag="Cyan7425_0193"
FT   CDS_pept        177372..177860
FT                   /locus_tag="Cyan7425_0193"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Lferr_2766"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afe:Lferr_2766 hypothetical protein"
FT                   /db_xref="GI:220910778"
FT                   /db_xref="GeneID:7291286"
FT                   /translation="MTLRQKLSLLSGWSTEILIDAPQQLVWERITDFERYSEWNPFMLE
FT                   AHAQFKVGSTIRFLEDLKQFGQHWLTAKFLAIAPPNEFIWQGHVGAPFLFSVRHTFCLE
FT                   TVSDTVTRFIQKHENFGVLVPYLALRGVYLVSYQGYLAYNQALKERCSETDPHLWIDC"
FT                   /protein_id="YP_002486088.1"
FT   misc_feature    177408..177824
FT                   /note="Ligand-binding SRPBCC domain of an uncharacterized
FT                   subfamily of proteins; Region: SRPBCC_4; cd07822"
FT                   /db_xref="CDD:176864"
FT                   /locus_tag="Cyan7425_0193"
FT   misc_feature    order(177408..177410,177414..177416,177420..177422,
FT                   177447..177455,177459..177464,177498..177500,
FT                   177522..177524,177528..177530,177534..177536,
FT                   177540..177542,177585..177587,177591..177593,
FT                   177618..177620,177624..177626,177666..177671,
FT                   177675..177677,177681..177683,177708..177710,
FT                   177714..177716,177720..177722,177726..177728,
FT                   177765..177779,177783..177791,177795..177803,
FT                   177810..177812)
FT                   /note="putative hydrophobic ligand binding site; other
FT                   site"
FT                   /db_xref="CDD:176864"
FT                   /locus_tag="Cyan7425_0193"
FT   gene            178166..178423
FT                   /db_xref="GeneID:7291287"
FT                   /locus_tag="Cyan7425_0194"
FT   CDS_pept        178166..178423
FT                   /locus_tag="Cyan7425_0194"
FT                   /gene_family="HOG000088073" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ava_4485"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_4485 hypothetical protein"
FT                   /db_xref="GI:220910779"
FT                   /db_xref="GeneID:7291287"
FT                   /translation="MKLSYRGIQYDYHPRPGTTGKPAPAAQAQPYTLTYRGTSYQINPR
FT                   VPKPPAVNFPNGYELIYRGNRYSVPSTQTLQPAAVLAHSL"
FT                   /protein_id="YP_002486089.1"
FT   gene            178556..178909
FT                   /db_xref="GeneID:7291288"
FT                   /locus_tag="Cyan7425_0195"
FT   CDS_pept        178556..178909
FT                   /locus_tag="Cyan7425_0195"
FT                   /gene_family="HOG000036660" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyt:cce_2709 hypothetical protein"
FT                   /db_xref="GI:220910780"
FT                   /db_xref="GeneID:7291288"
FT                   /translation="MTYTADSAIDFNAVARELLSAQPLRSVATPVAGRSNGTELVPTEV
FT                   NARIRREGQTFGRSLGLGATVDREGLSNNYAVEPQSYLALYPSPNEQRVYWLQGAAALV
FT                   LVTLTLLTAVAVS"
FT                   /protein_id="YP_002486090.1"
FT   gene            complement(179055..179492)
FT                   /db_xref="GeneID:7291289"
FT                   /locus_tag="Cyan7425_0196"
FT   CDS_pept        complement(179055..179492)
FT                   /locus_tag="Cyan7425_0196"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lic:LIC20258 hypothetical protein"
FT                   /db_xref="GI:220910781"
FT                   /db_xref="GeneID:7291289"
FT                   /translation="MKSNLKVLFPSLISLILYGLSLAFPAFEFLHSRGPRIEVWPGWQV
FT                   LFMGWLGIFFYQVGWYANPLYIISIGLWWGRVWKGVAVLGTIAIVLGLNTFFLFYQRVY
FT                   ADGAGATLQLQSLKIGFYFWIVSISIPALWSCRQLWLASKP"
FT                   /protein_id="YP_002486091.1"
FT   sig_peptide     complement(179421..179492)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.790 at
FT                   residue 24"
FT                   /locus_tag="Cyan7425_0196"
FT   gene            complement(179506..179967)
FT                   /db_xref="GeneID:7291290"
FT                   /locus_tag="Cyan7425_0197"
FT   CDS_pept        complement(179506..179967)
FT                   /locus_tag="Cyan7425_0197"
FT                   /gene_family="HOG000088086" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:all7109"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ana:all7109 hypothetical protein"
FT                   /db_xref="GI:220910782"
FT                   /db_xref="GeneID:7291290"
FT                   /translation="MIKYGQYGLAVTAYFGLSYVLFLSTSNTIVGGIVYLFLLLPFYAT
FT                   VLLILWIIVLQNRNKKVQIKKWIWGCVLLLQIITILVSPGNCFQAKEGSPCYSNLQILI
FT                   GNAPRTGPGKVSHWTFVENAFPGLVFAYSVAVALALFPMKNLSIKNTLN"
FT                   /protein_id="YP_002486092.1"
SQ   Sequence 179973 BP; 46334 A; 44076 C; 44278 G; 45285 T; 0 other;
     ATTCTATATA AATGTATTTA TCTAAGTTTT GTCATCAAAA GTATAGATCC CAAAACTTCT        60
     TAAGTAGATT ATATTCATGA ATTGCCAGAC CTTGAGCGTT CCTACCAGTA ACCTGACAAG       120
     GAGCACCTTA CCCCCTTTGC ACTGCTGATT TTTCATTCCC GCAACGACTT TCTATCGAGT       180
     TTCCCTAATG CCGTATAGGG AAGCTCTCTA TGGAATTCAA TCACTGCAGG CATTTGGTAG       240
     CGCGCCACTC GTGGTCTTAA CCACACCCGC AATAAATCTT CGCTCAACAT CGTGGGCTGT       300
     TTTGTAACTA CCACCGCCTT CAGTCGCTGG CCAAATTCTG GATCAGGAAT ACCTAAAACG       360
     ACTGCTGCCT CGATATCAGG ATGCTGACTA AGAATAGTCT CCAGGTCGAT TGGGTAAACA       420
     TTTTCACCCC CAGAAACAAT CATATCGTCC ACTCGTCCGC AGAGAAAAAT ATTTCCCTCG       480
     GTATCCTGGT AGGCTAGATC ACCAGTTTCA ATCCAGCTAT TGGCAGCAGT AGACCAGGCA       540
     CTACGAATAC AGAGGCGGCC AATCTGATTG TTGCCGTATT TGTTACTGTG CTCCTGGCTC       600
     CCATCCCTGA CAATTTTGAC CTGTACTCCC CCCACGGGTT GACCAATGGA TGCGGGGTTT       660
     TTCCTGAGTA TACGGGAAGT TCCCAGGATG CAAAAACCTG CCTCTGAGGT GCCATACAAA       720
     TTAAAGAGAA TTGGCCCCAA CTGAGCCAAT GTATCCTGAG CCAAAACCGG ACTCAATGCC       780
     GCTCCACCTG TGAGGATACA CTTTAGAGCG GATAAGGTGG CTGGGTTATC CCTCAGCATC       840
     CGCTGCAACA TCAACGGTAC CAGTGTGACA ACTTCGATTT GATGACTGGC AATCAGGGAA       900
     CAGGCTTGTT CGGTCTGAAA GCGAGAGGTA ACGTACAACT CCACCCCAAG TACGATTCCA       960
     ATCAGTAGGG CTGCCAAACC GAAACCATGA TAAATCGGTG TTGCAATGTA GAGCGATCGA      1020
     TAGCGATCCA GGTGTACTTG CTCCAACAGG GCAATAAAGG GGGGCAGAAA TTTGACCATT      1080
     GAGGGTTTAC GGCTCGCAGG CTTCGGTGTT CCGGTTGTAC CCCCTGTCAT GACGATAATG      1140
     TTGCCAGTTT TCACAGGTTT GAGATGCCGA TTGACAACTT CAGGGCTTAA GGGTAGTTGA      1200
     TCAATGGCAG ATGCGGTAGC ATGGTAGGCT GGGAGTGCCT GACGCTGTTG AACCGCTACT      1260
     TCCAGCCAGG GGGGGAAAGG TTGATCGGGC GGGTGGTCGT AGATATAAAA ATCGATCGCC      1320
     AGACGGTCGA GGGTAGCTTG AATCTGGTTA GGACTCATCT CTGGATTGAG CAGATAAATA      1380
     TGGGCCCCCA GTCGCGATCC AGCAAAGATA GCCTTAATGC AAGCCGCATG GTTGCGGCAG      1440
     GCAACCGCAA TGTTTTGCTG CTGTTGGATG CCATACTCAC TCTGCAAGGT CATCGCTAAG      1500
     GCTTCTGCCT GTTGCCAGAG TTGACGATAA CTATAGTGAT CATGTTCGTC GATAACAGCC      1560
     AGGCGTTCCG GGTGTAATTG AGCTGCCAAG CGTAACAGGG CCATCAGGTT CATCCCCGTA      1620
     GTCAGGAGTG CTTCAAGCAG ATAGAACAAT CCCATTGGGG TTAGTAATTT CGTCCGATAC      1680
     AGTTTACGGA TGAGCGATAA CATAGCCCTC CCACTATTTG TGCTTGCAGT AATAGTTAAG      1740
     CCCAATTTCC CATAAGCTGC GAAACAGCAC AGAGCCAAGC TGCCCAATCA ATAACCACCA      1800
     GGGAGCATAA GTACTTCTTC GGGAAAGCAT CGCTTGACAA ATCAATTGAG CCACTTGCTG      1860
     AGGCTGCATT GCGGGCAGGT GACGATACAT CAGGGTTGGC TCGATCATAC GGGTTCGTAC      1920
     CAGCGGTAAA TAAATGGATG TAGTACGGAC ATTCTGGGCA TTTAATTCAG GACTGACACA      1980
     ACGAAACCAT TGATCAAAAG CGGTTTTAGA GGCCTGATAG GCTGACCACT GGGGAGTGGG      2040
     GATTAACAGC ACGTTTACCG CTGAGATATT GATTACCTGT CCGCGCCGCG CCACTAGAGC      2100
     GGGAATGAGT CCCAGCATGA GTTGGACAGG CGCAAAATAA TTCAGATACA TAGTGCGGGT      2160
     AAAATCATGG TAGCGATCGA GGGAGTCAAA AATGGAGCGG CGAATTGATT TCCCGGCATT      2220
     GCTGACAAAA ATATCAATCC CTCCAGGGCG CTGTTGCAGT GTATTGATCA GGGCTTGAAC      2280
     CTCTACCGCG TTTCGCAGAT CACAGGGGAA AATTTCAGCG TGGCCTCCCT GGGATTCAAC      2340
     ACGTTGTTTT AGTTCCACCA GTTTGTCCTT TGTGCGTGCC ACCAGTAGCA ACTCAGCCTG      2400
     TGTCCCTGCC AACCTGGTCA CCAAGCACTC GCCAATACCG TAACTTGCAC CCGTAATCAG      2460
     CACGGTCTTT CCCCTTAAAT GCCTTTGAAG CTGAGTGTCG CTAAAACTGA GGAAGGGAAA      2520
     AAATAGTATT CTCATTTGGA GATCATCATC TGTAACCTAA GTCTCTCCCA TTATTGATCT      2580
     ATAGCAATTC AACTGAAATT TAAGTAAGGT AAAAGGGGGC TTGTTCCCAA CCGGTCTAAA      2640
     GTTGCTATAG GTTGCTGTAA ATTATCCAGA ATAGTGCAAT CAGCCCGAAA GCTAGCTGAC      2700
     ATTTTCAGAC ATTTTAGATA ATGGCATTTG TGAGCACCTG TTCAGTTCAA CCGGCTTTAA      2760
     TATGTACGTT TTAACCTGTT TATACTATTG ACATGAAATT TGTTCAGAAT CCTATCAGCA      2820
     GAATTATCTT AATTGTTATT GCGGTATCCG CCACCCTAGG AATCATCTAT GGCATTAACC      2880
     AACTGGGAGG CTGGCTTTGG AGGGATACGT CGCTGGTATG CCGTAAAGAA AAATTGAATG      2940
     CGCTGGATGT GACTGCGGAT GGCAAAACCC TAATCACTGG AGGCAAGGAG ATCAGAGTAT      3000
     GGGACATTGT CAGTGGCAAA AAACTTTATG ACAGTACGAC GGTTGGTAGC ACTGTGAAAA      3060
     AAATGGCAGG GCTATCCCCA GCAACAATTA GTACTCTGAA CATTACCCCT GATCAGCGGC      3120
     TGTTTATCAC TGCTGCCAGT TCATTAGGAG GGATCGGAAC CCAGGGACAG CACGAAATTC      3180
     AGATTTGGGA TTTGGTCAAT CGTCAACTGC TGCGTACTCT TAAGGGGCAT CGCGATCGAG      3240
     TCAGGTTTTT AGCCGTTAGT CCAGATAGTC ATACCCTGGT GAGCCAAGAT GATAGCGGTG      3300
     TCATTCAAGT CTGGAATCTA GCCACAGGTC AAGTAAGGCA AACCCTGAAT ACAGAACGCA      3360
     GACAACGTTT TCCCATTGTG CTCAGCCCCG ATGGTAAGGT GTTCGCCAGC ATGAATAAAC      3420
     AAGGTACAGT TACCTTCTGG AATATCACAA CCGGCCAAGC AGTGGGCAAA CTGCAAGCTG      3480
     ATCCAAGCCA TACTCCCCTT GCCATTAGTG ATAACAATCA AACCTTGTTG ATCCAGAATG      3540
     CTGGGGATGT GAAACAGTTC CGAGATATCG CAACTGGGAG AGAGTTAACC AGACTCAAAG      3600
     GTAGCTATAT CGAATTTCCC TTCACGGTTG ACCCAAGGGG GGAACAGGTG CTGATTCAAA      3660
     CCAATACAGA TCTCAAACTC TATAACCTGC TTACAGGGGT AGAACTGAAA ACTTTTAATA      3720
     TGAACAATTT CTACAACCCG ATCTCAATTA CCCCAGATGG TCAATCGTTT CTTACCATCG      3780
     ATAGCCAAGA CAACTATGTC CTCTGGAACA TAGCAACGGG AGCCAAAATT CATCAACTAG      3840
     AAGGTAAGGC TAGTCGAGGG GAATATGAAA TAACGACAGC TCAAATTCTG GTCAATGGCG      3900
     ATCGTAACGG CAATGACCTT ACCCTGTGGA ACTTAACAAC TGGAGAACGT ATACGAAAAT      3960
     TTTGCAATCA ATAAGCTTGT TATTATTGCC AGTATCTCCA TCGTCACGTG GACTTGATCC      4020
     CTCTCCGTCT ATCGGGCTTT TACGATCGGA AGTTCTGCCC ATTGGGTTGT ATAGCGAGGT      4080
     GAAGGTTTGG AGGAGCGCAT TTGCCAGGGT TTCGTTACAC CCGCCGCCGC AAACTGAATT      4140
     GTCCCTCTGC CAAACTTGTG GTTAATCTGG TCGATCGTGT CCATTAGCAA ACGGTAGCAG      4200
     TCACGGTTAC GGTGATCAAA CAGATGGGGC TGCACCAGGG TGAGAGGCAT CAGGTTCACC      4260
     AACATTACCC CTACTTTTTT GTACAGGTAC TCGGGACGGT AAATTTTCTC TAACCCTTGC      4320
     AGAACATAGT GGATCAATTC AGCGGTGTCA TCGGTGGAAA CGGGGAGGGT GATCCGGACC      4380
     AAGTTCTGGT AGGTGGATCA TCTCAATCAT GTAACAGCCC ACAAATCCTG AACCACCTGT      4440
     GACAAAAACT TTCATAGTTT TTTATTGCTG CAGTGTCAGC AGTTTGAATG ACCCGCAAAC      4500
     TCTACTGTTG CCCTAACTTC ATCCATTGAG CGGTATAAAC CATATCTCGC ATAAACGCAG      4560
     TCAGGTCTAA CACAAACGAT GCCATGCACA GAAATAGAAT GGCACTACCA ATCCCGATCA      4620
     CGATCGGTCG GCGCAAGGTG AGCAGAGCTA TGTTTATTTG TGGTGTATGA GCAAAGGAGA      4680
     GGAAAGGGCG TATCCTGCTG GATAAGCAAA AGTAAAAACC AGACGAGGAT ACCCCATGAG      4740
     TAACGACAAT CTTATTGCAT TTCAAGCGCC AGACCCTCCC GCATCGTTTA GTGATGCCCT      4800
     GACAGAACTG GTCCGTAACG GTGCTCGCCA AATCATTGCT CAAGCTGTGG AGGCGGAATT      4860
     GCAGGGGTTT TTAGCTCAGT ACGAATCGCT TCAAGATGAC CAGGGACGCC AAGCGGTGGT      4920
     GCGCAATGGG TATCTGCCTG AACGCACGAT TGTGACTGGC GTGGGGGAGG TTGCCATTCA      4980
     AGTGCCTAAG GTGCGCGACC GCAGTGGTAG GGGGATCAAG TTCAATTCGA CGCTGTTACC      5040
     TCCGTACCTC AAACGGGTCC AGAGTGTGGA GGAGGTGCTG CCCTGGCTGT ATCTCAAGGG      5100
     CATTTCAACC GGGGATTTTT CCGAAGCCTT GGCATCCTTG CTGGGAGCCC AAGCGGCAGG      5160
     ACTTTCGGCC AGCACCATCA GCCGCCTGAA AGCCAAATGG ATCAAAGAGC ACCAGCAATG      5220
     GCAACAACGA TCACTACTGG GGAAACGGTA CGTGTATCTG TGGGCGGATG GGATCTACTT      5280
     CAACATCCGC AACGAGGACG ACCGCCAATG CATCCTTGTT GTCATCGGTG TCACCAACAC      5340
     AGGCAGCAAG GAACTGCTGG GATTGGAAGC CGGATTTCGA GAGTCCGAAC TGAGTTGGAA      5400
     GCCGTTGTTG TTACGTCTGC AAGACCAGGG GCTCAAACAG TCCCCCGAAC TGGCGGTTGG      5460
     AGATGGCGCC TTAGGGTTTT GGAAGGCGCT CGCGCAAGTG TTCCCGACCA CTCGTGTCCA      5520
     ACGCTGCTGG GTGCACAAAA CTGCTAACGT CCTCAACCAC TTGCCCAAGG GTCAGCAACC      5580
     CAAAGCCAAA TCAGCCCTGC ATGAGATCTA CATGGCAGAG ACTCAAGCTG AAGCACAGAC      5640
     AGCGTTTGAC CGATTTATCA AGACCTATGA TGCCAAATAC CCCAAGGCGG TGGCGTGTTT      5700
     ATCCAAAGAC CGTGAAGCCT TGTTAGCCTT TTATGATTTT CCGGCTGAAC ATTGGGTGCA      5760
     CCTTCGCACC ACCAATCCCA TTGAATCCAC CTTTGCGACG GTGCGCTTAA GGACGGATAA      5820
     AACGCGAGGC TGTGTTTCAC AGGAGAGCAT TTTGTCCTTG GTGTTCAAAC TGGTACAAAG      5880
     TGCCCAGAAA CGGTGGTTAC GCATTCGAGG CTTCAAACAT TTAGCAGAGG TAATTGAAGG      5940
     AGTGAAATTC AAGGATGGCC TTCGAGCAGA CCAGCAACTC GATTTCAAGG ACAGTAGGAA      6000
     CGCCGCTTAA TTCTTCTTCA TACACCAGAT TTGACAATAA CTCAGGTGAG CATGACTGCG      6060
     ATCGCCATTC CACCTGCAAC CGTCCAAATC GTTGCCAACT TTTGAAAATG CGGAACTCCT      6120
     CTCTCGGCTC CATAGCGATC GATAATGGCT TGCCGAGCAG CATTAAGGTT TGTCTGAGCA      6180
     GATGCTAAAT CAGCCTCTAA CTTTGCTGGA ATGCCAACTC GGTAGCTGTA AGCTGCACCA      6240
     ACGAGACTAC TGCCAATCAC GGTTAGGACG ATCGCCGCAG CTAACCAGGC ACGTCGATGT      6300
     TTAATCGATT GACGGAACCA AACTACCCAG GTAACAAGGG CAGCAATTGC TACAGCAACC      6360
     ATGTAGATGA GCAGATCACG ACTCAAGTCA CCGTAAAAAT TACGAATCAG TGAATCAATG      6420
     TTCATAGCTA ATCAAAATTA CTTTGCATTG AACGATTGCA GATTCAACTA ACCTAACTTG      6480
     AAAGACATCT AAGGATGCAA TTTCACGAAG TTAATTCAAT GCGTTAATAT CTTGAGTTAG      6540
     TGTTACTTTG CGACGTTTTT TTGAGTCTGA TACTTCACCC ATTGGAAACA TCCGAGACAT      6600
     CAATGCATCC CAAGCGCGAT CGGATAGTAG ACGACGAACC CAGATGAAGA TCTTGCCACT      6660
     CAATCCGACT GTGTAACGAG TCTGAGGACG ACGCACAAAA ACTGCCTGCA CAATCACCTT      6720
     CGCAACATCC TCTGGATTTA GAATGCCCCA GGCATTGCCT CTAAACATCT GCCGAATTTG      6780
     GGCTTCAATG TTTCGCTTGA ATGCGGCATA GGGGCTATCA CTTCCCGTTT TCGGCATCAA      6840
     TGCATAGAGC TTCTCAACAA ATGGCGTTCG CACTCCCGTT GGTTGAACCG AAACGACATC      6900
     CACTCCAAAC GGTTGTACCT CGTAGCGTAG GGCATCCGTG AATGATTCAA CCGCATACTT      6960
     ACTGGCGTGA TAAGCTCCAT TTCCAGGGGT GGTGAAGTTT CCGCCCATTG AGCTGACGTT      7020
     GATAATACGC CCATAGCCCT GCGATCGCAT CCCTGGCAGT ACAAGCTGGC ACATCCGCAA      7080
     TAAGCCAAAC ACATTGGTTT CAAACTGACG GCGAATCTCC TCCATCGTCA ACTCTTCCAG      7140
     GGGGCCGATC TGGCTGTAGC CCGCATTATT GACTAACACA GAAATCGCAC CATGCTTCGC      7200
     TTCGATTGAT CGCACAGCGG CAAGCATTGA CGCTTCATCC GTAACGTCGA GTTGAAGAAT      7260
     GTGGCACCCT TTTAACGCCA GATCACTCAA TGTTTGCGGA TTTCGAGCGG TCGCATACGT      7320
     CGTGAATCCG GCTGATTTCA GGGCGATCGC GGTCGCTTTT CCAATGCCAG AGGATGCACC      7380
     CGTAACCAAT GCCACTCCAT GTTTTACTAC CATGCTTGCA ATATCTCCTT ATTGATTGAC      7440
     TAGCAAACTA CTTAAATTTA AGTAAGCGAT AGGACAAAAA AATTAGCGGC GGCGCATTCC      7500
     ATCTAGCAGG ATGTCGATCA TATCCTTCGC TAAAACCTGC TTTGGAATGT TTTTGTATCG      7560
     ATGCATATCA TGAGCGGTAT CGACAAGAGA AAGAAACATT GTAGCCATCA ATTTAGAATC      7620
     CACTAAGCGA ATTTCTCCTC GCTCATAAGC CTCTGTCAAA ACCTGCTGGA TAGGTTGTAC      7680
     GAGAGAAATC TCTCCCAACG CCATTAGGGT TTGAGCGTGG TCTAGAGAAA GGGCCGGAAG      7740
     ATCCGATCGT GCCAGACGGG TCATATCGAG TGGAGGCTGT GCTAACAACC AGTCCGCCAT      7800
     CTGGTTCAGT TGACTGGATA GGTTGGGTTC TGCTTGTGAA ATAGCGCGAT TTAAGCCATG      7860
     GAGATGACGC ATGAGACTGC GCTTGATCAC CTCAACAAAC AGCTCCTCTT TACCCCCTGG      7920
     GAAATGGTAG TAGAGCGCAG CCTGACGCAC CTTAAAGGCA TCTGCAATAT CTCGTAGAGT      7980
     AACAGCTGTA TAACCTCGCT CGCCAAACAG AGCTTCAGCT AGTTGCAGCA GTTGCTCCCG      8040
     TGAATCTCCA GATTTTGCCT TTGCACTCAC ACGCTATTTG AACCAGAACT TACTTAATTT      8100
     ATAGTAAGTA ATATAGCGAG CGTGTAAAGA GCTGTCAAGC GTTTCCTGCT ACTTCAAGTT      8160
     TTTGGATAAT AGCTACGGCG TTCGCGACTC CATCTTCATT GCGGATTTTT ACACCCAAGT      8220
     CTGCTGCATG CTGACGCATC GTGCGATCGC CCACCGCCGT TTGAATCGCT TGTGCCAACC      8280
     GTTCAACGGT AAGCTGTTTG CGGGGAATTG GTGCTGTGCC CACGCCCAAA TTTGCGACCC      8340
     GTTGCCCCCA AAAGCCCTGA TCGCCAAAAA ACGGAATAAT GACCGTTGGA ACACCTGCCC      8400
     GAAGCCCTGC GGCGGTCGTG CCTGCCCCTC CATGATGAAC CACTGCCGCA ACGCGCGGAA      8460
     ATAGCCACGC ATGGGGAACT GAATTGACGA GAAAAGCGGT GTCTGGCAAA TTTTCTGTTC      8520
     GCATTCCACT CCAGCCAGCC GACAGAATCG CCCGTTGCCC TGTTTTGTCG AGGGCTTGCA      8580
     AAACTAGACT GGCCGTTTCT TCAGGATTGC GATTGCCCAT ACTGCCGAAG CCGATATACA      8640
     CCGGAGGCGA ACCCGCTTGC AAAAAGTTTT CCAGGTCTGA AGGAGGAGTC CAATCAGGTG      8700
     CAGCATCTAA AAACCAATAG CCTGTGACAA AAGTATTTTG CCAATCTGAC GGCTGAGCAA      8760
     TCACAGAAGG ACTGAACCCA TAGAGGGTTG GTAGACGATG AAGATAGGGA GACTGGTGAG      8820
     GACCGAACAA CGAAGCTGCG GGTAGGTTGA GAACTTGCCG ACGGGCAGCG GTATCGCCAG      8880
     CACGAGAGCC TTGCCAGATG ATCTGACGGA GCACTTGATG GGAGAGCCAG TTCACCGTCC      8940
     CGCCAAAGCG ACCCATCGAC TGGGAAAATA AGATCCCCGG AAATGTTTTG GTTGGCGTAA      9000
     AGGGAAACAC AAAGGCTGGC AGCAGGGGAA TTTCTAGCTT TTCTGAGATC GCCAACGCCA      9060
     GATAAAGCCC TCCTACGCCT GCAATAAGTA AATCCATTCC ACGACAAGCC TCTAGCCCCG      9120
     CCTGTGCCCA GCGAATTGAC ACCTTTTCGC TTTCCTTCGC CGTCCGCAAG GTCAGCGTAA      9180
     TGAAATTCCC TTTCTCGGCA AGCTCACGCA TTTCTGGTGT TTCAATCAGT TCTTGCACAT      9240
     TCCCTTGCAT TGGATAGAAT GCCAGCCCGT GGGAGGTGAC CTGCCCTTCA AAATTCTCAT      9300
     GGGTCAGTAG GCGAACATCG TGCCCCCCTG CTTTTAGCCC TTTCCCTAAG GCGATATAGG      9360
     GTTGAACATC TCCCTGACTC CCCAAAGCAA TGATGGCGAT ATACATCACG GGTGCCTCCT      9420
     ACGTAATGGA TTGGAGCTTA TAGACAAAGG AATGATACTT ATATCAGTTT GACAATAACG      9480
     TCATTTTGAC GAAAGTGTCA ACAGCAGGGT ATGCTAAAGT TGGTACCGTT CAAGGCTTTT      9540
     CCATGAAACC TTCTCGCCGC GCCGCCATTG GTCTGGAAAA AAGGGAACGA ACGCGATCGC      9600
     ATTTAATCGA GTCCGCCTAT CGGGTATTTG CGCGTAAAGA AATGGATGCG GTCACGATTG      9660
     ATGACATCAT TGCTGAGGCA GGGGTTGCCA GAGGAACATT CTATAACTAC TTTCAAACTC      9720
     GCGAAGAGGT GCTGAGAACT TGTTTGAAAA GTCAGAGGAT AGGCTATCTA GCTTGATTTT      9780
     TGGGTTTTAA TCGACGAACC ATCAAATGTA CCATAGCGGC AAAGAGCATC ATTTCACTTG      9840
     TCGTGGTCAA AAATTCATAG TCTTTACTCA AGCGGCGATA ATGCCCAAAC CAGGCATAGG      9900
     TTCGTTCCAC CACCCATCGT TTCGGAATGA CCTGGAAACC CGGCTCAGTC TTTGTGGGTT      9960
     TGAGATGTTC GAGCGACCAG CCAAAGTGCT GAGCGATGGT GGCGATAAAG TTTTTTCCTG     10020
     CAAAGGTGCT GTCTACCCAA ATCACCTTGA GACAAGACCA AAAGGCAGCC CAAAAGGTGG     10080
     CAAGTAAAAC CATTCCCTGA TGGTCAGAGC GTTTGGCACT GTGGACACAC ACACCGAGTA     10140
     ACAGTCCCAT TGTATCGACC AGGATGGTGC GCTTGCGTCC CTTGACTTTC TTGCCGCCAT     10200
     CAAAGCCGAT GTCCTCCCCT CCCCTCGCAG TTTTGACCGA TTGGCTGTCT ACACTCCCGG     10260
     CACTTGGTTG AGCCTTGCGT CCCGCTGCCA CTCTCACTTC GGTGCGTAAT GTCTGATTCA     10320
     GCCGTTTCCA CGTCCCATCC GCTTCCCACG CTCGAAAGTA GGTGTAAATG CTGTGCCAGT     10380
     TGGGGAAATC ATGGGGCATC GACCGCCATT TAATCCCATT GCTGAGCAAG TAAAATATCC     10440
     CATTCAAGAC TTCACGGATG TCGAGGCACC GAGGACGGCC ACCGGGGCGG GGCGGAGGGA     10500
     TTAAGGGTTT GAGCAGTTCC CACTGTTCAT CTGTCAGATC GGTATCGTAA GATTGTCGTA     10560
     TCATTTGGGG GTCTCGCTGA AGACCCTTTT ACTTTATTTC AGCCTTGTGA ACCTCTGAGC     10620
     GGACAGCTAT CCAACTTTTC AAACAGTTTC TGAGAGCTGT TGCAGCGTCC CTGAGTGATG     10680
     TCATGAATCA AAAAATTTGG GCACAGTATG CGTTGATCCA AGACCCGGCT GAACGAATGG     10740
     CGATCGGTTT GCGGCAGTTT CTCCATCAAT CCATGCAAGA TGCGACGTGG GGATGGGTGA     10800
     TTGTTCGTAT TGGTTTAGTG GCAGCTCCTT TGAGTGAAAC GATCGAACGG GGTTTGCTGT     10860
     CGGATTTAGA AGCGGGAATA CGGCTGCAGC GGTTTCAGGT GGAGAGTACA CAAGCCGCGA     10920
     TCGACCTGAT TTTAGGAACG GCACTGATGG CAATGCGGAC CATTTTGGAA GGACATAGCG     10980
     AAGCTAACTA TCCAGAACAA GTGACGAAGT TAATTCTCAA ATCTTTGGGA GTGAATCACG     11040
     ATGATGCAGA TGAGATCGCA TTTAAAGCGC TAGAGCCTTT TCCAGAGAAG TAATCTGTTG     11100
     ATTGCCAGGG TCTTACCGAT TTAAGTTTTG ACGAAGCGGC AGTGATTTTA AGCCAGAAGT     11160
     TGGGGCGATT GTCATTACCG CTTTGCGTAG GCAACTAAGG AAACGCCCAA AACGACTAAC     11220
     ACAGCTCCGG TAATGCGGGT TGGACTGGCA GCATATTTAG TCAGTCCAAT TGCACCATAA     11280
     TGATCGAGAA ACAGGGCGGC GATCATCTGA CCGGCGATCG TCAACGCAAG GGCAAGCGCA     11340
     GCACCAATTT TAGGGGTAGC GAAAATGGTT GACCAAACAT ACAAGGTGCC TAAACAACCT     11400
     CCAATCCACA TCCACCAGGA GGTTTGAGCC AGAGCCGTCG CAGCAGGCAG GGGATATCGC     11460
     GCCAAGAAAC AGATGACCAG GGATGCTAAA GTCCCAGCCA GATATGAAAT AAAGGTGACT     11520
     TGCATCGGTT CGCCCACATA GCGTCGGAGC AAGGTATTGA TCGCAACTTG AACGGGGAGA     11580
     ATTGCGCCAC CGAGTAGTGC TGCTAACAGG TAAATGGTTC GGCTATCCAT ATTCAATTTC     11640
     TAGCTATAGT TTCGGTTTTG AATATAGCCC TGCTTTGGCA CGATCGCTCC AGTTGAGCCA     11700
     ACTCATTTCT GCACAGGCTG ATCGAAGTTG AGTAAAAGTG ATCGCTTCAC CGCCAACGCC     11760
     ATCCTAATCC CAGTGCGGCC GCTCCCATTG CAGCCATCAG TCCACCTGCC AAGCGATAGG     11820
     TCACATCTAA ACCAACGGCG CTGCTTAAGG GTGGGCTGAG AATAGGCGAA ACAAACTGAC     11880
     CGAGAAAAAA GGCGGTCGTT AATCCACCCA ACACTCGTCC TCTCAGGCTA ACCGGAGTTA     11940
     CTGAGGTTAG GCAAACATTC ATATTAGGCA TCAGTAAACC CAGCCCTGCG CCAGCAATGG     12000
     CTAATCCCAC TAAAACCATT GCATAGGTAG GCGAAACGCT GATAACGAGA TAGCCAACTG     12060
     CCATTGCCAG AAATGCGATT GCGTAAATGC CCACGAATGA CAGTCGGGCT TTGATTTGTT     12120
     TGTAAGCGAT GGCACTGGCT GCACTGAACA AGGTCGCAAG GGCGATCGCC AATCCACTCT     12180
     GTGATGCAGT TGCATTCGCC AATTGCTTTA GATAAAACGG CAACTGGACT GGAATCAAAT     12240
     AAAACACAAT CTGCGATAAA AAGGCGGCTA AATATGTCAA GTTTGCAATT TGCCAGGGGA     12300
     AAACTTCAGT TTCATCTATT CCTGCATTCT GACCAACTTC CGTATAGTTA GGTTCGGGTA     12360
     AGACCAGCAC CACGAGTGGC AAGATGAGTA ATGCCAGAAG ATAGATCAGA AATGGCATTC     12420
     GCCAATTTAT ATCTGCCAGG AAGCCACCCA GGGACAGGAA CAAGACTCCA CCTAATCCCA     12480
     TAAATCCTGC CTGAAAGCCG AGAAACTGGG CACGGGCCGC TCCGGTATAG TAATCGGCAA     12540
     TCAGAGCAGT TGCTGTGGTC ATGATGCCTG CCACACTCAG ACCCAGCAGT ACTCGCCCAA     12600
     CCAGGATCAT GCCAATAGCG TTTAATACAG CACCAGAAGT GCCTGCAATT CCGTACAGCA     12660
     ACACGGAAGA TGCTAACAGG GGTTTTCGGC CAAAGCGATC GATCACTGTA CCTACAAAGG     12720
     GCGCACCAAT TGCAATAAAC AGAGCGGGAA CCGTCAGCAC GAGGCGTACC CAGTAGTCTG     12780
     CATTGGGTGT CACTGCAAAG TAATCGCGCA TGGCAGGCAG AGAAGGGGCG ATCGTCGCTC     12840
     CTGCCATGAC GGTGAGGCTA CTGCTTAAAA GCAGGGTTGC TTTAACAAGA AGAGAGCTTG     12900
     TTTTGAGGGG CATAGAGATT AACTTGCTAA AATTCCTGCC ATCCACTTTT CAACCGCTTT     12960
     GGGGTCTTGA AGGAGCTGAG CCTGCATCTC CTGTGCTTGT TCACCAGGAT AGACATCCTC     13020
     AACCCCGTCA ATAACGGCTT GAAGTGCTGC CCGCACAACC TCTTCAGGGG CAACTTTGGG     13080
     CGGTGGGAAA TCCTTGCTCA TCTTCGTGTC TACTGTTCCA GGCATCACCC CAACCACCAG     13140
     CGTTTTTTGT GAGGCAAGCT CAGCCCGAAT TCCCTGAGTT GCTAGTAGAG CCGCCGCCTT     13200
     AGACGCACAG TAAGACGCAT TTAGCGGAAA ATTGACTTTT GCCAACATGG TAAGCATATT     13260
     GACGATTGCC CCTCCTCCAT TGGCTTTGAG AACTGGAGCG AACGCCAGAC ACATCCGCAA     13320
     CGTACCGAGG TAATTGACCT CAATTTCCGA TCGCACCTTG TCAAAATTGA GATCTGCGAC     13380
     CAATCGTTGA TTAAATCCCA CGCCAGCATT GTTAATTAGC AGATTCACAT CTGAATACGT     13440
     CTCAGCCGCT GCTTGGACCG AAGCTTCATC AGTAATATCG AGGGGAATGG GAATAATGCG     13500
     ATCTGGATCT GTTGCAACAA TGTCCTTCAG GCTATCTGGA TTGCGCACCC CTGCATAAAT     13560
     GCGACTGGCT CCAGCCGTCT GTAAACCCTG GATGTAGTAT TGCCCAATAC CACCGTTTGC     13620
     GCCTGTCACT AATGCGATTG AACCTTGAAC TTGCATTGTG TCTTGTCCTC ATAAGGTTTG     13680
     TCATTTCAAG CAATCAAGCT CAATGACTAA TAACCATGAC CAGGGTATAC TCTTACTAAC     13740
     TTTTTAGGAA GTACTTACTT TTTTGTAAGC TTTCTTAAGA CATGGGAAAG TAGCACAGAT     13800
     GACCAGTCAA CCGACTCAAG GCACAGTGTT TGTACAAACT ACCTTAAAAG TATTAGGTGG     13860
     GAAGTGGAGG ATTTTGATTC TGTGGCATCT CAAAGATGAG AAAAAGCGAT TTAGTGAACT     13920
     TAAACGTTTG ATGCCAGAGA TCACAGAGAA AATGCTGATT CAACAACTAA GAGAGTTAGA     13980
     AAAAGACGGC ATTGTAAATC GTACTGTTTA TTCAGAAGTA CCGCCTAAAG TAGAGTATTC     14040
     ATTTACTGAG TATGGGTTGA CTCTCAAACC TGTTTTGCAA GTACTGTGTA ATTGGGGAGA     14100
     GAATCACATG AAGCGTATTT GATGAAGCTT TGAAAGCGGG ATGTTTGGCT TGGCCAAAAA     14160
     GAAGGATATG CGATTCCCCA ATGGGAGCGT TTCACGATCA CTTGCTAAGA TCTGACATGA     14220
     CCATTGAGCA AATTGCTGAA CAGCTGAGGG TTGATTTTGA AGCGGTTTGC CTAACTCCAG     14280
     TACTGTTCGC AAGAGGGTAA TGTCAGACCG TTGCTTGATC CAGCCCTGAG ATGCATCCCG     14340
     TACTTGTTAA GCCGTTGAAA CGCTTGGTTA AACTAACGCT GGCAAAGAAG CAGCATTACG     14400
     TCAGCATAAA TGCTCTGTCT GCGGAAGGAA TAACTTCTGG GATGCTGTTT GTAGGGCTCG     14460
     GTTGAACCGT GGAGGTCATC ATCAAGAGGC TAGCAAGGAC ACTAGCCATA GCGGTTAGAG     14520
     CAACGGGTGT AACTAAATTC TTTTTAGCGT GCAGAACTTC GGTAGTCATG GCTGTATTGC     14580
     CCTTCGGTTG ACGCTTTTAA CTTTAAGAAG CAGGTGTGTC AGCCCTACGG TCATCCTGTT     14640
     GCAATCGTGT TTCATATCCT GCTGAAGAGT GGATGGGGCG ATCGCGATGG CAATCACAGG     14700
     GTTCAAGCAT TAACTTGCGA ACCTTATGGG TTGCCAACCC GTCATATTGT CAACAAGTTA     14760
     ACTTGTCAGA TTGTCAACTT TAAACCCTAA GCTTCGCCCT CAGCAACCTA ACGACTCATT     14820
     CGACGGCAGA AGACAAACAC AAACAGGGCC ATCGTAAAGA TACCGAGGAG GGCTTCAAGG     14880
     GCTGCTAATA CTTTGGCCCA GCCTTCTAGT CGAATATCTC CGTAACCAAG GGTGGCAAAG     14940
     GTTACCACAC TGAAATAGAG GGCCTCGGGA AAGTTATGGC GAATTGGACC GCTCGGGCCC     15000
     ACAAGAGGCA GGAAGTAGTA AGCAATCGCA AAAAGGATAA TCAGAGCGAT CGCAAAGAGG     15060
     ACAGATCGCA TAGGCCGTTC GCCATAGCCA CAGGTCAACC AGAGTGCAGT CAAAGACCAG     15120
     AACTCGTAAC CCTCGCTATG GCGGCGACGC ATTTCCATTT CCCGTTCAAA ATATTGACCA     15180
     GAATAGTCAT GTTCACCGCT GGCCTTATAA GCTTCTTTGA AGTGGCGGTA GACATACTCT     15240
     GCTTTCGCCC AATTCTGTTC AACTTTGGAC TCATAGATAC ACTCAGCCCC AGAGAGATGG     15300
     GTTCTGGTAG GAGTACATTC GAGAAAATGG TATGGAACCA GCGGGCAGAC TTGAGACTCT     15360
     TAACAAGTCG TAGATCGACC TGGTCCAGAA AAGCGTCCTC CAGGTTCACC CCGTCCAGCA     15420
     GGGAGTGATC AAACTTGACT TTATGTAAGT AAGCCTGGTG TAGATCTGCA CCCCTTAAGT     15480
     CAGAGTTTTT GAGGTTTTTA AACTGAATGG AGATTCCCTT TAGATTGGCA TCCCTGAGGT     15540
     AAAGCTCTTC CAGTAAGGCC GGCCCTGAAT GGTTGAGCTT GCTAAAACAG TGGTGTAGTT     15600
     GCTGAGGATC TTTAGCTTCC TGCTTGAGCT GCAAATAGCA GGGTTGGGCA TTGCCATCAT     15660
     CGCTGAAAAT ACACTGCTCA CAGTCAAATC CCATGTTGAC GAACCCTTGC TCAGGTCTGG     15720
     TTGCGCTGTT GCTGCCGTTT TTGCAGGGTG CGAATCAATC CCTCCCGGTC TTCGGTGTTC     15780
     AAGAGGTGAG CGATCGCAGC TTCAACAATA ACCTCTTTAT AGGGTGCATT CGCTTTACCC     15840
     AGTTCCAGCT GAAGCTGCAG GTGAAAGGTG TCCAGCCGTT GCAGCACCTC TTCACTTAAC     15900
     TGAAAGGTAG ACTTACGGAT GGCTGGCTTG CTGACTTCCT TGCTTTCTGA AGTGTTGACT     15960
     TGTTGACTTG CTGACTGGTC AGATTGCTGG CGTTCTGGCT TGTTAAATTG TTCATAGCCA     16020
     GAGAGAACCT TATCTGTGGC AGTCAAGGGG TCATTTTCAA TCAATCGGGC CTGTTTCTTC     16080
     ATGGCTTACC TCCGGTCATC ATGCGGGCAA TGGCTTCGTA AGGTTTGATC AGTTTTTGCT     16140
     CACTGCTGTA CTGGTGGATG GACTCTCCAG CTACATTGGA TTCAGCGAAT CGGATGGATT     16200
     TAGGCACGGG GTCAAAAACC GGTATATCCT GAAATCGATT TTTCAGGGAA GCCAGAACAT     16260
     CCTGGGTCAT CAGCGTGTTC ATCTCCGCCA TTGTGGGGAG TACCCCCAGA ATCTTCAGTT     16320
     CCGGATGCAA CCGTTTCTGA ACACTCTGGA TGGTTTCCTG AAGAGCCGAT AAACCTTTGA     16380
     GAGCAAAAAA CTGACATTGG ACGGGAATCA GAACCGCATC GGCAGTTGCC AGAGCATTGA     16440
     CGGTTAGTAG CCCTAAGCTG GGAGGACAGT CAATCAAGAT GTGCTCAAAC CTTGCCGTTA     16500
     CCTTTTCTAA GCGTTCCCGC AGTAGAAAAA AGTTGCCCAC TTTCGTCAGC ATTTCTGGTT     16560
     CAGCTTTTGC CAGGGTGATA TCAGCGGGTA AGAGGCTGAG TCCACTTTTT GTGGTGACGA     16620
     TCGCATCCAA TGCCTCTGCC TGTTCTGTAA TCACTTCGTA GCTGCTGAGT TGACCATCAG     16680
     CCAGAGTTTC ACCCAATCCG GTGCTGAGGT TACCCTGAGG GTCCAGGTCA ATTAGGAGAC     16740
     AGGAGCTGGA TTTGGACAGA ACCCCTCCCA GACAGATGGT TGAGGTGGTC TTACCTACTC     16800
     CTCCCTTTTG GTTGGCGATC GCAATGAGCA TCTAAGTAAG TTAGTAACTT GTTGACTTGT     16860
     CAAGAAGTTA TAAAGATGAC CATACAACTT TATTCAGGAA CGGGTCGAGT TCAGGGGACA     16920
     ATTTGGAGGC ATAAGAGATA AGGATACTGG GCTACTCACT GCTTGCCTCT ACCAACTCAT     16980
     AACACTCTTG GGCAACAACA TAAAGCTGTA CAGTTAACAA GTCAACAAGA TGACGTGCTG     17040
     ACTTTACAAC AATGTGACTT GTCAGCTTAG CGATTGCCTA TCCATGGGTG CACCAGTGCT     17100
     CCTTCCTCTC TGATCAATAA GATGTCAATG CTTCGCTTCC CAGTATCCTG TGCTCTCGTT     17160
     TTTGATGTAC TGGTGCTTTA CCGCCGCCCA AGCGATACGA TGAGCCCGTT CTTCATCCTG     17220
     GTCATATTCT TCCCAGGCAT TATTAAAGGC TGCTTGATAT ATTTCCTGGG CATGGTGGGG     17280
     CAGGTGTTCG GTGACGCTCT GGGGTAAATC GTCTAACTGG TTGTAGGGCA TGGCCGCGGC     17340
     TGAGGTAAAC GATGCGATCG TAGCCAGACT TGCAGTTTGC TGACTCATGC TCTTGAGAGA     17400
     ACCAGCTTTA TCTGCAAAGA AATCTTATGA CTACAAGCAT AAAAAATAGA ATCTGGAACT     17460
     TCAAAGGGTT CTATAGAAAC TATAATTTCT ATAGATAGGT AGACTGGAGG CAATATAATG     17520
     AGCGGAAAAA CAATTTCGGC TTATACGGAT ACAGCTACAG CAGAGAGAGT GGCAGCTTTG     17580
     GCTAAGCTAG AGGGGCGTTC CACAGCTCAG ATCGGCGGGC TGGCTCTGAA GTTCTTCACA     17640
     CGGCTACCTG TCGAAGCTCG AACTGCTCTA CATCAAATTG AGCTGCTTGG TGAACCTGGA     17700
     GATTTAGAAG CTGTTCTTCG GGATATCACT CGCACCTTAT TACATCGGCA GTACGAAATT     17760
     GCTCAGCGGC AAGTTGTGGA ACAGATGCAG ATTGAACATC TGGAACCTCT AGAAACCGAG     17820
     GATGATTTTC TTGCGGCTGC CATTCGTCTG ACTCAGTGAT ACGGAAAGAT GAATGCTTCG     17880
     CTCCGGTTTT GCCTGGATTT AAACATCTGG TGCGCTGCTC TCCTGGCAGA GCGTAAGGGC     17940
     AGGCAAGGAA CCGCAGCTCA AACACTGGTG CAAATGGTTC GGCTTGGTAC CTGTCCACTG     18000
     GGGCCAGTAC AACTGGTTAT TTCCTGGGGA ATGCTCAATC GGCTCCGCCT TGTTCTGGAA     18060
     AGGGATTTGG GAGTTATTCC AGAAACAGCT GATTTATTAA TTGAGACCAT TGGAGGGTAC     18120
     GCTCACCTGG GCCCGGCTGG AATATCTCCG CAACTCATTT TGGGTGGAAC GGGCGTGCTG     18180
     GCACTACGTG ATCAAGAAGA TGCCCATGTT TTGGAGGTGG CGATCGCTGG ACGAGCCAAC     18240
     CTACTGATCA CTGCAAATTT CAAGGATTTT TTATCTAAAG ATACGGATGT AGTTGTGCCA     18300
     GAACAACACG CGATTCATAA CGCCCCTGGA CATCGATTTC ATATTGTTCA TCCCTATCTG     18360
     ACTCTGGATT GGCTCCGTTC GGGTACCATC CCTCCCCTAT CTGCATAGTG AATTCAAAAA     18420
     ATACGGATTA ATATAAATTC TACTCATTAG CCCCTTTGCA TCTGAATCAA CAGCTGGTGG     18480
     GTATTAGGGG GTATTAGCCT GCTAGGGGTA AAGGTAGCGG TGCGATGTAG AAAGTCAAGT     18540
     GTTAGAGGAT TAAAGTGAAA CCTCATGAAT GAGTGGAAAG CCTCCTTTTC CAGTGGCATC     18600
     TGTCCCACTG TCCTCACGTA AAAGAGTCTT GGACTCCGGT CACGCTGGTT ATCAGCAATG     18660
     AATCCAGTGG AATGCAGACC ACGAACGTAT CCAACCCTGG GAGCCTCAAT CTGGGGAAGG     18720
     GCAAGAGGAA GTCCGACAGG GTTAAGGCAA CTGAACCGTC ATTTGAATCT CCGTCATTTG     18780
     CCAATCAGTG AAAAGAGGCT GAGACACTGA GACCAAAAGG TAGATGGGTG ACTCAACGGC     18840
     TCGCTTCTCC GTTGAGGGAC AGATCGCAAC CCCTAATGCC TTCGGCAACG CTACGCGAAC     18900
     GGAGTGTAGG CGGAACCCGA CCCGGATGCA TCTCAAACAC TTGGAACTAC AGAAGCCCAA     18960
     TGGATTCTCT GTCCCAACCG CCAGAGTAGG CAAACCGCAG GGAATGCACA ATGATCTGAT     19020
     TGCACTCATC AATTTAACGG TTCTCCCGAT CAACTGCCCC TGACCTGATG GTACGGGGGT     19080
     TTTTTAATGG CAAGGGCAAC TCCGGAAAAG AGGTTCGGCA GGAGCAATCT TTTATTCGTG     19140
     TTTGGCTGGA AAGAGGGACG GATTTACAGA AGGAGAATTG ATGTCAATAC GCCATTGCCC     19200
     AGCATAGGGA GAGGGAGAGC GCATGAGTGG ACTGTAATCA GTAATATCAG GGGTGTAAAG     19260
     TCCGAGCGAA AACAAGGGAG GCTTAACATA GCCCTGGATA TTACTCAGGT CAGTAATGGT     19320
     CTCGCTGTCT AAACGCAGGC GTAACTGGCT GCCATTGACA AACTTCAGGA TGGCATCGTT     19380
     CTGCTCAAAC TTGACCTGTG CTGAGTAAAG ACCCCCAAGG GAGTAGGAAA AAGCTTGACC     19440
     AGAAAATACA AGGCCATCAA TGTTCTTACC CTGATACTCA GCGCATTGGG CCCAAAGGGG     19500
     AGCGATCGCA GAGATGATGC TCAGTAGAAA CGTACCCCTC CATCTCCACT TGCCCATTCC     19560
     TATTTCCTCT CAGATTCGAC TCTACCTTCG TTCTAACTCT ATGATGACGT ACTCAGCTCT     19620
     TCCTCTTCAG GATACTCTCC TAGAAATAAT TTTACGGTAT TAACAAAGAA CCGCTGGAAT     19680
     TTTTGGTCGA TCTATCATTT CTAGTACGGA TTTATGCCTG AGCGATCGGA AGTTCTGTCC     19740
     ATTGGGTTGT ATAGCGGGGA TAACGCTTTG ATGAACGCAT CTGCCAGGGT TTCGTTACAC     19800
     CCGCTGCCGC AAACTGAATT GTCCCTCGGG AAACTTATGA ATTGATCATC TGGACATTAA     19860
     AGCCATGTTG AAACTGTGGT ACAAGAAAAG TTTCTAAAGT TAAGTGGCTT TGGTTTATCA     19920
     CTTGTTGCAG TTGTTCCTGG AGCCACTGCT CAAAGAGTTC GTTCAGCAGA CGTTGATGCA     19980
     TTGTGCTATC AAGCTGTGCT GGTAACCACT GCTCCAATTT GATAATCAGC CACCATTCCC     20040
     CTAGATGCAC AGGAGCAAAC AGCTGTCCGG GCTGGCTGTT TTGTAAGAAC TGAGCTACGG     20100
     TTGGATGCAG CCTACCCATC TCCACAGGAC CGACTAATCC TTGTGTTTTG GCTTCCCCAC     20160
     CTTGAGAATA GAGAGGGGCA AGCTCGGCAA AAGTTTGTTC ACCTTCCTCT AAACGGAAAT     20220
     AGAGCTCGTG GACTAACCCT TCCTCTCTTG TACGGATTAA GGAATAAACC GCAGCGTCAA     20280
     GCTGTTTTTT TCGCTTTAAG AAATAGGACT CGATCTGCCT ATTCCAGGTA AGCTGCTTAA     20340
     ATTTTTCTAG CCGGTATTGC CGTAGAGAAT TGTCTGGTGG CGGCGAGAGT AATGTATCAG     20400
     CGAGTGTGCG ATCGCCAGTT GGGAACTGAG AAGTAGGCTG CTGTTCAATT CTAGATTGAT     20460
     AACTAGCGAT TTCTACCGGG GTAAGTTCAA TGGATGCGAT CGCCTGGTCA ATAATAAATT     20520
     CCTGAAACAA CCTGGGAAGC AAGCGATACC GGGGTATGAC ACCGTTCCTG GCAATTAAGT     20580
     ACCACATCGG CTGAAACGCT TAGTAAGCAG CCCTTCTGAG AAATGATTTT CTAAAAAATT     20640
     ATTGATTGGA TGACTTCTGG GAGACGACAG GGATGCCAAA GTCAATGGGA GGAGGGCAGC     20700
     GATCCATGTC CAAACTGTAA CGACCAAACC GATTAATGTG TTGCGTCCAA TAGGGACTGA     20760
     GTGCTGCGAT GGTTTCGGGT TCAATCTTCA CGCCCTCTTG GATCAGTTCA TGGAGAATAC     20820
     GGCTGAGCTC AAAAACGTTG TAAAAGATCA AACAGTTCGC GACCAAGTGG TTGTATTTCA     20880
     CGAGTTTGCG CTGCTCATCC CGGTCGTTAG TGGCAATCAC CCCTTCGCCA CCAAAGGCTA     20940
     ACCACTTCAA AAAGCCATTG AAGGACTCAC TTTTATTGGT TGCGGTCTGA ATCACAGTCC     21000
     GGAGATCAGC ATCATGAATG TAGCGCAGTA GAAATCCAGT TCGGATCGCA TAACCCAACT     21060
     CCTGAAATGC CTGGTAGAGT TTGTTTTTGG AACTATTCGT GCCCAATTTC CGCAGGATCG     21120
     TTGAAGCCGT AATCTTGCCA GCTTTAATCG ATAACGTGAC CCGCAACATA TCAGGAAGAT     21180
     GAGTTTTAAT CAGGTTCCAG TTCACACTGT CAGAGAACAG GTTGTCGATA TGGGTACAGC     21240
     GGGTTGTGGG CTCACTGCGA TAGAACTTCA GGTCTTGCCA ACTCCGGATG CGTGGCATCA     21300
     AGGTGATTCC TAGCAGATAG GACAACCCAA ACACCGTCGT ACTTTGAGCA TGGGTATCCC     21360
     CATGAATAAT GTCTGGTTGG ATGTTAGAAG TATTCTTCAG CAGTCCGTCG AGTAAGTAAA     21420
     CCGCTTCAAA CACGCCGCAA GGAATGAAAT GACTGAACAG GGCAATGTAG GTGTCCGAGA     21480
     CATGATAATA CCCAATCCCG CCGTAGCCTC CATAGCGGAT ATGGTACTCC GCTAATAGAT     21540
     TCTGCTCATA GACATCCCAC TGAGTTCCAT CCACAGAGGC ATGCTTGCCA GTCCCCCAGT     21600
     GAGCCGGTAG GGCAAAGCGG TTATAGGCAT TGATCACCAC CTCGATCGCA GAGTGTAACT     21660
     TGAGGTCATC AATATGGCGA TGATGAATAT CCGCTAACTG TCGCCGATCA AACTCGCTCA     21720
     ATGAGCGGGC AGTCTGGCTG GGACCAATGT TGCAACCGTA GCAAAAGGTT GTTGCCAGAT     21780
     ACCGTGCTGT GGGTTGTTTG AGCTTGGCAT CATAGCCAGA GATCGGCTTA AACGAGCGGG     21840
     TCCAATGCAG CCACAGTTCG GTGTCGGTGA GGACATCAAG TAAATTGACT GGGGTCAGGC     21900
     GTTCACTGAC CAGTGCTTTA AGCTTTGCCA GTCCTTTCGG TGGCTGCGGT TTACGGCGAT     21960
     GGATGACCAG TCGATCCTTT TTGTATTCCA CCTCAGTATT GGCAGGGAAT GCCTGGTCGG     22020
     TCGTCTGGGT CTGTAGTTCC AACCACTGTT GGACATGGTT GACAAATGCC TGCCCCTCCA     22080
     CGGGGAGGTT CACTAATTGC CCGTAGTCCG CCACGCTTGC CTGATAGTCT TCCCAGGTGA     22140
     TCAATTGACT GTAGTAGTCA CCATAGGCAT CACTTCCTTC AATGTAAAGA TCGCCCGATT     22200
     TCAATTCCAG TCGCACCTGT GAGAAGACGC AGGCCTCGAA GTGACGACGA TGGACTTGGC     22260
     TGGGGTAGGG TGTGCGGTGC CGTTGTCCAG TCACCAAAAA CCACCATTTG CCCTCAATCC     22320
     AACTGAGATC CAGCAGTGGC ACCGCCTGTT CTTCGGATGT CCCCGTCACT TCTTTTTTGA     22380
     CTGTGGCAAC CCAGGAACTC CGACCTGCGC GCTGAGATTG GATAAAAGCA ACGGCTTCTA     22440
     TCAGACTATC ATCTTGGGTG CTCGAACGCA GCGGCAGGAG CTCCAGTAAC CGAAACAGGG     22500
     TTGCCCGATG GCTTTTATAG AATTTTTGGA ATAAGGGAAA GTGGTTATTC CCTTGATAGG     22560
     TTAAATGAGC TTCGCATTGG TCCAACAGGG CTTGACTGTG TTCTCCAACG ACGGTGGAGA     22620
     TCGCGGCGAA GCGTTGCGGA ATGTCGCCTT CAGTTTGATA AGCCAGCACC AAATCGCGCA     22680
     AAGTGGCGAT CAGTCCGTCT GTGTTTGGCT GCTGCTCCAC TCGGTATTGT GCCAGAGCTG     22740
     CTTTACTACG ATGATGCAGG TGTTGGATCT GCTTGATAAA CATCTCTGCG AGATCATCCA     22800
     GGACGCGGGC GTACTGTTGG TTAAGGAGGG TGATCGCAAG GGTATAGCGT TTGCCCACTG     22860
     GTAGTTCTTT CATCTCGCTG GCGCCCAGGG TCTGGGCCTC CGCCGCAAAA TGTCGCCGTT     22920
     TACTGTCGGG AATAGACTGG AGCACGGCTT TCTCAAGGCG TAAGGAAGAT AACCACTTGA     22980
     GGCGATCAAT CAACACCTGC AAATGAGTGA GGGTGGATCT ACCGGAGTCT TGTTTGAGTC     23040
     GCTGCCAGGG GGTTGTATGG GTGGCTGCCT CCGCTTCAAA TAACTGATTA ACTTGCCTTC     23100
     TTTCTTCTTG TATGAGGCTA CTCACCACTT GCTGGTACAG TGCCTGAGTC ACCTGATTGC     23160
     GAGCTTGCCG AGAGGCTTTC AGCAGGGTAC TGAAGGCAGG TAGCTCAAAT CGTTGACGAA     23220
     CTAATTCTTC GATGGACACA TTGATTAAGT CCACCAAGTC GTGTTTAGTC CGTGCTGCAT     23280
     CTGCCATGAC TTCGTTCATC CGTTGGCGGG CAGTCTGACC AAAAACTTGC AGGTTCAAGT     23340
     ATTGTCGAAT GACGGTCAGA TGCCGCTTGC GGCTAGTCGA AGCATCATAG GCAGACCAGG     23400
     CATCGGGACG GGGGGGCAAT CCAGCAGCCA TTGCAATGTG CCGAGTGATG GTTACAGGTA     23460
     CATCCGCCAT CGGGACGGCA TATCCCAAAC GCTGAAAAGT TTTCAGGAGC ACCAGAAAAC     23520
     CTAACCGTGA TGCCTGGCTT CTGGTGACTT GCCCCGACAA CATCAACTCC TCTGGACTGG     23580
     GGGTATAAAT AGCAGCTAAC TCTTTGGCAC TTAAGCTGCT TTTCAACCGG GGGTAGGCGG     23640
     TCTCTTGACT ACTGGGCATG TCCTCGCCTC ACATCTTTGC AAGCAAGTTG CAGGGTAGCA     23700
     GACGACCATT GATAAGTTCT ACTAAAGGCG GAAAAAACAT ACTACAAGGG AGGTGGACTA     23760
     GTTCTGGACT GTACCGCCCT CGAAAATCTG TATTACATCC GTAATCTTTA AGGCAGGAAG     23820
     CTCTGGAATC CAGATTCTGG CGTTGCCCTT CTGCTGTCCT GGCAATGATT GCTAGTCAAA     23880
     CAGAACATGA GTAGAAGTTA TCAATCACGC TCTATCCCAA CGCGCTTGCA GTGATTTTTG     23940
     TGCATCGGCT CTAACTAAAA TAGGCAAGAT CACACCCTGA AACACCTGTG GAGAAAAGTT     24000
     TTCAGCCGAT GTGGTACTTA ATTGCCAGGA ACGGTGTCAT ACCCCTGGAT GCTCCTATAA     24060
     GGCTTTGTAA ATCTTTGTAA ACTAGATGTA ACACCATGTT AAGAAAGTTG CAAGCATTTT     24120
     GGTAAATATG GTATGCAGTC CTGCTTATGG CGGGGATTGG CTGGGCTTGT CATGTTTACA     24180
     GGGACTGAGC TAGCACGGCG GCGGGTTGCC GGGTCTGGTT CGAGGGGACA TGATAGCGAT     24240
     TGCCCCGATA GATTAAGTCG TAGCCGTTGG GGAAGGTCAC AGTCTGAGGT TTGGGAGCGT     24300
     CAGGATTGAT CTGATAGCTG GTGCCCCGGT AGGTGAGGGT ATAGGGTTGA GCTTGAGCCG     24360
     CAGGGGCCGG TTTACCAGTA TTGCCTTGGC GGGGTTGGTA GTCATATTGA ATACCGCGAT     24420
     AACTGAGTTT CATGATTGGG AGTTCTCCTG AGAACTGGGT TTAATGGTCC TAAAGTAACA     24480
     ACCCAGTTTG ACAAGGCAAT GACTGTGCAG TGCCAGGTCT ATGTCGGTTT CAACTTGGTG     24540
     GCGATCGTGC TTGACCAAGC ATTGATCCGC TTATCTAGCC CGAACCTGGA GATACTTTAG     24600
     CGATCGCCAA GTAAAGGAAC GGTGAAGCGA TCGAGAATAG TTTCCGAAGC AAATCTGTGT     24660
     CAGCTCTGGC AAACGACAAT TCAGCAGATC AGCCTATGAT TGAGGAAGAT GGCTTCCGCT     24720
     ACAAACGGAA AAACCAAATT CAACAAGCCC CCTGGAGTAA GCCGTACGGG GTATTATTTT     24780
     GCTCTTATCT TGGCTTGACC CCCTTGTACT CATCTTCAAT CTGGGATGCT ACCCTATCTA     24840
     TTTTGCTATT GCGCCCAAGT TGAGCAGCAT AGATTCTTGG GCTTCGGCCA GACCTTTAAC     24900
     TCCGCGAATA TTCATTCCGG CATATAACTC TGGCAACTTA ATCACTTTAA TACATTGACG     24960
     AGTTTTGAGA TCCCACAATT GGAGGGTGCC GTTATCTCCC CCGCTCACCA GGGTCTGGCC     25020
     GTTTGGACTA AATGCCACAG AATGCACTAA TGAATTAGCT TGAAAAATGG TTTGGCATTG     25080
     CCAAGATTCA ACATCCCAGA CACGCACGGT TTTGTCATAA CTTCCGGTGG TAAAGGTCTG     25140
     GCCATCTGGA GAAAATGCAA TTCCCATCAC GACATTGTGA TGATCGCTGA GAGTGTGATA     25200
     GCACTGTCCC GTCTCTAATG ACCATAATTT TACCATTGCA TCCGAACTGG CAGTGGCAAT     25260
     GCAAGGGAGA GAGGGGTGAA AAACAATTGT TGTCAGCGCA TTCGTATGGC CCGACAGGAT     25320
     ATGTAAGCAT TGCCAGGAAC GAACATCCCA AATCCTTACA GTCTGATCAA AGCTGCCACT     25380
     AGCCAGCAGT CTACCATTAG GGGAAAATGC CACTGACCAA ACTACTGCTT TATGCCCTTG     25440
     CAGAAGTTTC TCAACCCGTT GATGCCGCAG ATTAAAAATT TGCACGTTTT TGTCGTCGCC     25500
     GCCACTCGCG ATCAAGGAGC CATCGTGGTT AAAGCAAACA GAATTGACTT TGCCAATGTG     25560
     GGCTGGAATC GTCATTAAAC AAGATCCAGT TTGCACCTCC CATAGTTTCA AGGTCGATTT     25620
     GGTGTGCATA TTGCCACTGA CCAATCGTTG TCCACTTTGC TCTGGAGATG CCTGTCCGCT     25680
     GTTGGACTGC CTTATTCCTC CTGGACTAAA AGCGATCGCA TGAACTTCAG CCGGATGCTT     25740
     CATCGTTTGG ATACATTGAC TGTTGTCAAC TTGCCAGATT CTCAGAATGC CATCCAGACT     25800
     ACTGCTGGCA ATGGTTTCAC CCTCAGGAGA AAACGCAACC GACCAAATAA TGTTCTTAAA     25860
     TCCCGACCAG GTTTTGGCAC AGGCTTTACT TGACAGATCC CAGTGCTTGA TTAACCGATC     25920
     CATCCCCCCA CTGGCTAGCG TTTTGCCATC AGCAGAAAAG GCAACTGCCA TCACCATGCT     25980
     GCTATGGCCT CGAAAACAGG CTTTGCATTG CCTTTCCTCG ATGTTCCACA GTCTGACCGT     26040
     TTGATCCATA CTGCCACTAG CAATGGTTTG ACCATCTGGG GAAAAAGCCA CTGACCAAAT     26100
     TTGTAAGGTA TGGCCTTCAT AGTCTTGCAG ACACCTGCCA GATTGAAGAT CCCACAATTT     26160
     GACAACATAG TCATTGCCGC CACTGATGAC ATATTGATCA TCAGGAGAAA TATCTACTGT     26220
     CCAAACGGTA TGGGAATGTC CCTCAAACGT TCGGATACAC TCTCCTTGAG TCAGATCCCA     26280
     CAACCGGAGT TGGTGGTCTT CGCAGGCACT GACCAGATAA CGACTGTCTG AGGTAAAAGC     26340
     GATCGACCGA ACCGAGGATT GATTGGCCCT CAAGGTCTGG AGGCATTCAC CTGTTTTGCA     26400
     ATCCCAAATC TTAATCGTGC CATCTTCACA GCTGCTGGCG AACCATTTGC CATCTTTGGA     26460
     GAAGACCACG GACCAAACAA TCTTGGCATG GGCGTTTAGG GTGTATAAAC ATTGACCTGT     26520
     TCTCACCTCC CACAGCTTAA CCATGCCATC GATGCTGCCA CTGACCAATA AGCGGCTATC     26580
     AGGAGAAATA GCCAAGGTAA AGATAAAGTT CTCATGAGCC TTCACTGTAG TTTGGCGTTG     26640
     TTCTCTGGCA TAAAACCAGA GATGAATTGA CCCAGCAGAA TCACAGGCCG CCCAATATTC     26700
     TCCATCAGGA CTGAAGGCGA TCGCCACGAT CCAGCCAAAG GTTTGTGAAA ATCGGGATTT     26760
     TGATAGATCG GCTCCCGAAA AATCAACATC GTATAGGGTG AGTCCCTGTA AATCGGCTTG     26820
     CCAGACCGTC AGTTGAGCAA AACTATAGCC GGATAAATCG ACCCCCAATT GCCGCAGCAT     26880
     GTTAATAATA TTTCCGGCTG CATACCCTCT CGCCTGGGAC GGAGCCGCAC GCATAGCCTG     26940
     GAGCATCTGT TGCAAGTGCC GTTCTATAGC CGCGACATCA CCAAACCGAT GCATGAGCTG     27000
     GTCGAGCACA GGCTGCAAAA TCAAGCGAAT TTGGGTCTCT CTCACATAAT CCTTCGCTTG     27060
     CACTTGAATT AGAGCATATT GCTGGAGCAG GCATTGAGAG TGAATGGGAG TTCCCGGTTG     27120
     CCAGCAACAA ATCTCCTGGG TGATTTGGTC AATCAAACAG CTGGTGACGT ATTCCATCAG     27180
     GACCGGCTGC TGGGTAAACT GATGGTTGAT TTTCTCAATC AGGGAGCGGC CCTGGAGTGC     27240
     AGCCAGCACC TGAAGCAGTT GAGGGGGAGA GGCAGGATGC AATAAATCCT CGGGTAGTTC     27300
     TGTCAGGTTG ACCGGTTCCC GCTTGATCGC AAGCCATATC ATTAGCTCCC GTTCCTGGGC     27360
     ACTAAGGCGT CGGAATTGCT GATCTAGGAG TTCTCGAATG TCATCAAAGA TGCAGGATGA     27420
     CTGTCCCAGA AAAGTCAGCA ATTGGCTCAG ATCACCAGCA AAGACCTCAG TGATGAAGGA     27480
     GGCCACAATC TTGAGCGCTA GGGGATTGCC TGCATACCGA TCGATGATGG ATTGCCACTC     27540
     TGGAAATGTG CCGCTAAATT GCCCAACGCT GCTAAAGAGG GCCTGGCCGT CCTGGTAGGA     27600
     TAGCCCGCTA ATGGTAAGAC AACGCATTGG GAGTTGCTGT CCAAATTTGG TGGCTAAGTC     27660
     CTGGGGGCGT TCTCGACTCG TAACCATCAG GCAACTCAGA TGGGAGGTCT CCCCCACTTG     27720
     TTGGAACAGG CGGCTATAGC CTTCATAACC CGGTCGGTAG TTACAATGGC GATCGCCCGC     27780
     TTGCAAGAGA GCTTCAGCGT TATCCAGAAT CAATAAACAG CGATGACTCC GTAAGTACTG     27840
     AAGGAGCTGT GAAATTGCCG CATCAACGCT AAGCGCAACT TCAATATCCT GTTGCTGAGA     27900
     TAGGAACTTG AGCACATCTA CTAAGAGATC TAGGGCAGGG AGTGCGTTAC GCAGACTCCG     27960
     CCAGATCACA AACTCAAAGT CTGATTGAAC ATTTTGTCCC ACTTTAATTG AAAGGGCAGT     28020
     TTTGCCAATC CCCCCCATCC CTAACAGCAA AATAAATCGA CAGCGATCGG AAAAAATCCA     28080
     CTGGCTTAAG GTCTCCTGTT CCTGGGATCG GCCAAAAAAA ATGGAGACAT CGATCGCTTC     28140
     ACCCCAGTCT GTGTTGCAAC GGGGGTAATA ATCACGGGTA ATCGGTTGAG CAACGGGGGT     28200
     AGAAGATTGC AGCTTGTGGG TCCATTGCCG TGCCAAGGCC GCCTTAAAGT TAGTTTTGCT     28260
     GACAGGCTCT CCTAAGACAA GGGATAGATC TCGCCAGAGC TTCGGACCGA CATCCTTACG     28320
     TAAATAGCTA TCTGAGTAGC CTGTACTTTC AGCAATCTCT TCATAGGTGT TTTGCTCCCA     28380
     GGCTCCGCGC AAAATCAAGG TTTCAACATC GGTCAAAGGT CGCAGCCCAT GCTGGACAAG     28440
     CAAATCACTG GCAAGGTTCA GGGCCTGTTC AATTTCCATA GGCAATTGGT ACTCCGGTCT     28500
     CACCTGACAT TTCCAGACAC TTCTTCATAT GTGCTTATAT TTATACGGAT TCCACGGAAG     28560
     ATTAGCCAAT GTTGTCATGG CCTGATCAGC CTTGTTAGAA ACTCCGTAAG CAGATAGATT     28620
     GTAAGGCCGT TTCTTATCCA TTGAGAGGTG ACGATCAACC ATCAGGGGCT TGCCTAGAGG     28680
     TGAAAATAGC CGCAGGTATC AGAGTACAAC TGCTCTCAGC AAGTTAGAGA TAGACGGTAA     28740
     TTCAATAATA AAGCCCAGAA ATATATTAAT TCAAATGATC TATTTCAGAA ATCCTGACAT     28800
     TTTCAGTAAT GACAATCATG AAATCCCGCA GTAGGTTGGG TAGAGCTTTA TCCTAAATCT     28860
     AAAAGGAGAA AACTATGAAA AAGCTAGAAA TTATTGTCTT TGGCATTGTT GATCCGTGAG     28920
     GTAATCATCC ACAGATTTGA TGCTGGTCCA GCCAAGATTT AAGTTCTAAT CCAAGTCAAG     28980
     CTAATAACCT GATACTACTC TTCATTGACT TCATCTGAAG GCTTGGGCAA TCGCACTTAA     29040
     ACTTCTGAAA TGAGCATTGA GTAATTTGCT CTAGCTTAAT GAACTCGTCT TTTTTCGTTC     29100
     AATATCGATT CAACTCAATC GGAGGAAACC CATGAAACTC AAAAACCAAG AAAATGTTAG     29160
     AGATAATTTT ATGCGTTTCC AGTTCCTTCG ATTGGTAACC CTTGCCCCCC TGAGCTTGGT     29220
     TGGCTTGGCT GTCCCTACTG TCCATTCCGT CCGCAGTGCG GGAGTGCCGA CCGGGATAAA     29280
     CTCACCTTCC GCAGATCTAT TCACGCCGAT GCGGGGAAAG CTTGCCGCCA AGGATGAAAC     29340
     AGCAAATCTC GAACCCGTCA TCCGTCAATT TCCGCCAGAT TCTACCAGTA CAACCGCCTT     29400
     AAGAAGTGTG AGCGTCCTTG CTTCCAACCT CGGTAATGCC GAAGATGTGT TCGCACGTAT     29460
     CACAACGACG GCTCAAACTT TTTATGTGAC TGACAGTACC GGGCGGCGAT TGGTCCGGGT     29520
     CAGAACAAAC ACGTCTCCCC CGCAGGTATC CTCTTTCGCA ACTAACCTGC CTACCGGAAC     29580
     GTTGGGAGTA ACTGGGGTTG GCAGCTTTTT TTACGTCACC CACACCGGAG GGCGGATTTC     29640
     GCGCATTTCA AGCACTGGAA CCGTTACCCC CTTTGTTTCG GGTCTGAGTA GGCTCGGGCG     29700
     GCCTGCCGCG CTTTCTACAG GCAACTTAGT TGTTTTCGAA ACTATTGACG ATCGCCTGTT     29760
     GCGGATTAGC CTCACAGCCA AGATTTCTAA CATCTTTGAG AACGATACCC TGTCTGACCC     29820
     CATTGATGTT GTCCCTAGAG GAACCAAGTA CGCGCTGGTA GATCTTAATA AGGGCTGCCT     29880
     GTACATTGCG ACGCCTCCCA GTGGTCTGTC TACGATCGCC TGTGGTCTGG GCCGGCCAGA     29940
     AAGCCTCGTG CCTCTGGATA CCGATAGCTA TATCGTGTCT GACTCTGCCG GCGATCGCCT     30000
     ACTGCGCGTG AGGGTATCAA CAGGGCGGGT AACGACGGTT CTGCGGGCCG GGGTTGCCAC     30060
     AGATCCTCAG GGTCTGGCCC TGGACAGGGA TAAGAATATT ATTGTCGCCG ATGGTTCTTC     30120
     CGAGCGATTG TTACGAGTCC GGCTCAGGTA GTGTGATGAT CAGGACGTGA GCAATCATAT     30180
     TACCTGCTGC AGGTTCTGGA GGGGTTGCAT GAGCGCACAG CTTAGCTTCC CGCTTCAAGT     30240
     GGTTAATCTT ATCTTGTATG GTTTTGCCGA TCGCTTTGTT GTGTTTGCAC CTGGTTCTGT     30300
     TCTAGAAGTC GAGGGTAGGG ATATTACTCT CTGAGATAAC CTGTCAATGT TGGAGGGCGA     30360
     ACGCGATCAT CGATTGACGG ACCTGGCCGC GGATGTACCG GCGACGGGTT GGATCGAATC     30420
     AGGCAAGGTG AAGGGTAAAG AATTTCGGCA GATCTGGTGG CGGGGGGTAG AACGGGACGG     30480
     TAAGAAGACC ACCATCTATA TCGGTAAGGA GGGTAGCCCG GTCCATAAGA GGGCAGTTGT     30540
     GGCTCAGCAG GCCAATTGAG AGGTTACCCC ATCTTGCTAC AAGTCACAGG ATTGAGAAGA     30600
     GAAAATCACG TCTGCTGTAC GAAGAAATCA CTTTCTTCAG AATCTGAACC TTCGATACTA     30660
     AAGACATCAA GACATTCGAT CTAACGGAGA AAACGCTCAT GAAAGTCTTA GCTCTTGCTT     30720
     TTGCCATCGG TACCGTCTGT GTCTCCCTCT CCCCCGCTGA AGCTCAGGTC GTGATCAAAG     30780
     GTACTAAATG CCATCCAGAC TCTCCCCAAG GCTTTTGTTG CCCTAATGAT GGACGTCCTT     30840
     CTGGTCCCTA CTGTCCTGCT CGCCCGATCA CAACTAATAC CAATACACAA AACCAATAAT     30900
     CCGCAGAGAT TAGTGCATCT GTTATTCACT ATTCACAACC GATGTGCAAG AAAGCTCCGA     30960
     AGAATTACCC CCATGATTCG GAGCATTATT CTCTGTTGTA AGTATAAGCG TTCTAATTTT     31020
     AGTTGGCTGG CCCGCTACCC TAGGCGATCC AGAACACTAG ATAGCGTTGA CGATCGTTAC     31080
     TGCCTGGCTA GAAAAATAGT CCTACGCTAC CTCTATTACG CTGCAACCCC CCGCTAGCGT     31140
     ATTAAAAGTC CCGAAAAGGC AACTTGCTCC GAAAGGGTAA GACGCAAATT GGTAATCCTG     31200
     CAGCCAGGGT GTCGGTATGG ATGTGTCAAT GCCGAAGGAC TTTCTCTCAA CCTCCCATCA     31260
     ACTTTGCAGG GATGGGAACG AGTTTGCATC TTATGGTCTA CCGACCTCAA CAGTCCCCGT     31320
     AGGCTTGGTC TTTTGCTAAT TGAGCAGAAG GGCAGCATAG CTTGGCTCAA TGCCGGGTTG     31380
     AGGGGACGGA GGGGCAGTGG TGAAGGGGAT CATTTGAAGG TCAAAAATCC ATGATCTTGC     31440
     CCTTCCCAAG CTTACGACTT TAGGTACTAG CCTGGTTAAA ACCCAAGGGT TCTCAGCATA     31500
     TTTTGGTTTG ATAGATTTTT TCTGTATAAT GAAGCGTTGA CTGTCAATAT CAGTCAAATT     31560
     AGTAAAAGTC GAAAAAACAA TGGGTATAAA TTTAAATAAC CTGCAAGGTT GCACGACTGC     31620
     TTTGGCAACC GGGTTACTGA CTATCGGGCT ACTTGTGGTA GACAAACAAT CTGCCAGTGC     31680
     TACCCAGCAA CTCTTCTGCG ATGGACGCAT GAAAAATGGT TGGGCTTACA CGGCTGAGTT     31740
     TCTTAATGGG CGCTTTACCC AAATTCGGTG GCAACGTTCC GGGCAACCGC CACAAACCAC     31800
     AAATCTTACC TTCAGCAGTA CTAATGCCCA AGGACAACCC ATCTATACTG GGGCTTTTCA     31860
     AGCAGCTACA ACTGTCACTT TAGTCGATCT ATCCGGTGGA AATGTGCAGT CTGGTTCACA     31920
     GATTTCTGTC CGTGTTGAAG AGTGGGGAAG TTCTGTGGGA ACATGCGGCA TTTCTACAGG     31980
     TGGGAATGCT CCGCCTTCTC CGCCCCTCAT TTCCCAACGA TTCTTTTGCG ATGGACGCAT     32040
     GAAAAATGGT TGGGCTTACA CAGCCGAATT TTCCGATAGA CGCTTTACCT TAATTCGCTG     32100
     GCAACGTTCT GGGCAACCAC CGCAAACCAC AAATCTTACC TTTAGCAGTA CTAATGCCCA     32160
     AGGACAACCC ATCTATACTG GGGCTTTTCA AGCAGCTACA ACTGTCACTT TAGTCGATCT     32220
     GTCCGGTGGA AATGTGCGGC CTGGTTCTGA AGTTTCTATC GGAGTAGAGG AATGGGGATG     32280
     GTCAAGGGGG AGGTGCAGGC GCTAAACAGT AGCAACGGCA TAACAAATTG GCTGGAGCGG     32340
     ACTCAGAGAG GGCATTTTAC CCAGAGTGCC AATTGGGTTA CTGCTACAAT TCAAACTCCT     32400
     GCCACTGCTC CCCGCTGAGT CTGAACCTCA TCCCTCAAAT TTTTCCGCTT AACCCAGTTA     32460
     CCTCAGCCTC GTTGGTTTAC CATCAGCAGG CTTTTTCGTG GGCAATTGCT TCAGGGAAGT     32520
     AGCCATGCAG TGTAGAGGCA TAACAACTTA CGAAGTCCAA GATCGGTTTG GCTCTCCTGA     32580
     GATAGGGGTG TAGAATGTAT TATTGAATAC AGTTCTCTAA TGACGTACCA CCTCGATTAT     32640
     CTGCTCAGGT TGCCAGGAGT CCGAGTAGAA AGGTGTCAAG ACATTGAAGG AGGGATCACT     32700
     CTCAGCTTGG AGATTGTCGC AGCAGGCATG AGTTGTCCGT ACTGCCAGGG ATACACGGAA     32760
     GAGTTGCATC AAATCAGACC GATATTGGTC CGAGCTCTGC CGACGGGGAG CATGTCACCT     32820
     TTTCAATAAG CAATTATGCT TAGTTAACAG GCAAGGGTGA ACCAATTAAC CCATTGAGAT     32880
     AAGCACAGCG ATGAGCTAAC ACTTGCGAAA TATTTTGACG ATGCCATTGC GCGCCTGACA     32940
     GTTGAATACG ACGACCGATC TGTTTAATGG CAGATTCAAC CGCGCCTGAG CCAATCGAGT     33000
     ACAACCCTTC TGCCTGAAAA TACTCATAAT TAATAATGCG ATGGTGATGG TGACGCAGAT     33060
     ACTCGCAAAA ATTCTTGGCT TGTTTTCGTT TGCAGTCGCT AAATAACGCA ATGGCTGCGT     33120
     CAACTTGACC TTGCCAGAGC AACGCCTCTG CTTGATTGAG CCGTTTGATT GACCCACCCA     33180
     CCTTGTGAAG ATTTTCCACC AGATGATACC AGTCCAAAAT TTCTAAGCGT TGCTCAGCCG     33240
     TGGCAATGTG GCTGATGATA TTCCAGACCC CATCATGACC ATCACCGAGA CAGGTCACCA     33300
     TTGAGGCTAA GGGCTGTTGA TTGACCCACT CAATGAGGGC TGCATTGTTG CAAATTTTCA     33360
     CAAACCTCGG GCTCTTTTCG GGTTTTGGTG ATCTGGTCAA TCCATGCCAG GAGCAACAGG     33420
     GTTATCGGGC TTAGCAAGCG AGTAAGAATC GGCGGCTTAA CAACGGTAAC CCCGCCCGCC     33480
     CATACATCTG CCGCTTGAGC ATTTTCAAGC GATTGATTTG TCCTTCTACT TGCCCGTTGC     33540
     TGATATGGAG GGTGACCCCC GCTTTGACCG CTGCATAGTC CTCCTGCAAG CTTTTAGCAA     33600
     ATCGCTGAAA CAGACTGAGT GAGCTAGAAG TGGCTTGCTC AAGCCAGGGG TCTAGTTGCT     33660
     CGGATTGACG TTGTCGCACC AGCTGAGCAA ATCCTTGCAC CAGATCGATC GCACCTGTGA     33720
     GATCAGGGTG CTCGTGTAAC CGGGCTAACA GCGCTTGCTG GTCCTCAGAT CGTTGCTTGG     33780
     CGGGCTTCAA CACCAGCCAA GTTGCACGGC GAGCACTCAG CGGTGGTCGA GGATGGCTCA     33840
     GATGGGGAGG AACTTGGCCT CGTCCATACT GGACATTTAA CGATTGACGC TGAACCTGGC     33900
     GGAGGTAATG CGTATAGCGA GCAACGGTAG CATAGCTGCC CCGATACCCT TGCTGTTGAA     33960
     TCTGGACAAA CAACAGCTTC GTTTGGCGCT GGCCTCCGTT CCATTGCTCA ATCAGGTAGG     34020
     TTTTGTAGGG GTCGAGGCTG CTTTTCCGGG TGTGACGCGG ATGGGGCTGC CATTCGGGAA     34080
     ACTCCGGACT GGCCAGATAG CGGAAGACGG TTCGCTCTCC CATCGCCAGG TGATGAGCAA     34140
     TGTCCGGTAC ACTGAACCCT TGCTGGCGGA GTTGGTGGAC TTGCTCGTAG TTCGCTAACC     34200
     GTCGCTCGCG CCGCTGCTGC GCTCGTTGCT GGCGTTGAAT GAGAGCCTGA GTAGGTTTTT     34260
     CTAGCTCAGG TTCTGGGGTC CGATGATGGG CAAGATCTAC GGTTTTAAGA GCCTTGCTTT     34320
     GGGTGGCAAA AAAGCTTTCC AGCACCTCCG CCAGATTTTG CAGCAGATGG AACCGATCCG     34380
     CCACTTGCAC CGCCTCCGCG GCCCCCTCAC TCATGCCCTG CTTGTACGAC CTCGATCGAT     34440
     CGCGCGACAA GACCTCTACC CCCGGATGCT GTTTGAGCCA CTCAGCCAGA GTATTGGCCT     34500
     CCCGGTCTGG CAAAAGGGCA ATGGGACGAT GCTGGTCGAG ATCCACCAGA ACCGTCCCAT     34560
     ACGTCTGCCC TTTGCGGAAA GCAAAGTCAT CGACTCCCAG GGTCTTTGGA ACGGCTAGCG     34620
     CGGGTAGGGG ACGCTGCGAA ACCAAGTGCA GTAAGCAATT GAGACTCATA GGATGGCCCA     34680
     AGGTCCGACT CAGGCGCACT CCCGCTGCAC CCCCCAAGGC TAGCCCAATC GCGACGAATT     34740
     GTTCTGCTAG ACGGACGGTT CTGCGGGCCC AGGGGAGGGT CACTTGGGGA AGTCGCTCTG     34800
     TAAAGATTCG CCGCTGGCAC AACGGATTGG TGCAGAAGAA TTTCCTGACC TGCAATCGCA     34860
     GTTTCACGGC ATAGTGAGCA CAGGGTAAAT CCCGGAGCGT CCGTTGGTAG CGGCTATGAA     34920
     TTCGCTGCGT TAGCCCCTGA CACAGGGGAC ACGGAGTCGT CGATTGGGTG GCTCTGATGG     34980
     TTAGTGTCAG CTGTTTCTGG GCACGATCAA GAGTCCAGCT TTCGAGGCGT AAGTGGATTG     35040
     GGTCTGGTAA CAGGGATTGA AGAAGTTCCA CGGACTACTG GGTTAACACG GATACATTTT     35100
     GATCCTGCCT CAAGATCACC AAAACCTCGG AAGAGCCTAA CTTCGGCAGG TGATTCTCAC     35160
     CCAACTTCGG CACCCCTGAT TACACTGCTA CTCGTTCGGC AGTGAGGGCG TAGGAGATGG     35220
     GCAAAGCCAA GCAACAAGGA GGATTACTGC AGATGGCAAA ATTTCGAGAA ATCTTGCGCT     35280
     TGCACGAGAT GGGCTACAGC CAGTGCGCGA TTGCCCAAAG CTGTGCGGTG GCGCGTTCAA     35340
     CGGTACAGGA CTATATCCGA CGAGCAACTG CCAAGAATTT GAGTTACGAA CAGTTGCAGT     35400
     TGCTGAGCGA TGAAGCGGTC AAAGAATTAC TGGGCAAAGG CAAACGCAGC ATGAGCGGGG     35460
     GGGCGGAACC CATTGACTTT GCCGGGGTGA ATTTGGAGTT ACAACGCAAA GGGGTAACGT     35520
     TGGCCCTGTT GTGGCAGGAG GGACTCGACC AAGGACAGTG GCAGATGAGC TATGGCACGT     35580
     TTTGTCGGCG ATACAACTAA TGGCGCCTCC GGCAGCAGTT GAGTCTGCGC CAGGTGTACA     35640
     AGGGAGGGGA GAAAGTGTTT GTGGACTACT GTGGGTTAAC AGTTCCCGTG GTTGATCTGG     35700
     CCACAGGGGA AGTGACACTG GCGCAGATTT TCGTGGCGTG TTTGGGGGCG AGCAACTACA     35760
     CCTATGCAGA AGCGACACCG ACTCAGGAAT TAGCCCACTG GATTGGTGCC CACCAACGGG     35820
     CCTTATCCTT CTTTGGTGGC GTACCAGAGT GTATTGTGCC GGATAATCTC AAATCCGGAG     35880
     TAACAGACCC CTGTCGCTAT GAGCCGGGAA TTAATCGCAG CTATCAGGAG TTTGCCGAGC     35940
     ATTATGGCGT TGCCATTCTC CCTGCTCGAC CCAACAAACC CCGTGACAAA GCCAAGGTGG     36000
     AAAAAGCCGT GCAGGAAGTC GAACGTCAGA TCCTCGCTCC CTTACGCCAC GAGCCATTCA     36060
     CCAGTTTTAC CGCTCTCAAC AGTGCCATTG CTCAAGGACT CCAACGGCTC AATAGTCGGG     36120
     TGATGCAGGG GTATGGGTTA TCCCGTCAAG GATTATTTGA ACAGGTCGAC CAACCGGTCC     36180
     TCAAGCCTCT GCCCCCGCTT CCGTTTGTCT TTGGGCACTG GAAGACTGCC AAAGTGAACG     36240
     TCGATTACCA CATTGAAGTG GAACACCACT ATTATTCGGT GCCCTACACC CTGGTCACCC     36300
     AAGAGGTTCA GGTCAAAACC AGTGAGCAGT TGGTTGAGAT CTTTCATCAG CACCAACGGA     36360
     TAGCCTGTCA TGAGCGTTCA CGCCTTCGCT ACCAACACAC CACGCTTGAC GAGCACATGC     36420
     CACCGGAGCA TTGGGCATAC AAGCAGCAGT CGAAAGAACG CTTTTTGAGT TGGGCAGAAC     36480
     AGATTGGCGT CCAAACCCAG GCGCAAGTGC AAGCCATCTT TGAGAGCAAA GCGCACGAGG     36540
     AACAAGCCTT TCGCAGCCTC AAAGGCTTGC AACGGCTCTG CCAACGCTAT CCCTCCTCCC     36600
     GAGTCGAAGC GGCCTGCCGC CGGGCGAATG CCTTTGGTCT GGTGGGGCTG CGCCGGATTC     36660
     GGACCATTCT GGAAACTCAA CTCGACCATG CCCCCCTGAA CGAACCCGTT CCAGCCTCTG     36720
     GGGTCACGCA ACACCCCAAT GTTCGAGGCT CCCAATACTA TCACTAATCT CCACTGACCA     36780
     TGAATCCATC CACTGTTGAA CAACTCAAAG CCCTGCGCTT GAGCGGCATG CTTGAAGCCT     36840
     GGAGTGAACA AGCCACGACA CCGACCTATC ACGACCTCAG TTTTGATGAA CGCTTTTCTC     36900
     TGCTCGTCGA ACGGGAACAT CACCGACGGG CTCAGCAACG ACTGCAACGT CGGCTCAAGC     36960
     AAGCTCAACT CTCAACCACT GCTTCAGTTT CCGATATTGA CTTCTCCGTT CCCTGGGGAT     37020
     TGGTCAAATC CAAGGTCCGA GCTATGTTTA TTTGTGGTGT ATGAGCAAAG GAGAGGAAAG     37080
     GGCGTATCCT GCTGGATAAG CAAAAGTAAA AACCAGACGA GGATACCCCA TGAGTAACGA     37140
     CAATCTTATT GCATTTCAAG CGCCAGACCC TCCCGCATCG TTTAGTGATG CCCTGACAGA     37200
     ACTGGTCCGT AACGGTGCTC GCCAAATCAT TGCTCAAGCT GTGGAGGCGG AATTGCAGGG     37260
     GTTTTTAGCT CAGTACGAAT CGCTTCAAGA TGACCAGGGA CGCCAAGCGG TGGTGCGCAA     37320
     TGGGTATCTG CCTGAACGCA CGATTGTGAC TGGCGTGGGG GAGGTTGCCA TTCAAGTGCC     37380
     TAAGGTGCGC GACCGCAGTG GTAGGGGGAT CAAGTTCAAT TCGACGCTGT TACCTCCGTA     37440
     CCTCAAACGG GTCCAGAGTG TGGAGGAGGT GCTGCCCTGG CTGTATCTCA AGGGCATTTC     37500
     AACCGGGGAT TTTTCCGAAG CCTTGGCATC CTTGCTGGGA GCCCAAGCGG CAGGACTTTC     37560
     GGCCAGCACC ATCAGCCGCC TGAAAGCCAA ATGGATCAAA GAGCACCAGC AATGGCAACA     37620
     ACGATCACTA CTGGGGAAAC GGTACGTGTA TCTGTGGGCG GATGGGATCT ACTTCAACAT     37680
     CCGCAACGAG GACGACCGCC AATGCATCCT TGTTGTCATC GGTGTCACCA ACACAGGCAG     37740
     CAAGGAACTG CTGGGATTGG AAGCCGGATT TCGAGAGTCC GAACTGAGTT GGAAGCCGTT     37800
     GTTGTTACGT CTGCAAGACC AGGGGCTCAA ACAGTCCCCC GAACTGGCGG TTGGAGATGG     37860
     CGCCTTAGGG TTTTGGAAGG CGCTCGCGCA AGTGTTCCCG ACCACTCGTG TCCAACGCTG     37920
     CTGGGTGCAC AAAACTGCTA ACGTCCTCAA CCACTTGCCC AAGGGTCAGC AACCCAAAGC     37980
     CAAATCAGCC CTGCATGAGA TCTACATGGC AGAGACTCAA GCTGAAGCAC AGACAGCGTT     38040
     TGACCGATTT ATCAAGACCT ATGATGCCAA ATACCCCAAG GCGGTGGCGT GTTTATCCAA     38100
     AGACCGTGAA GCCTTGTTAG CCTTTTATGA TTTTCCGGCT GAACATTGGG TGCACCTTCG     38160
     CACCACCAAT CCCATTGAAT CCACCTTTGC GACGGTGCGC TTAAGGACGG ATAAAACGCG     38220
     AGGCTGTGTT TCACAGGAGA GCATTTTGTC CTTGGTGTTC AAACTGGTAC AAAGTGCCCA     38280
     GAAACGGTGG TTACGCATTC GAGGCTTCAA ACATTTAGCA GAGGTAATTG AAGGAGTGAA     38340
     ATTCAAGGAT GGCCTTCGAG CAGACCAGCA ACTCGATTTC AAGGACAGTA GGAACGCCGC     38400
     TTAATTCTTC TTCATACACC AGATTTGACA ATAACTCGGC GAGCGGGGGC TGGGTGAACG     38460
     TCGATGATCT GTTATCTGCC TGTGCTGCCC ATCAGTTTCC TATTACTCGT GCTGAGTTGG     38520
     AGGAAGTCGT TGCCACCAGC AATAAACAGC GATTCTCATT TGATGAAACT AGAACGCGGG     38580
     TTCGAGCCAA TCAAGGACAT AGTGTTGACG TTGATTTAGA ACTTATTGGA CGACAATCAA     38640
     CCTACCGAGG AACGACAACC CTTTGGCGGA TTAGCCAAGG ACCATGAGGG CGCCTCGGTC     38700
     CAGAGCAGGG GATCAGGGGT ATCCGTCCCG GTTGTTTTCG CCTAAAAAAA AGACACTAGG     38760
     TCTTCCTCAC ACACTGGAGT AAAACTAGTG TCTCCAAAAA CAATTGACTC CTATCATATC     38820
     CGGGTTTACA TGAATGCACG TCACCATGGA CTGACTCAAG TGGATGCGGC TCAAATTGCC     38880
     GAGATTTCCT GTCGCAGTGG ACAACGGATT GAAGCCGGGA CACTGCAACC CCAGCGAGGG     38940
     GAGCGCTCCC GGGGACGGAC CGTGCCGGAC CCCTTAGCGG CGGTGTGGGA CAGCGAACTG     39000
     GAACCGATGC TGGTTCGAGA GCCGAAACTC AAGCCCATGA CCCTGTTTGA GTATTTGCAA     39060
     GAGAAATATC CGGGTCAATA CCCGCAGGTG TTACGGACGC TCCAACGGCG GGTGCAAACC     39120
     TGGAAAGTGC TGCATGGACC GGCTCCAGAG GTGATGTTTG AGTTGCACCA TGCCCCGGGG     39180
     GAGATGGGCC TGTCTGACTT TACGGAACTC AAAACTGTGC AGGTCACGAT TGCCGGTCAA     39240
     CCCTATGAGC ATCTGTTGTA TCACTATCGC TTAGCCTATA GCGGTTGGCA GTACGCTCAG     39300
     GTCATCGAAG GGGGGGAAAG CTTTGTCGCG TTGTGCGAAG GCTTGCAGAA TGCCCTGTTT     39360
     CGCTGTGGTG GAGTGCCCCA ACAACATCGC ACGGATAGCT TGAGTGCCGC CTATCGTAAC     39420
     CTTGGGGGCA AATACCCGAA ACCCTTGACG CGCCTATACA GCGACCTCTG CGACCACTAC     39480
     CGCTTACAGC CCACCCGTAA TAACACCGGG GTTGCCCATG AAAATGGCAG TATTGAATCC     39540
     CCTCACGGTC ACTTGAAAAA CCGCCTGGAG CAAGCGATCT ATTTGCGCGG CAGTGCTGAT     39600
     TTTGCCAGTG TTGCTGAATA TCAAGCGCTG ATAGAGACCG TGACCGCCCA ACTGAACCGG     39660
     CAGTGCCAGG ACAAATTTGC CCAGGAGCAG TCCCACCTCC AACCCTTGCC GGCCTACCGC     39720
     CTGCCCGATT ATGAAATCCT CAGTGTCAAA GTGAGCTGCC ACAGCACCAT CACGGTGCGC     39780
     TGTGTGCTGT ACACCGTCCC TTCCCGCTTG GTGGGTCGCC GTCTGGAATT ACATCTGTAC     39840
     CACAACCGGA TGGTCGGCTA TTTCGGCACT CAACGGGTCG TCGAACTCCC CCGTGTTCGG     39900
     GTCCATCATC CCCAGAAGCG CCGGGGGCGG TGTATTGATT ATCGCCATGT GATTGAAGCC     39960
     CTGCATCGTA AGCCCCGCGC CTTTCTCTAT TGCACCTGGC AGTCCGACCT CTTGCCGAAT     40020
     GCGGACTACC GCGAACTGTG GCAACAGCTC AAAACTCAGT TCTCTCCCGA TGATGCCGCT     40080
     CAACTCATGG TTGAAGCCCT CTACCTGGCC GCCACCGGAA ATCAAGAGGC GGCCGTCGCC     40140
     GAGTATCTCC AGCAAGCGCT CTCGACCGGC ACCTTGAGTT TGTCGCGCCT GACGGGACAC     40200
     TTTACGTTTC AGCCCACTCC GACCTTGCCT GATCTGACCA TTACTCAGCA CGACCTCTCC     40260
     AGCTATGACC AACTCATCCC TACCGCCCCA GTCGAACCCA AGGGACTCGC TGAGCCCCCC     40320
     CGCCCAGAGT CTGCCCCTGC TGCTGAAGCA ACTGAATCTC TCCCACCTGT TGGATCACCT     40380
     GGACGCTATC GAGCATCAAG CTACGCAACA GAACTGGTCC TATGGACAAT TTTTGCTGCA     40440
     CTTGTGTCAC CTGGAAGCCC AACGCCGCGA GCACGTTCGC TTGCAACGCA GTCTCTCAGA     40500
     AGCTCAACTC CCCGCCGCAA AAAGTTTTAC CAACTTTGAT TTCTCCCACT GCCCCCAGTT     40560
     CAATCCCGCC CCCTTGATGC AGTTGGCCCA AACGACAGAC TGGTTAGCCC GAGCTCAAAA     40620
     CTGTATTCTG CTCGGTCCCT CTGGGGTGGG CAAAACCCAT CTGGCCGCCA GTTTAGCCCG     40680
     TCGCTGTATT GAGCTGGGCA AGCGGGTCAA GTTCTTTGCG GCCACTGCCC TGGTCCAGCA     40740
     GCTCCAAGAT GCCAAGCTCC AACTCCAGCT GTATCCGCTG CTGAAGAAAC TCGACCGCTA     40800
     TGACCTCTTG GTCCTTGATG ACCTGGGCTA TGTCAAGAAG AATGAGACGG AAACGTCGGT     40860
     GCTGTTTGAG TTGATTGCTC ATCGCTATGA ACGCAAAAGC CTCCTGATTA CCGCCAATCA     40920
     ACCCTTCAGT CAGTGGGATA GCATTTTCAG TGATTCCATG ATGACCGTCG CCGCCATTGA     40980
     CCGGTTGGTC CATCATGGCG TGATTATTGA CGTGCAGGCC CCCAGTTACC GCAAAGCTGC     41040
     CGCCAGCCAA CGTCTAACCC AATCTGCTGC CACGGCATAA CCCCAAGCCC TAGCGTGACA     41100
     CCCGATCTGA TCCGAGCTTG TCGTCCCGAG CTGGACTTGT CGTCCTGATC TGGTTGAGAT     41160
     CTGAAGTTGT CATTGGAAAA AGCGATGGTC GTTTGACTCT AAAGGGGGCG CCTTTAAATC     41220
     AAGTTGACTC CCTATCCACC CGACCAGTAG GTTGTCGTCA TCTTGCTATG TGCTTGACAT     41280
     TTGACAAGAA CTACAACCGC AAATTCCACC GGATGTGCTG TACCACGGAA CAGGTGAACA     41340
     ATCTGTGCCT GCAATTCTAC AATCAGGGTT GCTCAAGATG TCACGGCATC ACGTGCATTT     41400
     GTCTAAAGAT GAAGAAACGG CTCAAAAAGT CGGAATGCGG CATGGTCGTC CTGTTATCCT     41460
     GGCGATCGCT GCGACTGCAA TGCAGCAAGC TGGGTTTACT TTCTACTGTT CGGATAATGG     41520
     TATTTGGCTG GTCGAGCAGG TTCCACCTCA GTACTTAAAG ATCCTGAGTC CTGAGTGCTA     41580
     AGGAGATGAA CCATGCAATT ACGTCAATTT GATAGCCTTC AAGAATTCTG CGATCGCGCT     41640
     CAGGATTATT TACTCCAGTA CGAGGCAGAA CACAATCTGT CGCTCGGCAT GCTATATACG     41700
     CTACAGCAGA ATGACCGAAA GTTTGCATGG AGTAATGTCA GCGGAACTGG ATATCTTTGA     41760
     ACTTCCCCTG CACCTGGGCC GGGCGTGTGG TGGCTAGATG ATTCGCTTTA GTAGCAGTTG     41820
     TTTGCTGTAC GTCTTTCTTC ACTTTGTCTG CTGGTGGTGC GGTAGATTGA GCAGTTGCCG     41880
     GCTCTGTAGG TTGTCCAGGC TGCTCCGGGT TGGCATTATC TTGTCCCTTC GGTTTGCGTT     41940
     CAAAGACCTG CAATGAGGCA TTGTTCAGTT CAAATCCGGT CGGCGTTGCT GCTCCCAGTT     42000
     GCCCACTGAT GGCTCCCACC CAATGAGTGA AGCCGTTTTC AGCCAGTTTT TTGAACTGTT     42060
     TTTGTTTCAG TCGTACTGTG AAAATGCGAT CGCCATCCGC AAGAAAGAAT TCGACCACGC     42120
     CAGTCGCAAC TAAGCGATGC GGCGGAACCT CATTAATCTT ACAGGTTACT TCGACTTTTG     42180
     CAGGGGTGGC CATAGCACGA ATGTCCTCAC TAGAGAGCGG CGGGGGCGGG GGAATGTCGG     42240
     GCGATCCAGT ACGTGTTTTG GATTGGGGTT GTGGGTTTGT GGGGGGCGGA GCAAAGGGAT     42300
     TGTACCGGGG CGGAGGGGGG TAGGGACCCT CGGCATGGAT CACCACCAAT TTTCCCTCTT     42360
     TCAAGAGCGC TTGGATCTGC CAGAACCTGC CATCGGTCGG TGGTGCATTC TCCCAGCTCA     42420
     GGGGCAATCC TACCGGTCTC CAATTTTTTT TCATGCCTGA GCGGAGATTG CGAAAGATCA     42480
     TCAAACGATC CCCCCCTGCT GTAGAACACC AGCAACCGTT GAGAGTGAAT CTAGGCGTCG     42540
     GATCAAATAT CTTGGGAATG CGGCTGAGTT GAAAGCGTAA CCCATCCTGA TGCCCCTTTG     42600
     GATAAACTCT CAACACCTGA GGTTGGTCTG GGGTAATTTT GCGCTTCAGC TTAGGTGGGC     42660
     AAAAGATGGG AAAAACCTGG TCGCCAATCT GAACCTTAGC CGGTTCGTCT AGCAGAATAA     42720
     TCCCCTGGAT CGTTCCGATC GCCTGGTAAA AGCGATCCAC CGGGGCTGCC TGGGGGGAAC     42780
     TGGGGGAGGG GGGGGGAGGG GATAGGGGTT CGGACATATT TTGAGATTAG CAGTTCCCTC     42840
     GTCTTTATTC AGACTTGACT GCACCAGCTA CTTTATGTGG AATGAAGAAA AACATGGGCA     42900
     TCCAAGTTTG ACCCAAAGTT TGATTACTCG TTGTAGGGAT TTTATTCGGA ATCTTTTGAT     42960
     TAATTATTAG CTGTTGACGG AATGGGTGAT CTCATACTTC ACTAGAATAT CCCTGCAATC     43020
     GATCGCTATA GAGTTGCGCC TGCCCGACTT TAAAGTTTTA TAAACCTTGA GGTAACCAGC     43080
     ATGAATTAAG AAATTTCCCC TTTAAAGCAC GAAATCCCTC ACTGCTCGCA ACAGAAGGGT     43140
     TCAGTGCCTG GAGTTTAGTC CAGTTAAGGT TGCTTGAACG AATGCTTTTT TCCAGGGCAT     43200
     CGATTGAGTC TCCTTACGGA GCCTTGCATC TATTTTAAAC ATCCTTTGTC TATCAGGTCA     43260
     AGCCTTAGCT TGATTTACCC GCAAGGCTCT CTATCTCACT CGCCACAACG ATAGGGAGAA     43320
     ACCAATGGAA GGAATCACTT TATTGATGAT CTATTCTCTC TATCCATCTA TTCACGATAG     43380
     GGAGAATAAT TATGGTTTTA CAAGCTTTAC AACCCTCAGC TTCGGAGTCA ATCTTGGATT     43440
     CCAGGCTAGA GGAATTTGAA ACTCTTACCC AGCTGGAATG GACAATAGGG AGTGCCATTG     43500
     ATCCTGAGCT GTTTCACTCA ACCGTTACAG TGGTGGCGGA TACCCAGGTT GACCCTTATT     43560
     CCCATGAGGT CAGCTATCCC ATCCACGAAG CGCTCAACTG GAAAATCACC CGGTTTGGGC     43620
     ATCAAGCTCG TGCAACTCTG TGCGGGGCCT TAATCCTCAA TGACGATGGC AGTGTTTGGC     43680
     AGGTCAAGCT GAGTCAACCC CGTCTAGATC GGGAAAAGGG CAAATCTCGT AAGTACGAAG     43740
     TGCCTGTAGG AACTCAGAGC CGGGCCTGGT TCCCCCATCA ATTCCCGATC CCCTTGTGGA     43800
     AACACATTGC TAGCCGGTGG GGGTTAACCC TTTCCCGGCA GGATATATAT TTGGGGTTGC     43860
     GGACCTGGCT GATCCACCAT CCTGAGCTAC CTGTAATTAT TTGTGAGGGG GCAAAGAAAG     43920
     CAGCCTGTCT GCTGAGCCTG GGTTACGTGG CGCTCGCCCT GCCTGGAATC TTTAATGGCT     43980
     ATCGCAAAGG CAATCAAGGC TTGATCCCAG ACTTAGCCGC GATCGCTCTG CCCGGACGGC     44040
     CCATCTACAT CTGTTTTGAC CATGACTTAA AACCCCGGAC GATCGAGAAC GTGAACCTGG     44100
     CAACTAAACG TCTAGGGACG TTCTTTGCTC AAGCGGGCTG CACCGTACGG GTGATCGCAT     44160
     TACCAGGGCC AGAGAAAGGG GTGGATGATT TTGTCGTAGC GCAGGGTAAG GAAGCGTTTG     44220
     CTGCTCTTTA TGCCGCTGCC CCCCTCCTTC AGGACTGGCA GAGCCACAAA CGTTGGCAAC     44280
     TGACCTTATC GCCCAGCCTC AAACTGAACC GACAGTTTCT GGGTGATCTG CCCTATCCCT     44340
     CCAGCGGCTT TGCCTTGATC AAGTCCCCCA AAGGCACGGG CAAAACGCAG GCCTTACAAC     44400
     CCTTAATTCA GGAGGCCACC CGCAACGGTC GTCGGGTCAT CGTCATTACC CACCGCATTC     44460
     AATTGGGACG CTCCATCTGT GCGGGACTGG GGCTGGATTG GATCGAGGAA ATGCACCAAT     44520
     CGGAAACACG GGGACTGCTC GGATTTGGAC TCTGTATCGA TAGTCTGCAT CCCTCTTCGC     44580
     AAGCCCGGTT TAATCCGCAA GACTGGCGCG GGGCAATCGT CATTCTGGAT GAGCTAGAGC     44640
     AAATTGTCTG GCACGCCCTC AATTCTCAAA CCTGTTACGA AAAGCGGGTA CTGATCCTGG     44700
     AAACCCTGAA GGAACTCATT CAGACGGTTT ATAACTCTGG GGGGCTAATT ATTGGTCAGG     44760
     ACGCAGATTT ATCTGATGTC AGTGTCAATT ATCTGCTTGG ATTGGTTGGG GCTCCTGTGG     44820
     TCAATCCCTG GCTGGTGGTG AATGAGTGGA CCTCTCAACA ACCCTGCTCC GTATCGTTCT     44880
     ATCACACCCC CGATCCGTCC CCTCTAATTA TTCAGCTAAG CGATTCTATT GAGGCAGGTG     44940
     CCATCTTTGT CTGTGTCGAT GCCCAAAAGC CTAAGAGCCG ATGGGGATCG ATTAATCTGG     45000
     AAGCCTATTT TCAGCAGCAG TTTCCTCACA AACGCATTCT CCGCATTGAT AGCGAAACCG     45060
     TTGCCGACCC CCAGCATCCT GCCTATGGAA TTGTGGAACG GCTGCATACA GCAGTGCGGG     45120
     ACTATGACCT GATCATCGCC ACACCAACGA TCGGCACCGG CGTCGATCTA AATGTGCAGG     45180
     GGCATTTTGT CGCAGTCTTT GGTATCTTCC AGGGCACTAC CCCCGATGCA GAAGCCCGGC     45240
     AAGCATTGGC AAGGGTGAGA GAGTCCGTTC CTCGTTATAT TTGGGCGCGT CCTTTTGGGG     45300
     CTGGCAAGAT TGGCAATGGC AGTTGTGATT ACCGTGAGGT CGCCCGCTCC ACCACCCGCA     45360
     ATCTGGAACT CAATCTCCAC CTGCTTAAAG AGATTGACTT TGACCTGGAT CGCTCCTATG     45420
     ACCCGATCAC CCTGCGGACC TGGGCCAAGA TGGCAGCACG GGTTAATACC TCACTGTGGG     45480
     ACTTTCGAGC CGAACTCCAG CGGGGACTGC AGGCTGAAGG ACATCAGGTA ACCGTTCTGC     45540
     AGGCAGGGGA GTGCTTGGCC AGTACACCCG TGAAACCCGC CTTGATGCAA ATTCAAGCCC     45600
     AGCACCGGGA ACAGGAAGCT CACCAGGTAT GCAGTGCAGA AGAAATCACA GCAACCAGCT     45660
     ATCAACAATT GAAGGCAAAA CGCTCTAAAT CGGCTCAAGA GCGATCGATG GAACGCAAAT     45720
     ATGCCCTTCA ACAACGCTAT GGGGTTGAAG TGACCCCAGG CCTGGTGCTG AAAGATGCCG     45780
     ATGGTTGGTA TCCCAAAATT CGGCTGCATT ACTATCTACT AAATGATATT GAGCTAGTTC     45840
     AGCACCGCGA TCGGCAAGAG TTAAAAGGAC ACCTGGAGCG GGGCAACCAA AAGCTGGCGT     45900
     TACAGGATAT CCGGTTACTG GGGGCACAGG TTCAAGCGTT ACGAAGCCTG GGGTTGCCTG     45960
     AACTCCTTGC AGCGGGCAGA GAGGTGAGAG GAAGTGATGC TTTAGTGCAG CAGATTGCCT     46020
     CCCTAGCAGT AGGGTATGCC CGTGACTTGA AGACGGTGTT GAACCTGACA TTCACTGACG     46080
     CCATGACCCC TATTCAAATC GTTCAAACCT TACTGAGCAA GTTGGGCTTG AAGCTGAGGC     46140
     GGTTAAAACA GGAACGGCTA CCTGATGGTA CAAGGGAACG GGTGTATCAG TATGAAGCCC     46200
     CTACGGATGG ACGAGAAGCT ATCTTTAGCG CCTGGGCAGC CAGGGAGCTA GAGTGGAAGG     46260
     AACGATTTGG CACACCCCTC TATATAGACT TTTAGCTGAA TTAGGTTTTT CTCCCACTTT     46320
     TCCAGGGAAC AGCCGCTGAT AAATTTAATT TACTTTTGGG ACAATCCTAA AAGCCAGCTA     46380
     GAAATCTGCC TGATCGAAGT TCGAAGCACA TCTCTAGAGT TTACGCTCGT TTTTTAACCT     46440
     GGCTGTTCAA TGTTGAGGCA GGTGGCGATG TACCCTAACG TTATGGTACA AACCTGGCTT     46500
     TGGTTATCTA GCTATTGCAC AAAGACAAAT ATAAGCTGGC TGTTCAACGT TAAGGTAGGT     46560
     CGTGATGTAC CCTAACGTTA TGGTACAAAC CTGGCTTTTA TGGCAAAAGT GACTCGGCAA     46620
     ATTAGAATTG CGATCGAGAG CAATACTGGC GGCTCTGGAA AAACAACGCT AGCAACACAT     46680
     TTAGCCTATG GCTTGGGCAA GAAGGGGTAC AAGGTTGTCT TAATTGATTT AGATCCTAAT     46740
     GGTTCATTAG GGCTGTTTAC GGGAAAAGTC ATTACACCAA CTAGAGAAGA GTCTCTTGCC     46800
     AGCGTTCTTG ATTCAGGCTT TCAAGGCAAT TATCCTTTAG CACCTATCTG GCAGGATTAT     46860
     GTAGACGGAG TTCAAGTCAT TCAAGGCGGA GCACCTTTGG AAGAAGTGAT TCGTAGCCTA     46920
     CATCTTTATG AACGAAAGTA CGAAATTCTG AAGGACAGGC TAGAAGACTA TCCCTTAATG     46980
     CAGAAGTTGT GATCTTAGAC ACTCCTGCCT CACTTGAACC CATGGGATTA ATGGCTCTTG     47040
     CAGCTTCAAC CCATATTCTG ATCCCTTTAA AGCCAGAGTA TAAAGATTCT TTTGGTGCAG     47100
     CAGGAATGGT GAACTGGTTT TATCAAAAAA TAGAAGCCTT GCGCCTTCGT CCTAAACCAG     47160
     AAATATTGGG TTTTGTGCCT TCTAGAGTAA ACCTGGCAAA GTTCGCTGCC CATCGTAACC     47220
     TGTTGGGTCT GAATGAAAAG GGAAAACCCA AGAGCGATAT TGACCTAGCA GAGACCATTC     47280
     CCTATCAACT TAAGCAAATG GGGATTACCT GTTTCCCCCC TATTAAAGAA TCAGGGTATA     47340
     TCTTGAGTGC CAGTGGCACA GGGTTACCTG TTCAGGTTTA TCAGTCCAAA GATGTGATTG     47400
     TGAAATCGTT CGACCCAATC ATGGCTCAGA TTATTAAAAT CTTAAAAGAG AAGTAATGGC     47460
     AAGACCTAAA CCGATCGGAG CCAGCCAGAT TTTTGCTGAA GCTGGGCAAA CACAAAAGGT     47520
     TCACCAACTA TCGAGCCGGG TAGAAGAACT AGAGGCTGAG ATTATCCAGC TAAAAAGCCA     47580
     GGAACTTGCA AACCAGGAAA AGATTGAACT AGAAGCAAAA ATTGAGGAAC TGACCCAACG     47640
     ACTTTCAGCT CAGGGGGGAA TTCAAGAAAT CGAGATTACG CGAATCCAAC GTAATATCTT     47700
     CCAGCCGCGC CAAACTTTTC CTCAAAGTGA GCTTAAGGCA TTTGCTGAAC TGTTGAAGCA     47760
     AGAAGGGCAA CATACTCCCG TCATTCTGAT GCCTTGGAAA GACACTTATT TGATTTTTGG     47820
     TAATTAGTCA CAGCAAGAAG CATGGCTAAT TGAGAAAGCC CAAAAGCCCG ACCTCAGCTT     47880
     TTATTCAGCA GTGGATGGCA GCAATTGAGG GGGAGCACGC TCAACCCCTG CCAGTAGATT     47940
     AAATAGTTCA GCCACCGCAT TCTGGCCTTG CAGTCGCATC GTTTCCAGAA AACTGAACAT     48000
     CAGTGACACT AACTGTCCGC CCCAAGCACT TCTAGCACCA CCACTGGTCT TACGATGAAT     48060
     CACTACTGGA CGCAGGGCAC GTTCGGCATC GTTATTGTCA GGTTTGACCT CTGGCATCCT     48120
     CAGGAAGGTG AACCAATCCG ACCAATAGCG GTGGAAGCGA TTTGCCAAAG CTTGGGCATC     48180
     TGCTGCCCAC CCAGTTTTCG GCGGGTGGTC GAGCACGTCT GTGAGCTCCG CTTCCAAAAT     48240
     CAGTCGTTGG GTCTGGAGTT GTTCTACGGT TAAGTTGCCC GCATGATAGC CTCGATAGGC     48300
     TTGCCGCGCC CGCTCGAAGA TAGCACTGAC TTGGCTTGCG AACTGCCGAT TCGACTCAAA     48360
     GCGTGAACCG CTAAGGGCTT CGAGTTCTCG TTGAATATGC GCCAAACATT TCTGTTTCGC     48420
     CGTGGCTTGC TGGGGACTAT AGGCAGACCA ACAATCACTG CTGAGAATAC CCTCAAAACT     48480
     TTTACCTAAC AAGGATTCCA CCTCGGCAGA ACTCCGACTC GGAGCGAGAA ACAAAACACA     48540
     AACTTCCCTC GAAGTCGCCA CCCACATCCA ATAGTTGACT CCATCGATGG GATAGCTCGT     48600
     CTCGTCTACA CAGCGCACTC CAGGCTGCTG AATCAGGCTC CACCAGGACT CATAACTCGG     48660
     ATATAAACTT TCGCAGAACC AGCGATGCAT CTTGGCAAGA CTACCTTGCG ACAAGGGAAT     48720
     CCCAAAAATG ATCGCAATCA AATCCCGTTG CTTTGCCCAA CTCAAATGTC CGCCGTAGCC     48780
     CAGCCAACCG ACCAAACTAC TCAACCGTGC GCCATAGCTA AAGTCCTCTC GACAGCCCAA     48840
     CGGCAGGGCA GCAGAACCGT GCCAGCCACA AAGGGGACAG GTGTAGACCG GGCGTTCATA     48900
     CTCCCACACC TCAACCGGAC GCTCGACCAG TTCTGCGATC TGCTGCCGTT TGACAGGGGT     48960
     GGTTTCGTCT CGTTCCAACG CATTGCCACA GACTAGGCAC TGCGCTAGGG AAAGCGCCAA     49020
     GCGATGGTCG ACGGTCTCAA ATCCATAGCG CGTTTTGCCC TCATGTCCGT ATTTCGGTCC     49080
     TTGCTTGCGT TGACGGGGCA TCAACCCTTT GCTTTTACGT TTGTATCCAT CTGACGATGG     49140
     GGGTTGTGAG CTATTCCCAC TATCGCGTTC CTTCAACTTC CGCAGTGTTT CTTTTAACTC     49200
     TTCTACTTCC CCCTCTAATT GGGTTAACTG TCTTCGCAAT TCCGCATTCT CTGCCCGTTG     49260
     CCGCAAATAC TGCTCATACC AATACCGAAC CCCCATCTCT TCTGGGTCAA ACTCGGGGGC     49320
     TGCCATCCTG GCTGCTAAGT GGGCATCGCT GGGCTCCATA CTGCTCAACC TAACCCATCC     49380
     GCTTCAATTT AGCGATTCCC ATTTAACCTT TCTTATTGCG CTGACCAACT ACGATTCACC     49440
     TTAGGAGCAA GAGACAACCG AATCTTGCCA ATAATTTGTG TCCACAGATG CAGAGTTGTA     49500
     TTAGTATCTT GCCAATCTGC AACAGGCAAC GATGGCCAAA TGTCAGTCAA TGGAGATTGC     49560
     AGGGGCGTAG CCATGATAGA AACCTCTATG CAATTAAAAC TATTTCGCTT ATTTAAAGGT     49620
     GAAAGAGCAG GAAGATAGAG GAATTTCTTT GATACAGTCA TCCACCCTCC AGATGGCTTT     49680
     TTTATGTCAT AGACCATACT GAATAATGAT AACTGCTAAA AATCTGGCTG AAAATCTCTT     49740
     CTAAGCAGAC GATTTACAAT CTCAATCAGA TCCAAAGACT TGAAGGGCTT CTCCAGGCAA     49800
     GCATCTACGT TGTTTTTGAT CTCGTCATCC AGGGTGCTTT TATATCCGTT AGCAAGAATA     49860
     ACCGGAAACA AGTGGCGATA CTCAGCAAAG TCTAGGCTAT TTTCATCCTT TAAAAATAGT     49920
     TCCGTAACTA GAAAATCCGG TTGATTTTTG GCGATCTCAA ACTTCGCGGC TGCGATCGTC     49980
     CGGACTAGCT TTGCCTCACA ACCATATGAT TCAAGCTCTA ACGAAATAAA TAATCCCGCC     50040
     GTCGAGTCAT CAACGATCAA AACTTTCATC ACAGAGGGAC AGTTAACCAA ACCAGGGGAC     50100
     ACAATTTCAA ATTACCCACG TTATGCAGAA AGTTACCTAG TGCGGTTTAT CTGGCCCCTA     50160
     TAGCAATAGC CCAAGCGATT GCTGATCCAT ATCTTAGCGC CATCGATCGC TGCTTGCTCA     50220
     GAGTTAAAAG TCTCAGGCAG CTCGATAGGA GCGCTGGAGC TAGGGAAATC AACCAAACAG     50280
     AGGTAGCTGT CTTCCGACTC CTTAAAAATG GTTACCCAGT GGTAACAATA GACAAAGCCC     50340
     ATAGGAGATT GCTCCAGGGA TAGAGACATA TATGGGACTA ACCTTTTATC GATCTAAAAA     50400
     CTAAATATTG GTATGACATA AAAAGTCTGC ACCTGAATCT ACCCAAAGAG TGATGCATAG     50460
     AAAAGCATCT ACCCGCAATA GGGGTTTTAA CTCCTAGTTG CACGAACGGA GAAGTGCCGT     50520
     TTTATACAAA GTATTAAGAA ACTCTTGAAT TAACATTCGT TGGTGTATAT CAGAATACAT     50580
     AGCAATAATT TTTCTATGTG TGTTTAGCAA GCCTAGCCCC TGTATGGCAA GGATGATTGT     50640
     GCAATGTTTT TAGTAAAAAC TAAAGTCTTG CTTGTGGATG AAGATTTTAT TAACGGAACG     50700
     CTATTTTCTT CATATTTAAA AAATATGGAC TTCAAGTTAA ACAGGTAGCA ACCATTGCAG     50760
     AGGCAAAGCT ATCTATCAAA GACTGGCATC CCGATATTGT GATAACAGAA GTGTTCTCAG     50820
     AAGAGCAGCA CTGTCTAGGT TTATTAGAAT TTTGCAAGTC TCGTCAGGTT CCAGTTATTG     50880
     TTCTGACTGG ATATACAGAT CCCTATGAGC AAGAAGTGCA AGAATTTGTA GAGGCCTACT     50940
     ATAAAAAACC AACCAATCCA CGCAAGATTT TAACAACGCT GTTATCACTT GCTAATACTT     51000
     CTAGAGTTTC CCACCACTTA AATATCGCTT AGTCTGGCAC TCAAGATTGA CCCTCAGGAA     51060
     ACTTGCGCAT AATCCTGGCG GAAGCAACAA TGAAATATAT TTTGCCCGAA AGTGGCACAG     51120
     ATCATCCCTC ACCCCCAGAG GCATCGCTGA GGCAATCTGG CTGACCTGGG ATAGTAGAGA     51180
     CATGAGATGA GTTGACCCCA CAAACAGCTA TGAAAGTCCC CCGGATCAAC CTCCCCGCCC     51240
     TAATCCTAAG TTTCACCATT GTTGGTCTGA TTGCCGATAT CCTGCTTGCT TTAGGGCTGA     51300
     GAGCCGGGGG TGTTGCCCAG AGTGCTAACT GGGTCGCTGC TACGATTCAA GCTCCCGCGA     51360
     TCGCTGGCGT GGCTCCCCGC TGAGTCTGGG ACTCACTCCT CAAAAGTTTT CCCATACTAC     51420
     TCATCTCAGC CCCGTTGAGG TTCTGCCAGC GGTTTTTTGT CCTGACTCCC CCTTAAGCTT     51480
     TCCCCATGGG GCTGAATGCC ATCTCTAATT TCATTGAAGC TGAAGAAAAG TGAAGGAGTA     51540
     GCACATTTTT AGCTTTACTC GCAATTCAAA AGTTGGATGG TGGGTGGAGA CAATACCAAT     51600
     AAACCGTTTT GGATCTAGCC CACCCAGGCA ATTTCGTCGT CTTGATACTT CTGACAAGAA     51660
     GCTTTTTGGG GAATTGAGGT GGTATCCTTG CAGGGGGGTT GGATGGCTTG GGGCTCCGCT     51720
     TGGCGAGCTT TTCGAGCAAG GCAGCTTTTG AAGGCTTCCC TCTCTGGCAA AACAATTTTA     51780
     TTGAATAGAA ACTCAATGGT TTGCTGCTTG ACCCACCCCC TGAGGACAGC GACTTCCCCA     51840
     AACTGCAACC CTGAATATTC CTGATCACGC AGGATGGTTT CTACCTGAGC TTGGCAAAGT     51900
     AAACCAGCCT CAACTAGATA GTTACCAATC GGTTTCATTC CTTTTTGGAA TACAAGTTCT     51960
     CCCACAGAAG TGCCTCCTTA ATCTCAGCTG AAGAGATATA TCCAAATAAC ACCACAAAAT     52020
     AAAGCTATGA AATACTAGAA ATTATTTGCT AGTAAAGGTA TTGAATAAAT CATCCTAAAG     52080
     ACTGAATTTT TCCAGCGTAA ATTCTCAAGC ATAGCCAGCG CTGAGCATTA CACCCCTAAA     52140
     CAGAGGCGAG AAATTGCAAA GCTTCTCACC ATCTGACCTT CTCACCGCAA AATTAAAAAA     52200
     AGGAGGGGGG GAGTCTCCCC GTCCCCCAAT TTTTTACTGC TGGGACTGCC AAGCGTTAAG     52260
     CTGGTCTTCC AAATCAGCAG GAGCCAGCGC ACTGAGTCTA GGATGTAGGG GCTTTGCCGT     52320
     CTCCCAGACT TGCCAGCAGA CCATCCTAGC CACCAGCCTC CTTAAGGATG ATCAAGCCTT     52380
     GGCGTACCGC ACCCCAAACG TTGCCTACTG GGAGACGCAA TGAAGAAGTT TCCCGACAAA     52440
     TGCGCCTAAG CGAGGACATA GCGATCTCAA ATTTGCAGAG CTTAGAGATC CCTCAAAATT     52500
     GTCTAACCAC TTGGGTCCAT CTCAATCGCG TTGGAGAGCA GGTTCCAGAA GACCTGGCAC     52560
     AGACTGTTAA ATGTCAATCC CAGTCTTATT CCCATCTGCA ACCAATTATC AAACGCCCTG     52620
     TATTCTGTCG CTATCCCAAC TATGCTCCAC TTTCAATTTG AAACGGTTAA TTGCTATCGC     52680
     CAAACAGGAG TTCAATCAGG GTTTCTACCA GGCGATCGAA GGTCATATCC ATCACATCCT     52740
     TTCCCTTCAG CATTTCTGTC ATTTGATAGT AGTAGCTCAG TGTTCCAGAA ATAATCCAGG     52800
     CAAGGGCTTC CGGGTCAGAA CCGCGAAGTT GAGGAATGGC TTGTAAAAGA CTCGCTGACA     52860
     CCTCTAGACC CGGTTTTTCA AACTGCTCGA CATAGAACCG AGCTAGTTCA GGAAACCGTC     52920
     CCGATTCGCC TACGATCAAC CGATAAAAGT TCATCCGCAT GGGATCAAGA TTTTCAGGAG     52980
     CGATACTCTT CGCTGCCAGG ATTCTCAACT GCTCAACGGG GTCAGGTGGC AATGGCTCTG     53040
     AGGCAAACAC CTGCTGAAGG TGCTGTTCGG CAATATGTTG CACGATCGCG GCAAACAGCT     53100
     TCTCCTTACT CTCGAAATAG GTGTAAAGCG TTTCCTTCGA TACGGCGGCG GTGGCTGCAA     53160
     TCCGAGCCAT AGTGGTGGCG GCATAGCCAT CGCGCAAAAA CTCCTGAATA GCTCCTTGCA     53220
     AAATTTGTTC TGCCTTGGCA GACTGCCTGA TTTCTTTGGG CATAACACAA CCTGAAAGAA     53280
     TCTATTCAAT CGTACCGTAC AGTCTAGTCT AAAGACTACC CGATCGGGGG ACTTGCATCC     53340
     GAACTATGCG GTCTAAGATT GAATTAATCG AACCGAACCG TCTAGTTCGC ATAGCGGGTC     53400
     CAACTTAAAT ATTGTCAACA TAAAACAAGC AATTGAACAC ACGAATTGAG GATTTGGTTA     53460
     TGAGGATTAC GATCTTAACC ACGGGATCAC GGGGAGATGT GCAGCCCTTG ATTGCCCTGG     53520
     GGCAGGGACT AAAACAGGCT GGATATCGAG TCAAAATCGC GACCCATGAC ACGTTTCAAG     53580
     TGATGGTGCA ACACCATGGA CTAGAGTTTG CTGCGATCGC AGGAGATGTC CAAGCATTGA     53640
     TGGCTAGTGA AGCGGGACAG CAAATGCTCA AGAGTAAAAA TCCAATTTAC TTGATCCAGC     53700
     AATATGCCCG CATGGTCAAA CCGCTCGTCA TTCAAGCCAT GATGGATTCC TGGGCAGCTT     53760
     GTCAGGATAG TGATGCAATC ATCTTCACTG CTACCGCCGT TTGGGGATAT GACATCGCTG     53820
     AAGCATTCGG AATTCCCTGC TTCTTTGCCT CCTTAATGCC TCAAACGGCT AATCCGGATT     53880
     TTCCTTACCC ATCTGTATCA CCTGATTTGC AACTCGGTCG AGTCTTAAAT CAATGGTCTT     53940
     ATCCATTGCT CATGGAAGCC TTTGGCACGG TATTTCGTCA ACCGCTCAAT CAATTTCGTC     54000
     GATCGCAGTT ACAGCTTCCA CCCATTGCCT TTGGCACAAT TTACCGCCGA ATTGAGCGCA     54060
     CATCGACGCC AGTTCTGTAT GGCTACAGTC CCATCGTGGT ACCCAAACCC CAAAACTGGA     54120
     GCGATCACCA TCATGTCACC GGATACTGGT TTCTGGAATC AACAACAGAC TGGCAAGCCT     54180
     CTCAAGCACT CCTGGACTTT CTGACAGCAG GAAGCCCTCC CGTCTATATC GGCTTTGGCA     54240
     GCATGGGTGG AGGAGACGCC ACACAGACTC AGATGATTCT GGATGCACTG AAGCAAACGG     54300
     GACAACGGGG GATTTTGCTG ACTGGTTGGG GCGGCATTGC ACAAACCAAT TTACCGGATG     54360
     ATGTATTGTT GCTCAATTCT GTTCCGCACA GTTGGTTGTT TCCTAAGATG GCCGCGATCG     54420
     TCCATCATGG TGGAGCCGGA ACAACTGCCG CTGCACTCAG AGCGGGAGTC CCTTCTGTTG     54480
     TTGTGCCCTT CTTCGGTGAT CAGCCTTTCT GGGGCGATCG GGTCATGAAA TTGGGAACCA     54540
     GCCCATCCCC CATTCCCAAA GCCCAGTTAA CAACCGAGCG TTTGGCAGCC GCCATGACAA     54600
     CGATGGTAAC AAATCCAGTC ATGCAACAAC AGGCAAAGGC AGTTGGGGCA ACTATTCGAG     54660
     CCGAGAATGG AGTTCAGCAA GCAATCTCTG TTATAGAACG GGATCTCGCC ACTTCTAAGT     54720
     ATCGATTCGC GCAATGTGTT TGAGAAATGA TTCATGAGGA ATGCCAAATC ATTATCTCTA     54780
     CCGTTGAAAC TACTGTTTGT TCTTTCAGCA CGTGATGCAG TTAAAACATT ACGACTACAA     54840
     GGAGAAACCA TTATGATGAT TCACCATATT TCGATTCCGG CAAACAATCC GCTCCACGTT     54900
     GCCCAGATAT GAGCAGAAGT TTTGGATGGC AAAGTTGGAA TTTTTCCGCC CAACCCCAAT     54960
     AGTTACATGG TGGCGGCAGG TGATGAGTAT GGCACACTGA TTGAGATCTA TCCATCTCAG     55020
     AGCGTTATTG TTCCGGGACA GGGCGATCTC CAGGCATGGT TTCAGCAAAC TGCTCATCCT     55080
     GTCACTTACA GTGCCGTTCA TGCCGCAATT TCTGTACCTA CCAATTTGGA GCAAATTGAA     55140
     CGCATTGCAG CACGAGAAGG ATGGAGAGTA TTGTCGTGTA GTCGAGATGG ACTATTTGAT     55200
     GTGGTTGAAT TTTGGGTTGA AAACCAATTG ATGTTGGAGT TACTAACTCC TGCGATCGCT     55260
     CATAAATATC TCAATGCCAT GCATCCCAAA AACTTAGAAC AACTTATGCT GGATATGGCT     55320
     CAGGTTGAGG CAAGAGTATA GAGTTCTTCT TGCAAATCGA GGTAAAAACA ATGTCTCTAG     55380
     CTCACATCGC ACTGGATATT GCAATCATTT CGACTGGATT GTTTACCGGA TTGCTATTAA     55440
     CGATGCTGTG GATTTTTCAG CCAATGCTCG ATCAATTATC TGCTACTGAG TATGCCGAAT     55500
     GGATGCAGCG ATTTTTGGAC GTAGCACGGC GATCTCCCCT CAATATTGCC TTGATGTTTA     55560
     TTTCACTCCT GGCTCCCATC CCTGCCCTGT TCAGTTTCTA CCAAACTGCC AACTGGCTGG     55620
     CTTTTGGACA AGTTCTAATC GGAGTAATCA CCTTTTTTAT CGGGATGTTT TTGGTATCCC     55680
     GTTGGTTTAA TGAACCGCTG TATGACCAAA TTTTAGGCTG GATAACTGAG CAACCACCCA     55740
     CAAATTGGCA AATGGCACGC CAACGCTGGC ATTCTTTAAA CCTGATTCGT GTTTGTGCCT     55800
     CTGGATCTGC ATTTTTACTT TTCTTAATCA CCCTTTCGTA AGTTCTTACT ATGGCACTTG     55860
     AACGCAAGAT TGCCATATTG ACCGCATGGT GTGGCTGTAC GAGGATGTGA GACAGACTTA     55920
     CCCCCAATAT CAAAGCTGGC TTTACTAGAC ATTGGTGGAG ATTTTTAAAA TGAACTCATC     55980
     GAAAATTTTG GTCACAGGCG GAACAGGTTT TCTCGGTTCA CAGGTGGTCG ATCGCTTGCA     56040
     ATCTGCTAAT TGCAACGTCC AGGCTCTCAG CCACAGTGAC CGCCCCGGCA CCGTTCAAGC     56100
     AGACTTGCTG ACGGGTGAGG GATTGAAGCA AGCCGTAGCA GGAATTGATA CCATTATTCA     56160
     TTGTGCTTCC AGTCCCACCA ATCCCCGTCA GGTCGATGTT GAAGGGACAA AACGTCTACT     56220
     TCAAGCCGCA GAACAGGTAG GGGTCTCTCA CATTGTTTAT ATCTCGATCG TCGGAGTCGA     56280
     TCGCAATCCC TTCTATCCCT ACTACGGTAT GAAACTGGAG ACTGAACATA TCATCGAACA     56340
     GTCTTCCATC GGGTGGACAA TTCTCAGAGC AACGCAGTTT CATGAGTTTG TTCTGATGCT     56400
     GATTCAATCG CTCGATCGTC TCCCTGTCAT GCTCATGCCC AAAGGCTTTC TGCTGCAGCC     56460
     GATTCAAGCG AGTGAAGTTG CCGATCGCCT GGTAGAACTG GCTCTTGGAG CCCCTGCCGG     56520
     ACGAGTGGCC GATATCGGTG GTCCCGAAGT TTGGACAGCC GCCGATCTGG CCAGAGCGTA     56580
     TTTCAAATCA ACTGGGCGCA AACGAAGTGT TGTCGAACTT CCGATTCCTG GCAAAATCGC     56640
     GCAAGCATTT CGTACCGGAG CGCAACTCTG CCCTGAGCAG AGGTATGGCA ACGTTGGCTG     56700
     GGATGAGTTC TTGAATCAGA CCCTCTAATA AAACAGTACG AATTGGAAAG GAGAAGCGTT     56760
     TATGAACAGT ACATCCAATC AACAGTTGGT ACGTCGAGGC TGGCTCCAGT GCAGCTTATG     56820
     GCTTCTAGCC GTAGTCCCCC TCCTCATTGG TTTCTGGGCT TTTTTTGCTC CCCACCACTT     56880
     TTATGAAATC TTCCCACTCC CAGGTAGACA TTGGATCTCA ACCTTAGGTC CTTACAACGA     56940
     ACATCTGGTA CAGGACTATG GTGCCAGTAA TCTCGGCTTT GGCGTACTGT TAACTGTGGC     57000
     AGCCGTGTTG CTCGAACAGC AACTCGTTCA AATTGCCCTG GTGAGTTGGC TTGCCTTTGC     57060
     CGTCCCGCAC TTCATCTTTC ACCTGACGCA AACTCATCAT TTCTCACAAT TTGACAATGT     57120
     AACGCAGTTG GGTTCTCTAG GGTTTGTGGC GTTGCTCCCG ATCTCCCTGC TCTTCTATAT     57180
     GACTAAGCAG AAGGAGTAGG CTTTGAGTGA CTCAGTTAAA CGGCTCGATG AGAATCACGG     57240
     TCTAATTGAG TGAGCGCGAT CGCTCCGATC AACAACCCAA TGGCAACCAT CCTGGAAGCG     57300
     CTGAATGGAC GGGTTCTCAT GCTAAACCAA CGGTAGTGTT CTAGACGTGT GGAAGTGGGG     57360
     ATGCAGCCAG ACTAAACTCA TAGCGATTGA TAAACAGCCC AATGACGATG TCGTGCATCC     57420
     ACTCAGATTC CGAGAAACAA ATCGTTTTGC GAGCTAAGCG TTTGATTCGA GTGCGTAACG     57480
     CGAGGGTTTT GCGCTCAATC GTTTGCGTGT ACTGCTTGCC GACTTCATGC TGATTTTCAT     57540
     CTAAAAGCCG GGTATAACCT CCCCAGTCAT CGGTGTAAAA ACGCTCAATA TGGGGATGAT     57600
     CGGTACCACA GTGCCCAGCT TACGTGGTCA GGAATATTGA GTTACTATTG GTAAATCTTG     57660
     ATTCAATACC CAATTACCAA TGTCTCGCAG TTTGTAATCT ACTGGATCGT GGAGCGTAAA     57720
     CGTCCGCAGG TCACGCCAGT ATCGATCAAA ACCATATTTC GCTGCTGTCG CGCGAGCCCC     57780
     ATTGACTTCA AAAATGCGAG TAGTGATGTC CAATCCAAAC CGGGTTGCCA AAGCTTTGGC     57840
     GGCATAGACG TTGATCGCTA TTTCCCCCCG TTCTTCATGG CTCAAGTCAT CCCCCTTTTC     57900
     CCAAGCAGCT TGAACCCGTT GGGCAGCTTG ATCGGTTAAA GCGATCGCTG CATTAAGCTC     57960
     CATCCACAAA TCACCGTAAT GGTGGAGGGT GTAAGGGTCT TTAGTCGCAC TATCAACACC     58020
     TGATGTCAGC CAAGGGCGAG CCGTTGTCAC TGTATAGGCT CTTGCTGATT CAAACGCTGC     58080
     TTGGGCAATT CCTAAATAAA CCTGAGTTTT CGCTAGCTGA TTGACAACAA ACAGAAAAGT     58140
     GACGAAAGCA CCATGGGGGT TCGAAGGCGG TCCTAAAATT TCATCCGGCA TCACTAAAAC     58200
     ATTTTGAAAT GTAAAACTGC CACTAGCTGT CCGCCGTTGC CCCATATTAT TCCAGTCATT     58260
     GTTATAGGTA ACGCCTTCCC GCTCTTTAGG AATCACAAAC ACAATTGGAA AATCAATTCC     58320
     TTCCTGAATT GCAGCAAATA CTCGCATATC TGCAACAGCA ACACCTGTAC CAAAGGATTT     58380
     GACTCCATTC ACCCGATAGT GGTTGCCCTC TGGTTCAATC CTCAGGCGTG AATCACGGGC     58440
     ATTGAGGGCA TTTCCCCAAA AGAGATGATG TTGGGCTGTA GCACGGTAAT AGCGCTCTGC     58500
     CTGAGCAGGT GTTCCAATAA CATGTGCGAG TACGGACAGA ACCATATGGT TGGCAACAAG     58560
     CTGTCCAATG GAACCATCTG CTTTTGCCAA TTCCCGAATT GTCCAAAATG CATCTATCCA     58620
     GCGTGCTCCA ATCCCGCCAT ACTCGCGTGG CACGACCAGG GGTAGTAAGC CGGACTGACG     58680
     GATTTGCTGC ACCTCATCGT TGGGTAACCC TGCGATCAGA TCTCGCTCGA CCGCTGTTGT     58740
     GGCAAGTTGG TTTGAAAGGG CAGTAGCAAT CTCACGATAG TTTTTCAACC TACTGTATTT     58800
     CAGGTCTTGA GTGATTTGGT CAGTTAATAA CATGAGATCT CCTTCATGAG AACGGAATGA     58860
     GGTCAAATTC AAAGGTTAAA ATCAATGGTT CTAGGCAAAA ATTAGATTGC TACAGAGAAG     58920
     AAACGATTGG AGAGGTAAGA CCACAAAACG GGGCTGCAGG CTTTGCAAAT GGCCTCAATA     58980
     TGGCGATCGT CCGTACCACA GCAGCCCCCC AGTACATTGA GGTGGGGAAG GTGCTCTCTC     59040
     AACTGCTGGT ACAGACTGCC CAGTTCTGCC GGATTGCCCT CATCCAGGGT TTCCGATTCA     59100
     TTTAACTCGG CATGGCTCTT GGTAGAAGCA TTGGCCCGAA TCCCCCGAAT GCGTTCGACC     59160
     CAGGTTTCAC CTGTCCGTAA TTCATCCATA AAATGAGTGG GATGGGCACA GTTGAGCATG     59220
     TAATAGGCCG GTGCGGCATC CGTTGCCTTA TCCACCTGGG CAATTGCCTC TTTCAGGGGT     59280
     TGGCCCGTGG GCAGCTTGCC ATCAGTTTCC ACCGTAAAGG AAATCACAAC GGGGATTCCT     59340
     ACAGTCTTGG CCCCGCGAGC AATCCCGATC GCTTCCTCGA CATAGTTCAT CGTGATCGCC     59400
     GTCACCAGAT CAGCGCCTGC CTGCCGGAAA GTTTCGATTT GTGGGCGGTG ATAGAACTCA     59460
     GCTTCAGTCT CGCTCATGGC ATCTGCAGGA ATGTAGCCAT CTCCCCGAGG GCCCAGACAA     59520
     CCACTGATCA CCAGGCGGCT CTGTTCCGTT TCAAATTCAT GGCGGATCTC GTGTAGCAGG     59580
     GCGATCGCTT GCCCATTGAC TGCCGTAAGT GCATCTCGGT CATACCCCAG TTTTGTGCCC     59640
     CAATCGGGGT TGGCTCGCCA GGTCGCACTT TCGAGAATGC AGCCCACCGC ATAGGTGCTG     59700
     GCCATCCGGG CATAGGTGCG GAAATACTTT TGCAGAGCTT GATAACCTGA GGCAGATTTG     59760
     AACAAATCAA AGGCAGCAAA CTCAGGTAAT TCAAGTCCTT CACGGAAAAT GAGGGTTGTT     59820
     TCAATTCCCC CATCCGTGAT GAATAAATCA CTGGACAATT GAGGCAAATT ATTGCGGTAC     59880
     TGGGCCATTA TAGTTCTCTT GTTGGATTCG AAATAGTTTC CATCAATTGC TAGCGATCAG     59940
     AGTGAAAAAA ACCTGTGAGT TGTTGATTGA AGTAGGTTTG CTTTAGCCTC GGATAGGAAT     60000
     CTTGTCGCTC ATACCTTTCT TCAATCCAGG CTCGAACCTC GTCTTCAGAG CTGAGCCAGC     60060
     CAACTCTTCC GGTGACCGGA TCATAGGCAT ACCACCAGAG ATGGCCATAG CGATCGCGCT     60120
     TGAGCAAAAG TTGAAGTTCT GTCTGTTCAA ATAAGGCATC TTTAAGCCAC TGCCAAATCC     60180
     TGCTCAACCA GGATGGAGAA GAGTGTTTGG CGACGGGAAA TGTTGTGGGT CTGGTTTCAT     60240
     GCAGAGATAT GTTCATTGAC GGTTGCCTCA ATGATCGGCC AATTGAATTC TTGCCGACGG     60300
     GATAGGTTGC CTAGGGCTTG ACTTTGAGTT AATTCACTGT GGTTAATAAT GAGCGTAATG     60360
     CACAGTCCAG CTGCTAGAGC TAAGGCCTGA ACGTTCGTTT TTCTCTCAAC TTTCATACAC     60420
     TACCTCCTGT CTGGAGAGGT GAGTTAATTG CAATTTAGGG GGCGATCGGG AAGAACTAGA     60480
     GAAGACCTCG CACGGGGAGC AAGCCAAAAA ATCTATCTAT TGATAGACGT CATTCAAGGG     60540
     CAAGATTGAA ATGGCTTCAA CCCATTCGAT TTAAGTTGGC GGAGGGCGGA TGCTCACAAC     60600
     TACTGGGATA ATGAATCAAA GGGTTGAGTA AGCTGGTTAA AACAGAGGAC GTTAATGATC     60660
     AGATCGGTCC TGACAGGCGC GAAGGAGACT GACAATGGCC CAGGATCTAA TTCCCAGTAG     60720
     CTATCAGTAC AGTCAGCAGG CTGAAGAGGC CCTCCGCTTG ATTGTGCAGG GAACCCCTTG     60780
     TGAACACGTC GCTTCCGGCA AAAAAGTCTT TTTCTATCCC CACAGTATCC GGGACCTCTG     60840
     TCCTGATGAT CCTTACCTGG AAGAGTTTGG GGCCGAGAGC TATCTGGGCA TTCCCCTCAG     60900
     CAATTCGGCG GGTGAGATGC TGGGCTATCT GGCAGTTCTG GATATCAAAC CGATGCAGCC     60960
     AGATCCGGGG CTTTGCATTT CTACCTCTCT CATCTCCGGT GTCGAGGGGG ACTACCACGC     61020
     CCTGGCGGTG ATGCAGGATA TTACTCAGCG CAAACATACA GAACTGGCCA TGCAACAGGC     61080
     TAAGGAAGCG GCGGAGGCAG CCAATCAGGC CAAGAGTGCC TTTCTGGCCC ACATGAGCCA     61140
     TGAACTGCGC ACCCCCCTGA ATGCGATTCT CGGCTTTGCC CAACTGATGG AGCGAGATAC     61200
     TTTGCTGACA ACCGCTCAAA AAGAATCGCT GTCGATTATT AACCGCAGTG GCGAACACCT     61260
     GTTGGAACAC CATCTATTTG AACCGTTTGT CCAAACCACT ACGGGAGCCA ATGCTCAAGA     61320
     GGGAACGGGC TTGGGGCTGA CCATTAGCCA CCAGTTTGTC CAGCTCTTGG GGGGTGAGCT     61380
     GTGGGTGGAG AGTGAAGTGA ATCGGGGGTC TACCTTTAGC TTTGATCTGC CGGTGGAATT     61440
     ACCCTATGGC GCGATCGCCC ACATCCCTGT ACCGACGGGC CGGGTGGTTG GTTTGGTCAG     61500
     TGGCCAGCCA GACTATCGCA TTCTGGTGGT GGACGATCGG GCTGAAAACC GCGAACCCTT     61560
     AGTCCAACTC CTGAGTAGCG TTGGCTTTTC CACTCGTACC GCCACGAATG GCTGGGAAGC     61620
     GATCGCCCAG TGGCAGGACT GGCAACCGGA CCTGATCTGG ATGGATATGC GAATGCCGGC     61680
     ATTGGATGGC TATGCGGCCA CCGCACAAAT TAAAGCCCAG TCCCAGGGAG CAAAGACCGT     61740
     CATTATTGCC CTCACCGCTG CAGCCTTTGA GGAACAACAA CAACAGATTT TTGCGGCTGG     61800
     TTGCGATGAT TTTGTCCGTA AGCCCTTTCA CGAAGATGTG ATCTTTGCCA AAATGGGCGA     61860
     GCATTTACAG GTTCGTTATC TCTATGCTGA GGATCAATCG GACCATCGTG ACCCGGCCCA     61920
     TTCCAAAGCT GCACAGGGAC CAAGCCCAGA CCTGCTCGGT GTGATGTCTT CGGATTGGAT     61980
     TGAGCAATTG CACCGGGCCG CGATCGCCGC CGATGGAGGA CAGATTGAAC AATTATTAAC     62040
     ACAAATTCCC GCTTCTCATG CAGAACTGGC CGATCGGCTA ACTGGCTGGT TAAGCGAATT     62100
     TGATTTTGAT CCAATCCTTG AATTGATTGA ATCTCTAAAA GGAGCCAGGG ATTAATGGCC     62160
     GTGCTCCCCC CATTCCCTCA GCCCACACCG TTCAAATCTG TTTTGTTGCA AGCAAAGCGT     62220
     CAGCAGAGAC GATGGCAAAG GGGGACTTAT TTGATCGGCT TGATAATGAG CGTGGTCATG     62280
     GTTGGCTGCA CGGCTGAGAC TCCCCGGCGC TTAACGACCA GCACCCCTAC AGCTGCAACC     62340
     AAGCTATTAA CCATCTGGTG GGACAAAGGT TTTACGCTGG AGGAAGATGA AGCCCTGCGT     62400
     CAGGTGGTGA AGAACTGGGA ACAACAGACA GGGCAGCAAG CCAAACTAGA TTTTTTCACC     62460
     ACAGACGAAC TTCCCAAGAA AGCGCAACGG GCCCTGCAAG CAGGTAACCC GCCCGATATT     62520
     ATGATGAGCC ACGGCGCTGA ACAAACCCTG AATCCGCGTC TGGCCTGGGA AGGGCAACTG     62580
     GCAGATGTCT CTGATGTGAT TGAACCAATT CGTGATCTTT ATCCAGATAC CATTTTAAAA     62640
     AGTGCCTATC TCTATAACAG AGTAGCCGAT CGCAAGAGTT ACTATGCCAT TCCAATTCAT     62700
     CAAGCCACAA CCCAAATTTT CTACTGGCGT GATTTGGTTA AAAAAGCTGG TAAAACTGAG     62760
     AAAGATATTC CAGAAGATTG GGATCGTTTC TGGCAATTCT GGCAACAGGT TCAGAATGAA     62820
     TTACGTCAGC AGCAGCCTGC CAAGATCTAT GGTTTGGGAT TGCCGACATC AGCCGTAGCC     62880
     AGAGATACCT ACGAAACCTT TGAACAGATT TTAGAAGCCT ATGATGTCCA AATTTTGGAT     62940
     GACCAGGGGC AATTGCGCGT CGATGATCCC CAGGTGCGCC AGGGCATTAT TCGTTGTCTG     63000
     GATTGGTACG CTCAATTGTA TCGCCAGGGC TATGTGCCGC CAGGGGCAAT TAAATGGCTA     63060
     AACCCAGATA ATAATCGTAG CCTGCTGAAC CGCGAGATTG TCATGACCCC CAACAACTCT     63120
     CTGTCGATTC CAGCGGCGGT GAAAGATGAT CCAGAACTTT ATCAGCGGAA ACTGGGAACG     63180
     ATTGGCTATC CCAATAAACC CAATGGGCAA CCAATGCGCT ATATCGTCAT TGTGCGTCAG     63240
     GCTGTCATTT TTACAACTTC AAAACATCAG GATCAGGCGC GATCGTTCCT GCGCTATCTG     63300
     CTCCAACCCG CGGTCTATGG GCAGTATCTC AAAGCCGCCG GCCGTAATTT GCCAGTTTTA     63360
     AAATCGGTTT GGAACGATCC TTTCTGGACA GATCCCAAAG ATCCGCATCG CTCCACCGTT     63420
     GCTCTCAATC TAAAAAATCA TCAGACTCGT CTGTATTACT ATGTGCAAAA CCCTGCCTAT     63480
     AGTCTGGTTT CTCAAGATAG AATTTGGGGT AAGGCTTTGA AACGAATTGT GATCGAGAAC     63540
     GAATCCCCTG AACAGGCCAC CGATGAGGCG ATCGCCCAGA TTAAACTAAT TTTTAAACAA     63600
     TGGCCAAGTA ATTAACCAGA GTAGACCTTG CAAGCGCTAT AAATTGATCG TTGAGTAGGA     63660
     AATTTATTTA TCATGATTGC TACGATCGCC GCTCCAGAAT TTTGCGGATA GCGGGTAGGG     63720
     CTGCCTCGAT CACCTCGGGT TTGGGAGTAG TTTGCTGCCA GCTTGCTCGA AGATTTAGAT     63780
     GTTCCAGCCA GGTTTTCAGG TGTGGGTAAG GCTCCAAAGC AAAGCCAAAT AGGGCTAGTG     63840
     AGGGAACCAA GGTGCCTGCG ACGATATCAG CTAAGGTGAT TTTGTCATCC ACAAAGTACC     63900
     TCTTGCCGTC CAGAAAATTC TCAAACATCT GAATAACAGT CATGACCCGG TGGTGAGCAG     63960
     CATTAAGTTT ATCGGGTTCA ACGTCCAATC CCAGCAGTTG TCGGGTGAAG GGTAACATCG     64020
     CAGGCTGGAG CTCGTTAACA GTAATCATTT CAACCATCCT GACCATGGCT ATTGCAACAG     64080
     GTTTAACAGG GATGAGTGAG GGATGAGGAT ACTTTGCTTC CAAGTAATCC AAAATCGCCA     64140
     GCGAGTCAAT TACCCGTAAT TCATTATCCT CAATCACTGG TATTTGCTGT AATGGATTAA     64200
     TTTCAGTAAA TTCCTGGCTA AATTGTTCCC CATTTAAGTT AACCTCAAGA GGCTGAAATT     64260
     GGATTTGTTT CTCCAGTAAT GCTACCCAAA CTCGACGAGT ATTGAGTGAA ACCTGATTAT     64320
     AATAGAACTT CAACATAATA TCTCGCCGTA AAACTCTATA GCTAATCCTA ATTGATTAAG     64380
     TGCGTTGAAA GTTGAGCCAG AAGTCTAACT GTCTGCGAAT TGCCTCCCGT TCGGGACCAG     64440
     GATTACTGTA ATAAAGCCTG TGTTTGAGCT CGCGAATAAT GGCTTTGCGA TCAGAATCTG     64500
     ACATTTGATT AGCTCCTTGG GTAGGAAGTT GATAGAAAAT CATCGCTATA AGAAATCGAT     64560
     TGAGAGGGGA CAGACCTTCT GACTCAGGAA AGTTTTAACC CCCCGTCTTG TTAAGTCAAT     64620
     AAAAGGACTG AGTGAAAGGT GAGTATGAGT CCTTAGTAAC GAATGCCGCG ATAGCGCAAA     64680
     CCTAGGAAAA GCTGGGTGAA GGTCAAATAG ATTGGACAAT TAATCCGATA GGCAATACCG     64740
     CGGTAACGGG CGGAATATTC TACTTCAGGC ATATCAACAC CGGGTTTACG AACTTCGTAT     64800
     GGGGCACCGC GATAACTTAA TTGCATGGCC TTAACTCCTG GGGTGAAAGG AATGATTTCT     64860
     GAATTGATTT CAGCTTAGGC AGCGATCGGG AAGAACCAGG GAAGATTCCA ACGGGTGTTT     64920
     AATGGAATAA TCTGATGAGC AGCAATTCAT CTGAATCCTA AAGAGTTGAG TTAATCCTGC     64980
     CGATTCATCC CGAAGAGCAA GCCTAAAATA GGTGGGTATC CCGCTGCATC GCCTCAATGA     65040
     AGCTCTGGTA TCAGCCCCTC ACCGATAAAG TTGCCAGTAC ATTCCTGCTG CTTTCACTCG     65100
     TTGCCGTTGC CGCCGTCAGT GGGATTACCT TTGTCCAAGC ACGAGAAGCC CTGAAGCAGG     65160
     CTGCCTTCGA TCGCCTGGAA GTGACGGCAG ACTTGAAAGA AGAAGAAATT AAACGCTGGT     65220
     TTGAGGATCA GCAACAGGAT TTTCTGCTGA TCAGCCAGTC TCCCGATGTA CAACGCAATC     65280
     TCAAAATTTT ACTCAACCCC GCTCTACCAG CCCGCGAACA CGAAGCCGCT GCCGCCCTGC     65340
     TGTCCAAATA CTGGCAACGG GCCGTGCAAC TGAAACCCAG CCTGAGGGAA ATTTTTGTCA     65400
     TTAACCGCAG TAATCGTGTC CTGCTGTCTA CACATCAGCA ACACAATGGG GAGTACGTAA     65460
     TTCTGGCCAA TGTCACCTAT TTTGATGCCG TTGAATCAGG CAATTCCTTT GCTCCAATTT     65520
     TCTATGTATC TCCCGAAACG GGCAAACCCG CCGTTACTTT TGCCACCCCC ATCCGTGATC     65580
     AAGCCGGTGT TCGGCAGGGT GTGGTGCTGG CCCATCTGAA CCTGAACCGG ATTGATCAGA     65640
     TCGTGCGGGA ACGGGCCGGG CTGGGCAGGA GTGGCGAAAC CTATCTGGTC GGCTCGTTAG     65700
     TCAGCAAAAA TACATTTATT TCCGGTAAAC CCTCTGGGCA GCAGGGGGAG GCGGGGGTGA     65760
     GTAGCCAGGG AATTGATGCG GCCATGAGTG GGATCAGTGG CTCTGATCTG TATCAAAATT     65820
     ATGCCGATGT GCCCGTTATT GGGGTTTTTC GCTGGCTGAA TGATCAGGAT ATTGCCCTCC     65880
     TGGTGGAGAT GAAGCAGTGG GAAGCGTTTG CACCGGCCCG GCAACTGGCG ATCACGGTGG     65940
     TGCTGGTTGG TCTGATCTCG GTCGCTCTCC TTTCAATCTG TGTTTACTGG TTGGCTAAAC     66000
     AACTGAGCTT ATCCCGCCTG CAACTGGAAA ACTCCAGCCG TCAATTGGAA CAAAAAGCGC     66060
     AGGAAGCCGA GGCCGCTAAC CATGCCAAAA GTGCTTTTCT GGCCCACATG AGCCACGAAT     66120
     TGCGCACGCC CCTGAATGCC ATTCTTGGTT TTGCCCAGGT GATGGAGCGA GACCCGCTTT     66180
     TAACCCATCA ACAACAAGAA TCCTTAGCCA TTATCAATCG CAGTGGTGAG CACCTGCTGG     66240
     GCTTAATTAA CGATGTGCTG GAGATGTCCA AAATTGAAGC GGGGCAGATT GTTTTGCATC     66300
     CGGGTGCCTT TGATCTACAT GAACTGCTGC AAACCCTGCG GGACATGTTT CAGGGACGGG     66360
     CCGAGGCCAA ACAGCTTGCA CTCAACGTCA ATCTGGCAGC CGATCTCCCT CGCTATGTAA     66420
     TTAGTGATGA AGGCAAATTA CGCCAGGTGC TGATCAACTT ACTCAGTAAT GCGGTTAAAT     66480
     TTACCGATCA AGGAACGGTA ACCCTGGAAG CTGCTTATCA ACATCACACA GGAGCGAACT     66540
     ACCTCACCTT TGCCGTTGCT GATACGGGAC GGGGGATTGC ACCAGAAGAG CAAGAGCATT     66600
     TATTCCAGCC CTTCTTCCAA TCTGCTGCCG GGCTTAAAAC GGAGGAAGGA ACAGGGCTGG     66660
     GACTGTCCAT CAGTCGCCAA TTCGTGGACT TAATGGGGGG GCAGATCAGC GCCAACAGCC     66720
     AACTGGGGCA GGGAACAGTG TTTAAGTTTG AAATTAAGGT GGAACTGGCA GCTCCGGTGG     66780
     TTTCTGATCG ACCTGTTTCA GGCCGCGTTA TTGGTCTGGG TCCCGGCCAG TCAGAGTATC     66840
     GCATTCTGGT GGTGGACGAT CGGCAGGAAA ACCGCGACCC CCTGATTGTC CTCCTCAATG     66900
     CTGTTGGTTT TCAAACCCAG ACGGCAAGTA ATGGCAAAGA AGCGATTGAA CGCTGGCAAA     66960
     CCTGGCATCC TCAACTGATC TGGATGGATA TGCTGATGCC AGTGATGGAT GGGTATACCG     67020
     CCACCCGCAC TATTAAATCT CAACCTGGTG GAAAAGACAC CGTGATTATT GCCTTAACCG     67080
     CCACCGCCTT TGAAGAACAA CAGGCCCAAA TTCTGGCAGC GGGTTGTGAT GATTTTGTTC     67140
     GTAAACCCTT TCGGGAAGAG GTGATCTTTG AAAAAATGGC TGCACACCTG GGAGTGGAAT     67200
     ATGTGTATGC TTCACCCCTG CCGATCGCAA CCCAGAGTAA AACCGAAGCT GCCTTACTCC     67260
     TGGCCCCAGA AACTTTACAG GTGATGCCAT CCGACTGGTT AGCCCGTTTA CATCAAGCTG     67320
     CGATTCAAGC TGATGCTGAA CTCATGGCCC AACTTTTGAG CGAAGTTCCC CTTGAACAGT     67380
     CCCAACTTGC CCAGTCGATC GCTCTCTTGG CTGAAGCCTA TCGCTTTGAC GAAATTATCG     67440
     ATCTTACCCG TCCAACCTCG CGTACCTGAA AGACTTCTTT AAGTGGGTTC CCTTATAGGC     67500
     ACAAGCAATC AAAGCCACCT TTTTGGCTAG CGGTGGTTTG GTTTCCATTG TCAGAATCCT     67560
     AGGGTGAATT GAGTTTGAGG TAACGGGGGA AGGCAATTAC CAAGCCCCTA TGTGATCCAG     67620
     AAACGGTGAG AACTCTGGAT CTGACCAACG CAGAGGCAGG CTAGCTTCCA CCCGATAGCC     67680
     GCTTTGCAGA TGAAAGCGCA GCAACCGCTC TGCTCCGACA TAGGTCAGAA TTTCAGTTCC     67740
     TTCCCAAATG ACTTCAGCAG TGCCGGTCAA ATAGAGCAAA TTGCCTTCAG TAAAATCGAT     67800
     AACCGAAGCC GGAGAAGCGT TTCTCGGTGA AGCCCGGTTA ACGATCGCCC AAGCTGATCG     67860
     CACCGCGCGG ATTGCCAAGC AATTCAATGG GACGCAACCA AAACGACTGA CGATCGGGTA     67920
     TTTGATATGT GCCTTCGATC GCCTGCTTTC CCAAATGATC CAAGCCTTTC GTCAAACATC     67980
     CCCAGGGGTG GAGATCGTCT TAAAAGGAAT GCATACGGCT CCCCAAATTG AGGCTTTGTT     68040
     CGCAGGTGAA ATAGATGTCG GGTTTGTCTA CTTTCCGGTG AATCAGCCAG AGCTTTTAAC     68100
     CCAACTAGTG CTGCGTGAGC CTTTGGTACT TGTGTTGCCC AAAGCCCATC CCCTCGCCGT     68160
     GTTACCCACT ATTCCCCTCG CGGTCTTAGC CAGTGAGCCG ATGCTAATCT ATCCCCGCTT     68220
     TGTGAAGCCT GATTGTTACG ACCTGATCAT CACTCTGTGT CATGAAGCGG GTTTCCAACC     68280
     TCGGATTGTG CAAGAAGCAA CACCACCGGA ATTACTCGTT AGCCTTGTGG AAGCGGGCGT     68340
     TGGCTTGGCG CTGGTGGAAG CCAGTGTGGA AAGTCGTCAC GATCAGGGTG TGGTCTACCG     68400
     ACCCATTGCT GAATCGACCC CTTATTTAGA CATGGGGGCA GTTTGGCACA AGGGGCGATC     68460
     GGGAGCGATC GTCAATCAAT TTATCAGTGT TGTCAGACAG TCCATAAATT TTGATGAACA     68520
     CCATCAGGGC AAATAATTTC GTCCAGGGGT TCCAAAACGC ACAGACGAGT TCCTTTCTTG     68580
     CCCCAGTCTT ATCCCGAACT GACGTTAATT AACCTTTTTA AGTGCTGCTT CTACATGCTT     68640
     CAGTAATCGG GCAATATCCT TATTAATAGT CTGAAGTTCA GCAATATCAG GTTCAGGATG     68700
     TGCTCTCTGC CACCGATTCA GTTCGGTTTT TAGCCGACGA AGAGAGGTAA TAGTAGCATC     68760
     ATTGTCTGCC TCACCCAAAA GCCGGACATC TGTCACACTT TCTTCAGGGG ACTCATTTAA     68820
     GTAACGGCGA ACAGTCCGAA TGCTCTTACC GATAATTACT TCGAGTGCGG GTCGTAGCGC     68880
     TTTTTCACCT TTTGCAGGTC TTCCCTTTAG ATCTACAAAA CCTGCATTTC GCAATCGCTC     68940
     AGCTAAGGCT TTAACTTCAT TGGGGGTGTA GTCCCGCCGC TTCTCGTTTT CCGTAACTTC     69000
     AACTTGCAAA GCTAGATCAG GATTTTCCTC AGCATCAAAA TCTACGACTC TGACCGGAAT     69060
     AAGGTCATTA GGAAAGTGAG TGGTATAAGC TTCAGGATTC ATCTCCTTAA CAGCTGCAAT     69120
     TGCTGCACGG CGATGTCCAC CAGCCAGCAA TCTGCCTCGA TTATCTACGA CAAGCGGTTC     69180
     AAGGAGTCCG AGTATAATAA TTGACTCTGC TAGTTCATTA ACATGTTGGT CGCTTAATTC     69240
     TCGGGTATCT TGAGTGCGAT TAAGAATTTT TGCTAAAGGT AGAGTTGAAG AGCGAGATTG     69300
     CTCTAGTTCA TTTCTAGCTT CAGCTGCTCG ATCTTGTGCT TGAATTGCAG CCCCAGCAAG     69360
     GTGAGCTGCG TCCAATAACT CTGCTGTAGT GCGTCGTTTG GGCATTTTTC CTCTAGTCAT     69420
     GGGCTGTTTC TATGATCCAT TCAGATAACA CCGCTAATTC CTGCGCTGAA CGGGATCGAG     69480
     GTGCATAATC CATCAAGGGT ATCTGCTGTG CTCCTGCCTG AGAGAGGTTA GTATCTTGAT     69540
     GGACAATAAA ATGCTTGATA TTAGGGTAAG ACAGAGCTAG TTGAATTGGA AGCTCTTTAT     69600
     CAAGAGCCCG TCGTTCATCG ATTTGAGATA AAACTAAAGC CCATTGTTTA GGCCCTCTGC     69660
     GTTCGCGGCT CCGATAGCTC TCGAGAACCC CTATTACACG ATTGGCACCC AGAATGGCGA     69720
     AGGGATGAGC GTTAGTCACC ACCAAAGTGC TATGAGATGC CACTAATCCT AAACGCTCAA     69780
     GGGTTTCATT TCCAGGAGGA CAGTCTAAGA TGATAGCTGT GTAAGCCATA TCTTTAACAG     69840
     CATCTGCCAA GTCTTCCGGA TGTAACGATT GGATAATTTG GTTGGTGAGG TTCGGTCCTC     69900
     CAGCCAAAAC GAAAAGCCCT GGTGCTGCTT CTAAGGGTTT GGGATTAGAC CCCATCAAAA     69960
     GTTCAGCGGT CCCAGGTGCT GTTGGATCTA CTCCTAATGC ATAGGCAGCA TTTGACTGGG     70020
     GATCTAGATC AATGACTAAT ACTTTATTAC CCTTTTTAGC CAGAACGGAG GCAATTCCAC     70080
     AAGCGATCGT GGTTTTGCCA ACTCCACCCT TTCGTGCCGC TACAGCTACC CGATACTGAA     70140
     TCATGAGTTA ACCCTATCAT GTGTCCTGGC TCTGTCATTA CTATTCAGAG CTTATGTAAA     70200
     TTATTCAGGC TAAGACCCGT TCGCCAAAAG CATCATTATT AAGACTGAGC GAGATAAAGA     70260
     GCTGTGGAGT GGATGACCAT ACAGGGACAA GCGGACAATT ACTGAAGAAT AATTACGTAT     70320
     TGGCAGATGG AAGCAAAATG AGGGATTCTT GAAAGAGCGA CGTTCACGCT AGGGCATTCC     70380
     CTTTCAATGT CAGATCGACC AACTGCCAGT TCTGCCAATG TCAATCCAAG AGCAGAGACG     70440
     CTTGCCACCA TGTGGAACCG CTGAGCGTTA ATTTCTTCGG TTGAGCCATT TAACAAGCAT     70500
     AGAGGAGAGC CATGCGTTAT TGGGTTCAGT ACCATAGCTA TGAAAAAATG GGGGGGCTTC     70560
     CCAGCGGCCC TAGCGAAACC GTAAGCAATT GTAAGATAGT TACCGATAAA GATATTGTTC     70620
     TGGATACGAT CAGTGACACT GTTTTTTTGA TCGTAGGTGT TTCTGAAAAC CCTAAACAGT     70680
     ACCTTTTATG GGAGCGGTTT ATTTGTGACG ACGTAGCAGA TGATGGTGTT CCACCCTGGA     70740
     AGTATAGTGC TACAGGAAAG GGGTGGGTAC TGATGCAGAG GCGGGGGCGA GAACCCTTAC     70800
     TAAACCATGA ACCAGGGTTT CGTGAGTATC TTAGCTACAC TGGAAACTTT TCCCGAGGGT     70860
     TTCATGAAGT GACTGACCAC CCATTCCTGG AGGTTCTGCT GCGTTTATCT GAGCGGTGTA     70920
     AGCCGCCCTC TAAAAATTGA TTTTAGAGAT AGCTGAAAAA GTCAGCCCTG CTCACTGCGT     70980
     TCGCACCCCT ACTCCCTCTA GGCTAGGCCC ATTCACCCAC CCCACCCAGC AACTCACCCT     71040
     GCTTGGTTCC AGCTCAGTCG CTCCTACCGT TGCATCCTTA ACCTCCACGT CACTTCGCCC     71100
     AGATTCCTCG CTCGGTCGCT CCCTTCCCTC ACGCCCCCAT ACAAAAAGAT GAGATAGACA     71160
     AGGGAGAGCC TCTCAGTTCT TTCAGCATAA TTCTTGTTGA TAATCTGACC AACAAGCAGA     71220
     ACCAGGAATT GAACCTCATC AGTTCAGACC AAACATATCC AAACCCCCCA AATCCGCTCA     71280
     TTGCCTGCAG GAAACGAGAA CCGGCAGTGT CCAAATGTTC TATGGGTAAC ATCTTTTTAA     71340
     GCCCCATCTT CTGAAAACAG AGAATATTTA AGGTTCAATT AGAAATATAG GTATTTGTTA     71400
     ATGGTTGACG AAATGGGTGA TCTCATACTT CACTAGATCA AACCCTGTAG CCGATCGAGT     71460
     CAAGCCGATG CTGCAGAATA ACAGTTCAAA AAAGACTAGA GGTGTGTTGA TGGTCTAGAA     71520
     ACCTTTTAAA GCAACAAAAC CCACTGCTCG AACAGTAGGT TTTGTTGCTT CCCCGGCTAT     71580
     ACAACCAAGG GACTGAAAAT AATGCTTTTT CGACCGGCAT TGATTTGGTC TCCTTACGGA     71640
     GCCTTGCGCT TATTTTAGGC ATTCTTTGCC TGCAAGGTCA AGCCTTGTCC ATTTTTTTGG     71700
     ACGCAAGGCT CCCTATCCAT TTGTCAAAAA CGATAGGGAG AACGATGAAA ACATGGCTTT     71760
     AGCGATAACT CACTCTCCCT ATCGAACCAT TCATAATAGG GAGAATATTA ATGGTTTTAC     71820
     AGACTTTATC CCCAGACTGC ATCACAGATT CCAGTCTGGA GGGCTTTGCA ACACGCACCC     71880
     GACTGGAGTG GACCGTGGGC AGCGCAATTG ATCTGGAGCT GTTCGGTGCC ACCGTCCAAG     71940
     TGGTCTCGGA TACCGAGGTT GATCCTTACT CCCGTGAGGT CAGCTATCCC ATCCACGAAG     72000
     CCCTGAACTG GAAGGTCACC CGGTTTGGCC AACAAGCACG AGCAACCCTG TTCGGGGCCT     72060
     TAATTCTCAA TGACGATGGC ACAGTCTGGC AAGTCAAACT CAACCAACCG CGGGTTGATC     72120
     AGGAAAGGGG CAAGTCCCGC AAGTACGAAG TCCCGGTGGG AACCCAAAGC CGGGCCTGGC     72180
     TCCCTCATCA GTTCCCACTT ACCCTGTGGC AACGCATTGC TAACCGCTAC GGCCTCAAGC     72240
     TCTCAGAAGC TGATTTAAGC CTGGGGTTTC GGGCCTGGCT GATCCAGCAC CCCGAAATTG     72300
     CCATCACGAT CTGTGAGGGG GCCAAGAAAG CCGCCTGTCT GCTGAGCCTC GGTTATGCCG     72360
     CGATCGCATT GCCGGGGATT TTCAACGGTT ATCGCAAGAA TAATCAGGGA CTGATCCCCG     72420
     ACCTGGCCGC GATCGCAGTC CCAGGACGGC CCATCTCCAT CTGTTTTGAC CACGACCTGA     72480
     AGCCCCGGAC GATCGAAAAC GTGAACCTGG CCACCAAGCG ACTGGGAATG TTGTTCCTGG     72540
     AATCCGGCTG TACTGTGCGC GTCATTCCAC TACCAGGGCC AGAAAAAGGG GTGGATGATT     72600
     TTGTCGTGGC GCAGGGAGCT GAAGCGTTTG CCCAGCTGCA TGAGAATGCA CCCTTACTCC     72660
     AGCAGTGGAA TAGTCAAAAA CTGTGGGAGT TGACACTACA GCCCACGCAC AAACTCAATC     72720
     AGCCCTATCT GGGAAATCTG CCCTATCCCT CCAGCGGTTT TGCCTTCATC AAATCCCCCA     72780
     AGGGCACAGG TAAAACCCAG GCGCTGCAGT CCCTCATCCG GGAAGCCACT CGAAACGGAC     72840
     GACGGGTCAT CGTCATCACG CACCGGATTC AACTGGGGCG CTCCATCTGT GCCGGGCTTG     72900
     GGATTGACTG GATCGAGGAA ATGCACCAGT CAGAAACACG GGGATTGCTT GGGTTTGGTC     72960
     TCTGTATCGA CAGTCTTCAT GCTTCTTCCC AGGCTCGGTT TAATCCGCAA GACTGGCGGG     73020
     GCGCCATCCT CATCCTGGAT GAGCTGGAGC AGATCATCTG GCACGCGCTC AACTCCCAGA     73080
     CTTGCTTTGA AAAGCGAGTC CTGATCCTGG AAACTCTCAA GGAACTGATT CAAACCGTCT     73140
     ACAACTCCGA CGGACTGATT ATTGGGCAGG ATGCCGACCT CTCTGATGTC AGTGTGAATT     73200
     ACCTGATGGG ACTGGTGGAG AGCCCTATCC TCCATCCATG GTTGGTGGTG AATGAATGGC     73260
     GATCGCTGCA ACCCTGCCCG GTGTCCTTCT ACCACACCCC CGATCCTGCC CCATTAATCG     73320
     CTCAGTTAGA AGCATTGCTT GAAACCGGAG CGGTGTTTCT CTGTGTGGAT GCCCAGAAAC     73380
     CCAAAAGCCG GTGGGGGTCA ATCAACCTCG AAGCCTATTT CAAGCAGAAG TTTCCCCAAA     73440
     AGCGCATCCT CCGGATTGAC AGTGAAACCG TTGCTGATCC TCAACATCCT GCCTGCGGCA     73500
     TTGTGGAACG GCTCAATACA GCAGCATTGC ACTATGACCT GATTATTGCC ACACCCACGA     73560
     TCGGGACAGG CGTCGATCTA AATGTGCAGG GGCATTTTGT CGCCGTTTTT GGTATCTTCC     73620
     AGGGCACCAC CCCCGATGCG GAAGCTCGGC AAGCTCTGGC ACGGGTCAGG GAGCCCGTTC     73680
     CCCGTTATGT CTGGGCCCGT TCCTTTGGAG CCAGCAAGAT CGGCAATGGC AGTTGTGATT     73740
     ATCGGGAAGT GGCCCGTTCC ACTACTCGCA ACCTAGAACT GAACCTGCAC CTACTGAAGG     73800
     ACATTGACTT TGACCTTGAT CAGTCCTACG ACCCCATTAC ACTCCGCACC TGGGCCAAAA     73860
     TGGCAGCACG GGTCAATGCC TCACTCTGGA ACTTTCGGGA AGAACTTCAG CGCGGACTCC     73920
     AATCCGAAGG CAATCAAGTC ACGATTCTGC AGCCAGGAGA ATGTCTATCC AGTGCTCCCA     73980
     TTAAACCCGC ACTTATCCAA ATTCAAACCC ACCACCAGGA GCAAGAAGCC CACCAAATCG     74040
     CTGCCGCCGA GGACATCTCC GAGTCGGACT ATCAACAGTT AAAGGCTAAA CGCTCCAAGT     74100
     CAGCCCCAGA ACGGGCAAGG GAACGCAAAT TTGCCCTCAA ACAACGCTAT GGGGTTGAGG     74160
     TCACCCCAGA CCTGGTCCTC AAAGATGCAG ACGGCTGGTA TGCCCAGATT CGGCTGCACT     74220
     ACTACCTGCT GAATGAAATC GAGCTGGTCC AGCAGCGCGA TCGGCAAGAG TTCAAGGGAC     74280
     ACCTGGAGCG GGGCAACCAA AAGCTGGCCT TGCAGGATGT CCGATTACTC GGAGCGCAGG     74340
     TTGAGACATT ACGCAGTTTG GGAATTGCTC AACTGCTGCT TGCTGGCCAA GAAATCCGGG     74400
     GCAGTGACTC ACGAATCCAA CATCTCGCTG CCCTAACTGT GGAATATGCC CGTGACCTGA     74460
     AGACGGTGCT GAACTTGACC TTCACCGAGG CAATGACCCC CATTCAGATT GTGCAGGCAT     74520
     TGCTGAGCAA GCTGGGACTG AAGTTAAAGC GGCTCAGACA AGAACGGCTA CCGGATGGCA     74580
     CACGCGAGCG AGTTTATCAG TATCAATCTC CCACAGATGG ACGAGAAACC GTCTTCCGAT     74640
     CATGGAAAGC CAGAGATGAG GCGTGGGCGA TCTCTTTAGG CACACCCCTT TGTACTTAAA     74700
     AACTATTTGT AGGAACAGCC AGTGATAAAC TAAAATTATT TTACTTAAAA TCGGGTAAGC     74760
     TAAAGGTGAG CAACGAAGGA ATCAGCGGTT GGAGCAGCAC ATTGAGCCCC AGGGGTTGCC     74820
     TGCCCTGAAG TTAATCGTGG GGGAAATGAG AGTAGAAACA CGATCGACTA CTCCAGTAGA     74880
     TCTGCGCGAG TTAAGAGTGA CAGAGTTTCT GCAAGCCCGA TCGTTAGCAG CCAATACTGG     74940
     GGTTTTTTGC ATACCCCCCC GAAAAGGTAT ATTCCACAAT GAGACGCCTG AGTCTTAATC     75000
     TGCTGATTGT ATGGGGTATG ACACCGTTCC TGGCAATTAA GTACCACATC GGCTGAAAAC     75060
     TTTTCTCCAC AGGTGTTTCA GGGTGTGATC TTGCCTATTT TAGTTAGAGC CGATGCACAA     75120
     AAATCACTGC AAGCGCGTTG GGATAGAGCG TGATTGATAA CTTCTACTCA TGTTCTGTTT     75180
     GACTAGCAAT CATTGCCAGG ACAGCAGAAG GGCAACGCCA GAATCTGGAT TCCAGAGCTT     75240
     CCTGCCTTAA AGATTACGGA TGTAATACAG ATTTTCGAGG GCGGTACAGT CCAGAACTAG     75300
     TCCACCTCCC TTGTAGTATG TTTTTTCCGC CTTTAGTAGA ACTTATCAAT GGTCGTCTGC     75360
     TACCCTGCAA CTTGCTTGCA AAGATGTGAG GCGAGGACAT GCCCAGTAGT CAAGAGACCG     75420
     CCTACCCCCG GTTGAAAAGC AGCTTAAGTG CCAAAGAGTT AGCTGCTATT TATACCCCCA     75480
     GTCCAGAGGA GTTGATGTTG TCGGGGCAAG TCACCAGAAG CCAGGCATCA CGGTTAGGTT     75540
     TTCTGGTGCT CCTGAAAACT TTTCAGCGTT TGGGATATGC CGTCCCGATG GCGGATGTAC     75600
     CTGTAACCAT CACTCGGCAC ATTGCAATGG CTGCTGGATT GCCCCCCCGT CCCGATGCCT     75660
     GGTCTGCCTA TGATGCTTCG ACTAGCCGCA AGCGGCATCT GACCGTCATT CGACAATACT     75720
     TGAACCTGCA AGTTTTTGGT CAGACTGCCC GCCAACGGAT GAACGAAGTC ATGGCAGATG     75780
     CAGCACGGAC TAAACACGAC TTGGTGGACT TAATCAATGT GTCCATCGAA GAATTAGTTC     75840
     GTCAACGATT TGAGCTACCT GCCTTCAGTA CCCTGCTGAA AGCCTCTCGG CAAGCTCGCA     75900
     ATCAGGTGAC TCAGGCACTG TACCAGCAAG TGGTGAGTAG CCTCATACAA GAAGAAAGAA     75960
     GGCAAGTTAA TCAGTTATTT GAAGCGGAGG CAGCCACCCA TACAACCCCC TGGCAGCGAC     76020
     TCAAACAAGA CTCCGGTAGA TCCACCCTCA CTCATTTGCA GGTGTTGATT GATCGCCTCA     76080
     AGTGGTTATC TTCCTTACGC CTTGAGAAAG CCGTGCTCCA GTCTATTCCC GACAGTAAAC     76140
     GGCGACATTT TGCGGCGGAG GCCCAGACCC TGGGCGCCAG CGAGATGAAA GAACTACCAG     76200
     TGGGCAAACG CTATACCCTT GCGATCACCC TCCTTAACCA ACAGTACGCC CGCGTCCTGG     76260
     ATGATCTCGC AGAGATGTTT ATCAAGCAGA TCCAACACCT GCATCATCGT AGTAAAGCAG     76320
     CTCTGGCACA ATACCGAGTG GAGCAGCAGC CAAACACAGA CGGACTGATC GCCACTTTGC     76380
     GCGATTTGGT GCTGGCTTAT CAAACTGAAG GCGACATTCC GCAACGCTTC GCCGCGATCT     76440
     CCACCGTCGT TGGAGAACAC AGTCAAGCCC TGTTGGACCA ATGCGAAGCT CATTTAACCT     76500
     ATCAAGGGAA TAACCACTTT CCCTTATTCC AAAAATTCTA TAAAAGCCAT CGGGCAACCC     76560
     TGTTTCGGTT ACTGGAGCTC CTGCCGCTGC GTTCGAGCAC CCAAGATGAT AGTCTGATAG     76620
     AAGCCGTTGC TTTTATCCAA TCTCAGCGCG CAGGTCGGAG TTCCTGGGTT GCCACAGTCA     76680
     AAAAAGAAGT GACGGGGACA TCCGAAGAAC AGGCGGTGCC ACTGCTGGAT CTCAGTTGGA     76740
     TTGAGGGCAA ATGGTGGTTT TTGGTGACTG GACAACGGCA CCGCACACCC TACCCCAGCC     76800
     AAGTCCATCG TCGTCACTTC GAGGCCTGCG TCTTCTCACA GGTGCGACTG GAATTGAAAT     76860
     CGGGCGATCT TTACATTGAA GGAAGTGATG CCTATGGTGA CTACTACAGT CAATTGATCA     76920
     CCTGGGAAGA CTATCAGGCA AGCGTGGCGG ACTACGGGCA ATTAGTGAAC CTCCCCGTGG     76980
     AGGGGCAGGC ATTTGTCAAC CATGTCCAAC AGTGGTTGGA ACTACAGACC CAGACGACCG     77040
     ACCAGGCATT CCCTGCCAAT ACTGAGGTGG AATACAAAAA GGATCGACTG GTCATCCATC     77100
     GCCGTAAACC GCAGCCACCG AAAGGACTGG CAAAGCTTAA AGCACTGGTC AGTGAACGCC     77160
     TGACCCCAGT CAATTTACTT GATGTCCTCA CCGACACCGA ACTGTGGCTG CATTGGACCC     77220
     GCTCGTTTAA GCCGATCTCT GGCTATGATG CCAAGCTCAA ACAACCCACA GCACGGTATC     77280
     TGGCAACAAC CTTTTGCTAC GGTTGCAACA TTGGTCCCAG CCAGACTGCC CGCTCATTGA     77340
     GCGAGTTTGA TCGGCGACAG TTAGCGGATA TTCATCATCG CCATATTGAT GACCTCAAGT     77400
     TACACTCTGC GATCGAGGTG GTGATCAATG CCTATAACCG CTTTGCCCTA CCGGCTCACT     77460
     GGGGGACTGG CAAGCATGCC TCTGTGGATG GAACTCAGTG GGATGTCTAT GAGCAGAATC     77520
     TATTAGCGGA GTACCATATC CGCTATGGAG GCTACGGCGG GATTGGGTAT TATCATGTCT     77580
     CGGACACCTA CATTGCCCTG TTCAGTCATT TCATTCCTTG CGGCGTGTTT GAAGCGGTTT     77640
     ACTTACTCGA CGGACTGCTG AAGAATACTT CTAACATCCA ACCAGACATT ATTCATGGGG     77700
     ATACCCATGC TCAAAGTACG ACGGTGTTTG GGTTGTCCTA TCTGCTAGGA ATCACCTTGA     77760
     TGCCACGCAT CCGGAGTTGG CAAGACCTGA AGTTCTATCG CAGTGAGCCC ACAACCCGCT     77820
     GTACCCATAT CGACAACCTG TTCTCTGACA GTGTGAACTG GAACCTGATT AAAACTCATC     77880
     TTCCTGATAT GTTGCGGGTC ACGTTATCGA TTAAAGCTGG CAAGATTACG GCTTCAACGA     77940
     TCCTGCGGAA ATTGGGCACG AATAGTTCCA AAAACAAACT CTACCAGGCA TTTCAGGAGT     78000
     TGGGTTATGC GATCCGAACT GGATTTCTAC TGCGCTACAT TCATGATGCT GATCTCCGGA     78060
     CTGTGATTCA GACCGCAACC AATAAAAGTG AGTCCTTCAA TGGCTTTTTG AAGTGGTTAG     78120
     CCTTTGGTGG CGAAGGGGTG ATTGCCACTA ACGACCGGGA TGAGCAGCGC AAACTCGTGA     78180
     AATACAACCA CTTGGTCGCG AACTGTTTGA TCTTTTACAA CGTTTTTGAG CTCAGCCGTA     78240
     TTCTCCATGA ACTGATCCAA GAGGGCGTGA AGATTGAACC CGAAACCATC GCAGCACTCA     78300
     GTCCCTATTG GACGCAACAC ATTAATCGGT TTGGTCGTTA CAGTTTGGAC ATGGATCGCT     78360
     GCCCTCCTCC CATTGACTTT GGCATCCCTG TCGTCTCCCA GAAGTCATCC AATCAATAAT     78420
     TTTTTAGAAA ATCATTTCTC AGAAGGGCTG CTTACTAAGC GTTTCAGCCG ATGTGGTACT     78480
     TAATTGCCAG GAACGGTGTC ATACCCCGTA TCTGGCCAGT CCTGAGTTTC CGGAATGGCA     78540
     ACCCCATCCT CGACACACCT GGAAAACTGC GCTGGAACCC TACAAACCCT ACCTGAAGGA     78600
     GCAATGGGCT GCAGGGCTGC ATCACGCAAA GCAGCTCTTT ATGCAAATTC AACACCAAGG     78660
     CTATCGGGGG AGCTATGTCA CAATGTCCCG CTATACGCAT TACTTGCGCC AAGACAAACG     78720
     GCGGTAGCAA TGGGGCTAAT CCCTACGCCA CTCTAGTAGT GGGATCCAAT GGCAATTTCT     78780
     ACGGCACAAC CCAAGCTGGA GGGGTGAATA GCCAAGCCAC GGTGTTCTAG ATGACGCCTA     78840
     CTGGCACGTT CAAAAGTCTA GTATCGTTCA ATGATAGCAA CGGGGCCAAT CCTTATGCGG     78900
     GCTTGGTGGT CGGCCCTGAT GGCAATTTCT ACGGTACAAC AAAATTTGGC GGCGCGAATA     78960
     ATCGAGGTAC GGTATTTCGG ATGTCAGTCC CTTAGGATTG AAGGTGCCGG TCATGTTCTA     79020
     GACCTATGGA AGTGTATCGA AAGACTCAAT TCATAGCGCT TGATGAACAG CCCAATGACG     79080
     GTGTCATGCA CCTCCGTTTG GAGCGCGTAC TGATGCAATT GAACAGAAGG TCAGCTGCCC     79140
     TTCCCCTACG TCAGATAATT AAGGAGAAGT CAACTTTCTT CCATTTTTCA TCATGGCTAA     79200
     TCTGTCACCC TGGGGTACAT CCCTGACCTC CACTGCTCAA CGTCTTCTCT TGCTTGGCTC     79260
     TGGCGAACTG GGCAAAGAAG TTGCTATTGA AGCCATGCGT CTGGGCTTAG AAGTTATTGC     79320
     AGTCGATAGC TATGTGAATG CACCCGCGAT GCAGGTCGCC CATCGATCGC ATGTGATCAA     79380
     TATGCTAGAC GGAGTACAGG TGCGGCGGAT AGTTGAGCAA GAACAACCGG GGCTGATTGT     79440
     ACCGGAAGTC GAGGCGATCG CTACGGCTAC CTTGGTTGAA CTGGAACAGG AAGGCTGGCG     79500
     AGTCGTTCCC ACCGCAAAGG CAACCCAACT CACGATGAAT CGAGAGGGAA TTCGGCGGCT     79560
     AGCTGCCGAG GAGTTAGGGC TGAAAACCTC GCCCTATCGC TTTGCTGAGA CAGAAGCAGA     79620
     ATACCAGCAA GCGATCGCAG AACTGGGCTT TCCCTGTGTC GTGAAACCCG TGATGAGTTC     79680
     CTCTGGAAAA GGTCAGAGTA CCCTCCGTAG TGAGGCAGAT ATACAACCCG CCTGGGAGTA     79740
     TGCCCAAGCC GGGGGACGCA CCAAAGGTGG GCGAGTGATT GTCGAAGGAT TTGTCCCCTT     79800
     TGACACTGAG ATTACCTTAC TGACGGTGTG TTCTGCCTCA GGAACTCACT TCTGCCCACC     79860
     CATTGGTCAT ATTCAGATAA GTGGCGACTA CCGAGAATCC TGGCAACCCT GCGCTCTGCA     79920
     CCCCCAGACG CTAGAGCAGT GTCAAGAGAT TGCCGAGAAG ATTACGACAG CCCTGGGGGG     79980
     ATGGGGCATC TTTGGCGTTG AACTCTTTAT TCAAGGAACC AGCGAAATAG AGCAAACCGT     80040
     TTACTTCAGT GAAGTGAGCC CCCGTCCCCA CGATACCGGG ATGGTGACGC TGATTAGTCA     80100
     GAATATGTCT GAGTTTGAGT TGCATGTGCG GGCGACCACC GGGCTTCCGA TCGGCGAGAT     80160
     TACCCTGATC CAACCAGGGG CATCGGCTGT GATTCTAGCG AATGTAGTGG GCGACAATCC     80220
     CCGATTTACC GGAATTTGCG AAGCATTGCA GGTACCAACG AGTAAAGTCC GTCTGTTCGG     80280
     CAAGCCTCGC GCCTATCGGA ACCGTCGGAT GGGAGTTGCT TTAGCGCTGG GCGATACTGT     80340
     GGAGCAAGCC AGAGAAAGAG CGAAAGCAAG TGCAGCAACA GTCACTGTTT TGGTGGATGA     80400
     TGCCGGTGAA GTGGACCCCA AAAACTGGAC AAGAGGTTAA GCTCTAAACC ACTCGACCCG     80460
     TGATAGAAGT CGTTCATGAG TAACAAAGGC AAACGAGTGC AGTGATTGAT ACGACCGTTG     80520
     GGAGACTTGC GAAATTTTAT CATACGGGTA TCAAAGCATT GCTCCATCTC ACTTTCAGCT     80580
     TTTGACTCAA GAAAAGTCAA CTTCTACCGA GTAGTTGCGG GGCAGGCAGG GGATCACAGC     80640
     TCTATCCTGA GAAGATCACA CTCTCGATGT ATTGAGGCTC TCCTGAGATA GGGGTGTAGA     80700
     ATGTATTATC GAATACAGTT CTCTAATGAC GTACCACCTC GATTATCTGC TCAGGTTGCC     80760
     AGGAGTCCGA GTAGAAAGAT GTCAAGACAT TGAAGGAGCG ATCACCCTCA GCTTGGAGAT     80820
     TGTCGCAGCA GGCATGAGTT GTCCGTACTG CCAGGGATAC ACGGAAGAGT TGCATCAAAT     80880
     CAGACCGATA TTGGTCCGAG ATCTGCCGAC GTTTGGTCGT CCAGTTTATT TACAAGTTCC     80940
     CCGTCGGCAG TTCTATTGTG TGACCTGCCA AAAGTATTGC ACGGAGCGAT TAGAATTTCT     81000
     AGATGGGCGG CGACGCCATA CGCGACGCTA CGAACTCAAC ATTGATGAGC GAGTTCAACA     81060
     GTCGAGTATG GAGCAGATTG GGCGTGAAGA AGAGCTGAGC TACGACGAAA TCAAAGGAAT     81120
     CTTTGAGCAC GTTGACAAAC AGAGAAAAAA ACACATGGGA GGGAAACATT CGAGTGGGGA     81180
     TTGACGAGAT CAGCTTGCGA AAAGGACAGC AGGATTATGT GACCGTTGTG AGTGACCTCG     81240
     ACCAGAGAAA GTTACTAGAG GTGATCGACT CGCATGGACA GGATGAAATC GTCAAAACGC     81300
     TGATACAAGA ACCACTTGAG GTAAGAGAAC GAGTCGAGGA GGTGAGTCTA GATATGTGGG     81360
     GAGGATTTCC CAAAGTTGTC GAGGCAGTGT TTCCGAATGC GAAGATCGTA TTTGATCGCT     81420
     TTCATGTCAT GAAGCTGGTG AATAACGAGT TAAATAAACT TCGTCGAGCA GTGGGAGTGA     81480
     CCGACCGAAA CAGCAAGTAT TTGTTATTGA AGAATTACGA TGATTTAACG CCGGGGCAAA     81540
     AGCAAAAAGT TGAGGAGGTT CTTCAACGGT CACCCTGTTT AAGAGTCGCT CACGAATTAA     81600
     AAGAAGAGTT TCGCAACATC TATGAAACGA GTCGAACGGT ACAGGGAGGT CGAAAGAAGT     81660
     TTGAAAGATG GCTCAGCTTA GCGCAATTGC TGTATGTGGA TTCGGCGGCA ACTATACGGA     81720
     GCCACCTGGA TGGAATTTGC AATTATTTTC TGAATCGAAC AACGAGTGGG GTTGTCGAGG     81780
     GCATCAATAA TCGAATAAAG CTGATTAAGC GGCAAGGTTA TGGCTTTTCA AACTTTTCAA     81840
     ACTTTCGCGT ACGCTTATTA GCTTGCCTGT CTCATTAGTT AAACTAATCG CCTCAAGTTC     81900
     AGGAGAGCCG CCAAACAGGA GATGGATAGA AATTATCAGT CACGCTCTAT CCCAACGCGC     81960
     TTGCAGCGAT TTTTGTGCAT CGGCTCTAAC TAAAATAGGC AAGATCACAG CCTGAAACAC     82020
     CTGTGGAGAA AATTTTTCAG CCGATGTGGT ACTTAATCGC CAGGAACGGT GCCATACCCA     82080
     AAATTCTAGC TGTATATAAG GCTTAACTCG AATTTAGCTG CTAGTTTCAA CAGCAAAGGA     82140
     CAGAAATCAA CTAGGCGATC TCTGGCAGGG TAAACGCATC AAAATAGGAG GTCAAACTAT     82200
     GCCTCATCAA GTAGTAGAAG CGGGGTAAGC AGTTGCATCA TAAATTGGTC GTCAAGTCCG     82260
     GCTCTGTAGC GTTTCATCAC TAAACTGCCC TTTGAGGAGT CGCGATGCAA GAGGTTGAGG     82320
     GTCAAGCGAC GCAGCAAACT GAAGTTGCGA GGTGCATGAT CCTTACGAAT GCGGGATTTA     82380
     TCTTCATTAA AAACAACATC TAAACACCAG TGGAGTTGGT TTTCAATCCC CCAATGAGCG     82440
     CGAATGTAGT GAGCAAAGGT GGCGGCATCC GTCGAAAGCG AACTGAGAAA GTAACGGGTT     82500
     TCAGTCGTGT CTTTGTTCCA GAGGCAACGC TGGGATTGAA TCACCACCAG ACTTCGTAAC     82560
     CCAGCCCAAT CCCTACCCTG CTTGGGGGTA AACACTTGCT CAACCGGAAC CTGAAACACG     82620
     CGCCTCGACT CAATGCGATG ATGGGCCGTC TCACACTGTT GATGCTGCGT GTACTCCGCT     82680
     CCTGCGTTGG ACCCCGTCTG AAACTCCTCA AACCACTGCT GAGCTTGCTT AAATAGCGTG     82740
     GGTTGATTGC CTTTGAGGGC GAGAATATAG TCAGCTTGCT GCTTGTGGAT CTGCGCTGCA     82800
     ATGGTCTGAT GGGTTCCCAT CGCGTCGATA CTGACGATAC ACCCTGCTAA GGCCAGCTGC     82860
     TCCAATAACA CAGGGATCGC TGTGATTTCA TTCGACTTGG TGTCCACCGC GCATTGTCCT     82920
     AGCACTAAGC GATGCTCACT CGCCCAGGCA CTCACCAGTT GCAAGGCTTT GACACCGCCT     82980
     TCGCGGTCAT AAGAACCTTT AGCTGTTTTG CCATCAATTG CAATCACTTG TGCCCCTAGC     83040
     GTGGATACCA CCCCTTTGAC CCAATGCTGG AAACGGGTCT CCAACGCTTC CGGGTCAAGA     83100
     CGAGCAAACA CACGGGCGAA GGTATCGTGG GAGGGAATTC CATTCGGTAG AGCCAGGAAG     83160
     GTTTCCAACC AAGCGCGTTT AGCCTGACCG TAGGTTTCGA TGCCTACCCA ACTGTCGGCT     83220
     CCCGCCAGCA CAGCAAACAA GGCAATTGCA ATGATATCGA GCAGTTGATG AGCGCGGGTT     83280
     CGCTCGACTC TGGGGTCAGT AATCTCACCA AAGTATTGCT CCAGACAGGC TGATAAGCTT     83340
     TCTCGGTTAA CGGTGGGAGG CATGGCGGAG GGGGTAAATC CCCGATCCTA CACCCTTATC     83400
     CGCTCCCGTT TAGATGCGTT TGCCCTGGCG ATCTCTGGGA ACTGGTATTT TAATTCGTGA     83460
     AGCATTGGAA CCCGCGTAAT GAGAGCAACT CCAGGGCTGC CATGGGAACA GACCAGTGAT     83520
     GCACTAATCG TTGCACCATG AGTGCTCGTT GCAATCCGGT CAAAATTGCC GCTCCAATCC     83580
     CCTAGTGTTT AGTCAATGAA TGATTGACGG GTAAAGCCTG TGCAATTTGA CCCTGGCATC     83640
     GGTTGTTGTA AACTGCCAAT TAATCCAGGT TTCTTCGTGA TTGCGATGGT CCTGCCAAGC     83700
     ATCAACCTCG GACTTGAGGG TATCCCCATC AGGAATGCGA CGATCTAAAC ATTGACGGCT     83760
     GTCAAATGTC AAGCACATAG CAAGATGACG ACAACCTACT GGTCGGGTGG ATAGGGAGTC     83820
     AACTTGATTT AAAGGCGCCC CCTTTAGAGT CAAACGACCA TCGCTTTTTC CAATGACAAC     83880
     TTCAGATCTC AACCAGATCA GGACGACAAG TCCAGCTCGG GACGACAAGC TCGGATCAGA     83940
     TCGGGTGTCA CGCTAGGGCT TGGGGTTATG CCGTGGCAGC AGATTGGGTT AGACGTTGGC     84000
     TGGCGGCAGC TTTGCGGTAA CTGGGGGCCT GCACGTCAAT AATCACGCCA TGATGGACCA     84060
     ACCGGTCAAT GGCGGCGACG GTCATCATGG AATCACTGAA AATGCTATCC CACTGACTGA     84120
     AGGGTTGATT GGCGGTAATC AGGAGGCTTT TGCGTTCATA GCGATGAGCA ATCAACTCAA     84180
     ACAGCACCGA CGTTTCCGTC TCATTCTTCT TGACATAGCC CAGGTCATCA AGGACCAAGA     84240
     GGTCATAGCG GTCGAGTTTC TTCAGCAGCG GATACAGCTG GAGTTGGAGC TTGGCATCTT     84300
     GGAGCTGCTG GACCAGGGCA GTGGCCGCAA AGAACTTGAC CCGCTTGCCC AGCTCAATAC     84360
     AGCGACGGGC TAAACTGGCG GCCAGATGGG TTTTGCCCAC CCCAGAGGGA CCGAGCAGAA     84420
     TACAGTTTTG AGCTCGGGCT AACCAGTCTG TCGTTTGGGC CAACTGCATC AAGGGGGCGG     84480
     GATTGAACTG GGGGCAGTGG GAGAAATCAA AGTTGGTAAA ACTTTTTGCG GCGGGGAGTT     84540
     GAGCTTCTGA GAGACTGCGT TGCAAGCGAA CGTGCTCGCG GCGTTGGGCT TCCAGGTGAC     84600
     ACAAGTGCAG CAAAAATTGT CCATAGGACC AGTTCTGTTG CGTAGCTTGA TGCTCGATAG     84660
     CGTCCAGGTG ATCCAACAGG TGGGAGAGAT TCAGTTGCTT CAGCAGCAGG GGCAGACTCT     84720
     GGGCGGGGGG GCTCAGCGAG TCCCTTGGGT TCGACTGGGG CGGTAGGGAT GAGTTGGTCA     84780
     TAGCTGGAGA GGTCGTGCTG AGTAATGGTC AGATCAGGCA AGGTCGGAGT GGGCTGAAAC     84840
     GTAAAGTGTC CCGTCAGGCG CGACAAACTC AAGGTGCCGG TCGAGAGCGC TTGCTGGAGA     84900
     TACTCGGCGA CGGCCGCCTC TTGATTTCCG GTGGCGGCCA GGTAGAGGGC TTCAACCATG     84960
     AGTTGAGCGG CATCATCGGG AGAGAACTGA GTTTTGAGCT GTTGCCACAG TTCGCGGTAG     85020
     TCCGCATTCG GCAAGAGGTC GGACTGCCAG GTGCAATAGA GAAAGGCGCG GGGCTTACGA     85080
     TGCAGGGCTT CAATCACATG GCGATAATCA ATACACCGCC CCCGGCGCTT CTGGGGATGA     85140
     TGGACCCGAA CACGGGGGAG TTCGACGACC CGTTGAGTGC CGAAATAGCC GACCATCCGG     85200
     TTGTGGTACA GATGTAATTC CAGACGGCGA CCCACCAAGC GGGAAGGGAC GGTGTACAGC     85260
     ACACAGCGCA CCGTGATGGT GCTGTGGCAG CTCACTTTGA CACTGAGGAT TTCATAATCG     85320
     GGCAGGCGGT AGGCCGGCAA GGGTTGGAGG TGGGACTGCT CCTGGGCAAA TTTGTCCTGG     85380
     CACTGCCGGT TCAGTTGGGC GGTCACGGTC TCTATCAGCG CTTGATATTC AGCAACACTG     85440
     GCAAAATCAG CACTGCCGCG CAAATAGATC GCTTGCTCCA GGCGGTTTTT CAAGTGACCG     85500
     TGAGGGGATT CAATACTGCC ATTTTCATGG GCAACCCCGG TGTTATTACG GGTGGGCTGT     85560
     AAGCGGTAGT GGTCGCAGAG GTCGCTGTAT AGGCGCGTCA AGGGTTTCGG GTATTTGCCC     85620
     CCAAGGTTAC GATAGGCGGC ACTCAAGCTA TCCGTGCGAT GTTGTTGGGG CACTCCACCA     85680
     CAGCGAAACA GGGCATTCTG CAAGCCTTCG CACAACGCGA CAAAGCTTTC CCCCCCTTCG     85740
     ATGACCTGAG CGTACTGCCA ACCGCTATAG GCTAAGCGAT AGTGATACAA CAGATGCTCA     85800
     TAGGGTTGAC CGGCAATCGT GACCTGCACA GTTTTGAGTT CCGTAAAGTC AGACAGGCCC     85860
     ATCTCCCCCG GGGCATGGTG CAACTCAAAC ATCACCTCTG GAGCCGGTCC ATGCAGCACT     85920
     TTCCAGGTTT GCACCCGCCG TTGGAGCGTC CGTAACACCT GCGGGTATTG ACCCGGATAT     85980
     TTCTCTTGCA AATACTCAAA CAGGGTCATG GGCTTGAGTT TCGGCTCTCG AACCAGCATC     86040
     GGTTCCAGTT CGCTGTCCCA CACCGCCGCT AAGGGGTCCG GCACGGTCCG TCCCCGGGAG     86100
     CGCTCCCCTC GCTGGGGTTG CAGTGTCCCG GCTTCAATCC GTTGTCCACT GCGACAGGAA     86160
     ATCTCGGCAA TTTGAGCCGC ATCCACTTGA GTCAGTCCAT GGTGACGTGC ATTCATGTAA     86220
     ACCCGGATAT GATAGGAGTC AATTGTTTTT GGAGACACTA GTTTTACTCC AGTGTGTGAG     86280
     GAAGACCTAG TGTCTTTTTT TTAGGCGAAA ACAACCGGGA CGGATACCCC TGATCCCCTG     86340
     CTCTGGACCG AGGCGCCCTC ATGGTCCTTG GCTAATCCGC CAAAGGGTTG TCGTTCCTCG     86400
     GTAGGTTGAT TGTCGTCCAA TAGACGGCTG AGAATACTCA ATTCGATTTC TGCCATATTC     86460
     AACCAACTCC CATGTTTCGG CGTATGACAA AATTCCAAGC GGCTCAAAAT TCGCTGGGCT     86520
     TCAGCTGGCT CAAAGGCTTT GTACAATCAA GCCGGAGAAT GGGTGTTGAG ATTATCTTGA     86580
     ATCACAATCA GCTTCTCCGC TTGAGCATAA TCTGAATCGA CTAACGTTTT GAGTAACTCA     86640
     GCATAATCGA GTGCCGTGCG CTGCTGCGTC ACTTCCACCC GTCGCCATCC AACCATCGGC     86700
     TCACAAACCA TAAACAGATT TGCCGTACCA TTGCGTTCAT ATTCGTAATC AACCCGCTCT     86760
     GGCTGACCCG GTTCAGCAGG GGTGCGTGTC ACCTTATTGA GAGAGAAATT AGGCTGGGAG     86820
     AGCAGTCTAC CCCTCTACCC GTCCGATGAC TCCAGAAGAC CAAGCGCAAT TGCAACAGAG     86880
     CCTTGATACC ATTGCCCAGA TTCTCTATCG CCATACCCCT ACCGAGCAGT TGCAAACCTT     86940
     GGAAGGGATT GAACACGCCA TTCGCCAGCA GACTCAGGAG TTGGTGTTGC CGCAACTGGG     87000
     TATTTTTTTA TTGCAACAAC GACAGCAACG ACGGAAGGAT ACCCGCGAAC CCTAAAGAGC     87060
     ATTTTAGGAA CGCTGTCCCT CACCAGCTGC TGTATTTGCA CGACTTCGGC AGGGTAGTTT     87120
     CACCAGCTTC GGCACCCCAC TCTCAACAAA GTTCGGGCTC TTCCGAGGTT TTGGTGATCT     87180
     TGAGGCAGGA TCAAAATGTA TCCGTGTTAA CCCAGTAGTC CGTGGAACTT CTTCAATCCC     87240
     TGTTACCAGA CCCAATCCAC TTACGCCTCG AAAGCTGGAC TCTTGATCGT GCCCAGAAAC     87300
     AGCTGACACT AACCATCAGA GCCACCCAAT CGACGACTCC GTGTCCCCTG TGTCAGGGGC     87360
     TAACGCAGCG AATTCATAGC CGCTACCAAC GGACGCTCCG GGATTTACCC TGTGCTCACT     87420
     ATGCCGTGAA ACTGCGATTG CAGGTCAGGA AATTCTTCTG CACCAATCCG TTGTGCCAGC     87480
     GGCGAATCTT TACAGAGCGA CTTCCCCAAG TGACCCTCCC CTGGGCCCGC AGAACCGTCC     87540
     GTCTAGCAGA ACAATTCGTC GCGATTGGGC TAGCCTTGGG GGGTGCAGCG GGAGTGCGCC     87600
     TGAGTCGGAC CTTGGGCCAT CCTATGAGTC TCAATTGCTT ACTGCACTTG GTTTCGCAGC     87660
     GTCCCCTACC CGCGCTAGCC GTTCCAAAGA CCCTGGGAGT CGATGACTTT GCTTTCCGCA     87720
     AAGGGCAGAC GTATGGGACG GTTCTGGTGG ATCTCGACCA GCATCGTCCC ATTGCCCTTT     87780
     TGCCAGACCG GGAGGCCAAT ACTCTGGCTG AGTGGCTCAA ACAGCATCCG GGGGTAGAGG     87840
     TCTTGTCGCG CGATCGATCG AGGTCGTACA AGCAGGGCAT GAGTGAGGGG GCCGCGGAGG     87900
     CGGTGCAAGT GGCGGATCGG TTCCATCTGC TGCAAAATCT GGCGGAGGTG CTGGAAAGCT     87960
     TTTTTGCCAC CCAAAGCAAG GCTCTTAAAA CCGTAGATCT TGCCCATCAT CGGACCCCAG     88020
     AACCTGAGCT AGAAAAACCT ACTCAGGCTC TCATTCAACG CCAGCAACGA GCGCAGCAGC     88080
     GGCGCGAGCG ACGGTTAGCG AACTACGAGC AAGTCCACCA ACTCCGCCAG CAAGGGTTCA     88140
     GTGTACCGGA CATTGCTCAT CACCTGGCGA TGGGAGAGCG AACCGTCTTC CGCTATCTGG     88200
     CCAGTCCGGA GTTTCCCGAA TGGCAGCCCC ATCCGCGTCA CACCCGGAAA AGCAGCCTCG     88260
     ACCCCTACAA AACCTACCTG ATTGAGCAAT GGAACGGAGG CCAGCGCCAA ACGAAGCTGT     88320
     TGTTTGTCCA GATTCAACAG CAAGGGTATC GGGGCAGCTA TGCTACCGTT GCTCGCTATA     88380
     CGCATTACCT CCGCCAGGTT CAGCGTCAAT CGTTAAATGT CCAGTATGGA CGAGGCCAAG     88440
     TTCCTCCCCA TCTGAGCCAT CCTCGACCAC CGCTGAGTGC TCGCCGTGCA ACTTGGCTGG     88500
     TGTTGAAGCC CGCCAAGCAA CGATCTGAGG ACCAGCAAGC GCTGTTAGCC CGGTTACACG     88560
     AGCACCCTGA TCTCACAGGT GCGATCGATC TGGTGCAAGG ATTTGCTCAG CTGGTGCGAC     88620
     AACGTCAATC CGAGCAACTA GACCCCTGGC TTGAGCAAGC CACTTCTAGC TCACTCAGTC     88680
     TGTTTCAGCG ATTTGCTAAA AGCTTGCAGG AGGACTATGC AGCGGTCAAA GCGGGGGTCA     88740
     CCCTCCATAT CAGCAACGGG CAAGTAGAAG GACAAATCAA TCGCTTGAAA ATGCTCAAGC     88800
     GGCAGATGTA TGGGCGGGCG GGGTTACCGT TGTTAAGCCG CCGATTCTTA CTCGCTTGCT     88860
     AAGCCCGATA ACCCTGTTGC TCCTGGCATG GATTGACCAG ATCACCAAAA CCCGAAAAGA     88920
     GCCCGAAGTC GTGCAAATAC AGCATCTTAA AATGTTGATG CTGCAAGCCA ACCTGACAAT     88980
     GCTACAACTA ATTTGGCGGG AGCATGATGG GCTATTTCAT TCGCGGAACC CGTTTCCTAT     89040
     CGGGGGGATT GTCGAAGATC CAGCGACGGG GGCTGCGGCT GCGGCACTTG GAGGGTATTT     89100
     ACGCGATGCT CGACTGATTA CAGCACCGAA GACCATCATT ATTCGCCAAG GAGAAGCAAT     89160
     GGGTCGCCCC AGTCGCATTG TCGTTGATAT TCCAATGACA GGTGGAATTA TCGTCACAGG     89220
     TCAAGCTGTC TGGCTTTGAG GCGGACAATT TGTTAATCTC AAAGCAGCCG CGATTTCGTA     89280
     ATTGGAGATA GTAAATTGCG GCGGGCGGAG CGCTACATCC TATCCCCTCT GCAAGCAACG     89340
     GGGCATCACG GAATTTTTCC TGCGAAACGT ACTACCGCCT ATAAGTATCT ACCTCGAGGA     89400
     AAAGAGATTC AATCATTCAA CTATGTCCCA ATTGTAAATG CTGTAACCGC GATTTATTAA     89460
     CCGATTCGCC TGATGCGAAA ATTTACTCGT TTGAATGTAC GTTCTGTGTT ACCTGTGCAG     89520
     AATCTTTACT GTACGGTCAT TGTCCTAATT ATAATGGTGA ATTGATAGTG CGTCCCCGCC     89580
     GTCCAGCGTC AAAGTTATTC AAGTATCCCG CCTCCTTAGA ACGAGTCTTT AAGCCCACAG     89640
     TTTGTGGTAA TTTTAAACTG ATCAAATAAA TTTAGACAAT AAATTCTCCA AAGTAATCGT     89700
     CTGATTCCTC CTCATAATTT CCCCATGCAA GCTTCTGCAA GCGAACTGCT ACAACGCCTA     89760
     CCAGGAAAAG TCTCCGAACA ATGGCCGATC GGGGAACGAT TTGTCACTGC TTTTACTCAT     89820
     GGCACAATGT CGGTGGAGTT CTATGCCCCG ATCGACCGCG ACCAACAAAC ACCACACTCG     89880
     CAGGATGAGC TTTATTTCAT CCATTCTGGA CATGGAGAAT TGACGATCGA TGGCGAACGC     89940
     CACCGATGCG AGGCAGGCAT GGTTTTTTTC GTTCCAGCAG GTGTCGAACA TCGGTTTGAA     90000
     CATTTTTCCT CAGACTTTAG TACTTGGGTT GTCTTCTGGG GTGCCCAAGG TGGGGAAGAA     90060
     TCGTAAGAGT GAAGGAAGTG AGGTGATGAC GAATTATAAA GAACCGATGA TTCAGAGTTG     90120
     GCGCACTAAC TCAGCGGGGT GGACGAATGC CGTGCGCGAG CGGCAAATTG AAAGTCGTGG     90180
     ATTGGTGACG GATACGGCGA TTTTGACGGA CGTATTCCGC CTTCAGCCCA AATCGTTGCT     90240
     AGATGTTGGT TGTATCGAGC CGTTGCAGCG CGAGAAATTA CGGTAGTGGG GATTGATGGT     90300
     TCTCCAGAAT TAATCGATAG AGCCCCTTTA TCACCAATAC TCAACTGCTG ATAGCAAAAT     90360
     TCTGTAGGGA TTTGGTTTGT CGGTAGCAAT GCTGCCAATA AATGGCTCTT AGCAAAGCAG     90420
     TAATCTGTCT TGTATTGTAG AACATCAGAA GTGCGACATG TCACAGGATT CATCTGGTAA     90480
     TCAACGCTGC GAGAAATTTC ATCTCATACC TACTCGAAGC ACGCTTTTGT GATCGCCGTT     90540
     TATGATTTGT GAGCTGATGC AATTCGCTTG ACAAGTGTGA TGATTTCTGG ATGCTGCCAA     90600
     TTAATAATTT CACTAGATCT CAAGTATTCT TCCATACCAA CTGCTACAGA TACTGCAAGT     90660
     CCAACTCTAA CTAAATCATC GGTAAATTCA AGGTGCTGCT TCATCTAGAA ACGGAGCAAG     90720
     CGTTAGCTAT TGATGCTGGC ATCACGTTCA AGCACCCAAC AGCGCGGATT GTTTGTGAAA     90780
     CCAAGGTGCT CATAGTAGCT ATTTGCATTA GGGGCTGCTA TGAGAATTAA TTTACATTGC     90840
     GGACCTAGCT GGCTCTGGGT GATGATTTGT AACCGCTTAC CTATACCGCC CTTTTGATGG     90900
     GATTGGCAAA CAGCGAGGTC AGACAAATAG CACGCATAAT AGAAATCAGT CATCGAGCGG     90960
     GCAATGCCTA CCAGTTTGTC TGACTCCCAG GCGCTTATGA TCAAGTTGCT ATTTGCAATC     91020
     ATACCCTCCA TGCACTCGCT ATCGTGGATT GGTCGGCGTT CGCCCAGGGT TGAGCGTATC     91080
     AGCAGATCAA TGAACTGATC CACACTGACG GGAGTGTTGA TCCTATACTC AATGCTCATA     91140
     GCTTCATTGT TATGTGAAAC TGAAGAATCA ACCGTATTAT ATTTGACTCG CAATCGACCG     91200
     AGATACGAAT GAGATTGTCG GCTACTGTGT TGGAGATCGA AGTCGAGAGT CTGCTTGGCA     91260
     GCATCGTTTC GACCGACGGA TCACGTTTGC GTTTTACGCA GCTATATTCG CCACCGCGAT     91320
     AGCTTAATTA AAACCGCCTG CGTTCACCTC CAACGGATGC AAAAGGCCTT AACCCAAATG     91380
     AATGTGCAAC TCCATCAAGT GGTAAGCGAT TTGAGTGGCA CCACAGGCAT GGCGATGATT     91440
     CGAGCCATTG TTGCAGGGAA ACGCAATCTT CAAGCTTTGG CTGCCCTCAG GCATCCTCGC     91500
     AGTCAACGCA GTGAAGCTGA AATTGCTCAA GCCCTCGACG GAGATTATCG GCAAGAGCAT     91560
     GTCTTTGTCT TACAGCAGGA ATTACAGTTG TACGATGTCT ATCAAGCCCA CATTGCCGCT     91620
     TGCGATCAGC AGATTGAGCA GTGCCTGGGT GGATTTGACG TCCACGTCGA CCTGAGCGAA     91680
     CATCCTCTGC CGCCCCCTAA ATACAAGCGA AATAAGCCCC AAGATAATCA ACCAGCGTTT     91740
     GACTTACGCA CCTATCTCTA TCAAATCAGT GGGGTTGACT TTACCCAAAT TGATGGCATG     91800
     GGCGTCCTGA AGGTTCAAAC CATTCTGTCA GAAGTGGGGT TAGACCCCAG TTGCTTCCCC     91860
     AGTGTCAAGC ACTTCACTTC CTGGTTAGGA CTCTGTCCAG GCAGTCGTAT TACAGGAGGC     91920
     CAGTCTAAAA ATTCCGCCAC TCGTCCGGTC GTCAATCGAG CCGCTAATGC TTTCCGCATG     91980
     GCCGCTCAAG CCGCAGGGAA AAGCCATTCC GCTCTCGGTG CTTTTTACCG TCGCCTCCGG     92040
     ACGCGGTTAG GCGCACCTAA AGCCATTACA GCGACCGCTC ACAAAATTGC ACACCTTTTC     92100
     TATCACCTTT GGTCAACCCG GCAAAGCTAT GTTGACCCAG GAGAACACTA TTACGAACAA     92160
     CGCTATCGAG AACGAATCCT CAAACAGTTG CAAAAGCGGG CACAAGCCTT AGGTTTGGAA     92220
     CTCGTTCACC AGCCCCCGGC AGAGGCGATT TCTTAGGAGA GGGATATACT CCGCATTAGT     92280
     AATAGTAAAA ATTTACTGCA AAAAAACGAG GTTTTTCAAG AACATCCACA ACCGCTAAAC     92340
     TTAAGAAATA CTTATAGAGA ATTTTAAACC TCATCTATCT AAAGTTTGAT TTCTAGAAAA     92400
     AGCTGAGGCT ATAACCTAAT ACGGTTCTAA AAGGTGGTGT GCATGAGGAA AGTAGAAGTT     92460
     CTGCCCCATA ATCCTAAATG GCGGGAGATG TTTGAGGTTG AAGCCACCCG AATTGCTGAT     92520
     GCTCTAGGTA GCAACGTTTG TCGTATCCAC CACATTGGCA GCACCGCGAT TCCTGGGATC     92580
     TATGCCAAAC CTATTATTGA CCTACTACCG GAGGTCCAAG AGCTGACAAA AGTTGATGAG     92640
     TGTAGCCTCG TAATGGAGCT ACTGGGGTAT GAAGGGATGG GTGAGTTCGG CATCGAGGGA     92700
     CGTAGATACT TCCGAAAACT GAATTTCGAA GGCATCAGAA CTCATCATGT TCATATCTTT     92760
     ACAGTTGGTT CAAAACAGGT ACAACGGCAC TTGGCTTTCC GGGATTATAT GATTGCCCAT     92820
     CCTGACGAAG CACAGAGATA TAGCGATTTA AAGCGCAGGC TGGCAAAGGA GAACCCTACG     92880
     AATATTGTAG TTGGTCAGCG CAATAAGAAA GGTTAAATGG GAATCGCTAA ATTGAAGCGG     92940
     ATGGGTTAGG TTGAGCAGTA TGGAGCCCAG CGATGCCCAC TTAGCAGCCA GGATGGCAGC     93000
     CCCCGAGTTT GACCCAGAAG AGATGGGGGT TCGGTATTGG TATGAGCAGT ATTTGCGGCA     93060
     ACGGGCAGAG AATGCGGAAT TGCGAAGACA GTTAACCCAA TTAGAGGGGG AAGTAGAAGA     93120
     GTTAAAAGAA ACACTGCGGA AGTTGAAGGA ACGCGATAGT GGGAATAGCT CACAACCCCC     93180
     ATCGTCAGAT GGATACAAAC GTAAAAGCAA AGGGTTGATG CCCCGTCAAC GCAAGCAAGG     93240
     ACCGAAATAC GGACATGAGG GCAAAACGCG CTATGGATTT GAGACCGTCG ACCATCGCTT     93300
     GGCGCTTTCC CTAGCGCAGT GCCTAGTCTG TGGCAATGCG TTGGAACGAG ACGAAACCAC     93360
     CCCTGTCAAA CGGCAGCAGA TCGCAGAACT GGTCGAGCGT CCGGTTGAGG TGTGGGAGTA     93420
     TGAACGCCCG GTCTACACCT GTCCCCTTTG TGGCTGGCAC GGTTCTGCTG CCCTGCCGTT     93480
     GGGCTGTCGA GAGGACTTTA GCTATGGCGC ACGGTTGAGT AGTTTGGTCG GTTGGCTGGG     93540
     CTACGGCGGA CATTTGAGTT GGGCAAAGCA ACGGGATTTG ATTGCGATCA TTTTTGGGAT     93600
     TCCCTTGTCG CAAGGTAGTC TTGCCAAGAT GCATCGCTGG TTCTGCGAAA GTTTATATCC     93660
     GAGTTATGAG TCCTGGTGGA GCCTGATTCA GCAGCCTGGA GTGCGCTGTG TAGACGAGAC     93720
     GAGCTATCCC ATCGATGGAG TCAACTATTG GATGTGGGTG GCGACTTCGA GGGAAGTTTG     93780
     TGTTTTGTTT CTCGCTCCGA GTCGGAGTTC TGCCGAGGTG GAATCCTTGT TAGGTAAAAG     93840
     TTTTGAGGGT ATTCTCAGCA GTGATTGTTG GTCTGCCTAT AGTCCCCAGC AAGCCACGGC     93900
     GAAACAGAAA TGTTTGGCGC ATATTCAACG AGAACTCGAA GCCCTTAGCG GTTCACGCTT     93960
     TGAGTCGAAT CGGCAGTTCG CAAGCCAAGT CAGTGCTATC TTCGAGCGGG CGCGGCAAGC     94020
     CTATCGAGGC TATCATGCGG GCAACTTAAC CGTAGAACAA CTCCAGACCC AACGACTGAT     94080
     TTTGGAAGCG GAGCTCACAG ACGTGCTCGA CCACCCGCCG AAAACTGGGT GGGCAGCAGA     94140
     TGCCCAAGCT TTGGCAAATC GCTTCCACCG CTATTGGTCG GATTGGTTCA CCTTCCTGAG     94200
     GATGCCAGAG GTCAAACCTG ACAATAACGA TGCCGAACGT GCCCTGCGTC CAGTAGTGAT     94260
     TCATCGTAAG ACCAGTGGTG GTGCTAGAAG TGCTTGGGGC GGACAGTTAG TGTCACTGAT     94320
     GTTCAGTTTT CTGGAAACGA TGCGACTGCA AGGCCAGAAT GCGGTGGCTG AACTATTTAA     94380
     TCTACTGGCA GGGGTTGAGC GTGCTCCCCC TCAATTGCTG CCATCCACTG CTGAATAAAA     94440
     GCTGAGGTCG GGCTTTTGGG CTTTCTCAAT TAGCCATGCT TCTTGCTGTG ACTAATTACC     94500
     GAATATTGAT GGGTATATGG ATGGCAAAAA TGAATTTATT AAAGAGATCG ATCGCAAAGC     94560
     TGAACAGTGG TGTCAATATT ATTCCTGAAA TGCTTGATCT ATAAGGAAGT AAAGATAATG     94620
     AAAAATATTT GCGTTTATTG TGGTTCAAAT TTCGGTGGTC GCCAGAGTTA TCGTGAAGCT     94680
     GCCAAAAATC TAGGGGTTGA GATGGCAAAG CGCGACATCG CCCTGATCTA TGGTGGTGGA     94740
     AATGTCGGTT TAATGGGAGT GATCGCAGAT GCTGTACTCG CTGCTGGTGG AAATGTCGTT     94800
     GGCGTAATTC CGCAAGCCTT AGTCGATAAA GAGGTAGCAC ACACTGGATT AAGGGATTTG     94860
     CGAATTGTTC ACTCAATGCA CGAACGTAAG TCATTAATGG CTGAGTTGTC GGATGCCTTT     94920
     ATTGCACTGC CTGGTGGCTT GGGGACTTTA GAAGAATTCT TCGAAGTAGC AACCTGGACT     94980
     CAGCTGGGAT TTCACCGCAA AGCCTGCGGG CTGCTAAACA TTGATGGATT TTATAATGGC     95040
     ATGCTAACAT TCCTCAATCA GGCGACAGAA GAAGGATTTA TTCGCCCTCA ACATAGAAAT     95100
     ATTATTTTAA CAGCAGAAGA TCCGGTGGAA TTAATCGACA TGCTGAGTTG CTTTGAAGTT     95160
     CCTCTCGTTC ACAAATGGAT TGGCCGCGAG CAACAGTAGC AAGGGATAGT TGTACTGATG     95220
     CGATCGCCCA TCCAGCATTT TCAGTACCAG GTGATCCCAC CTCATCCCTT GTTAGTACCC     95280
     TATATCCGTT GCTATTGGGT GCTTCGCGTT CCAGCGGGAC AACCAACGAG GCGTGAACTA     95340
     ATCCTTCCCG ATGGCTACGC TGAACTCATT CTGAACTATG GTGAGTCTTA TCGCTGGCAG     95400
     GATCAAGCCC GGCAGGTCGA ACAGATAATT AAAACAGTAC ATCTAGTGGG AGAACGGGAT     95460
     ACTTCCATTC TGGTAGATTT ACCCAGGGGG CTAAACCAAA TTGGGGTTAA ATTTAAGCCT     95520
     GCTGGATTAT TTGCATTGTT ACATCAACCT TTAGAGCAGT TAGCCAATCA AATCGTGAGC     95580
     CCCAGTCAAT TAGGTAATTC TTCGATTCAA GTATTGGGGG AGCAAGTGTT TGATGCACCA     95640
     ACAGATGAAG CAAGAATTGA GCAGCTTAAC ACATTCTTCT TGAAGCGATT GTTACTAAAT     95700
     CCTCTTGATC CCCTCATCGA AAAGTCACTA AAAATCATCT TAGTACACAA GGGGAACCTT     95760
     CGCATTGATG ACCTAAAAGC TCACCTGGAT GTCCATTATA AAACTTTGGA GAGAAAGTTT     95820
     AAGACTTATG TTGGGTTGAC CCCTAAGGTT TTTGCAAGAA TTGTGAGATT TAAGTACACC     95880
     TACAAGCAGT TCCATGCAAT CTCCGCTCAG GACCCAGTCT TTTTTCTGGA TGCAGGGTAC     95940
     TACGATCAAA ATCACTTTAT TAAAGATTTT AAGTATTTTC TGCACACAAC CCCTTCAGCT     96000
     TATGTTCGAA ATCAGCATTC AGTCTCAGAC GAAATTGTTC GGCGCGGGCT CGCCAAGCGC     96060
     TCAATTCTAT CCTCGCTTTA GTGACCCTGT CCAAAATTTA CTATCTTTTA GCCGTTTAGT     96120
     TACGGCAGGG TTAAATCGTT GTTTCAGATC GCTTCAGAGC TACCAACTAT GTCATTGGAG     96180
     TCCAGAAAAC TGCTGGGAAC CTCTCGGCGC AGGTTCCTGG GACAAGCATT AACAGCCGCG     96240
     GGAACAGCAA TCGTTGCGCC TAAAGTCCTC GAGCATGCCG ATGCTCAACC GTCCTCGCTC     96300
     GATCGCCATT CTCCCATTCA AGGCGAAACT CCAGTGAGGC TGACGATTAA TGGGCACCCC     96360
     CACACGATTC GGATTGAGCC GCGCGTAACA TTGTTGGATG TCTTAAGAGA ACAGCTAGCC     96420
     CTTACCGGCA CAAAAAAGGG CTGCGATCAT GGGCAATGTG GTGCCTGCAC GGTGCTCGTT     96480
     GATGGAGATC GGATTTATGC CTGTTTAGCT CTCGCAATCA TGCAGGAGGG ACGAGCAATT     96540
     ACGACCATCG AAGGGTTGGC GCGGGGTGAA CAACTACATC CTGTTCAAGC TGCCTTTATT     96600
     GAGCAGGATG GCTTTCAGTG TGGATATTGT ACTCCAGGAC AAATTTGTGC CTCCGTAGCC     96660
     CTTCTCTCTG AAGTTAGCCG AGGTTGTGCG AGCGCTGTAA CTGCTGACCT CACCCGTCCG     96720
     CCGCAACTGC CAACACTCTC GGGAGCTGAG ATTAAAGAGC GGTTGAGTGG AAACCTATGT     96780
     CGCTGTAGTG CTTATAACGG CATCGTTGCA GCCGTGCAAC AGGCCGCTGG ACAAACTCCT     96840
     CCCCCGTCTG CCGCCACGAT TCTAGTGCAG GAGGGGTGAG ATGAACAATT TTTCCTACGT     96900
     CCGGGCTATG TCAGTTCAGG ATGCGGTACG ACGTTTGCAG GCCGCGCAAA ATGCCCAATT     96960
     TATTGCCGGT GGAACAAACT TAGTCGATCG CCTGAAAGTA TTTCTCGATC AACCTGCTCA     97020
     ATTAATTGAT ATCTCACGAC TGGATTTGAA GCAAATTGAA GCCGCACGAG AGGGTGGAAT     97080
     GCAGATTGGA GCCTTGGCAA CAAATACAGC TGTCGCGGAT CATCCCCAAA TTCGGCGTGA     97140
     TTATCCCCTG TTGTCTCGAG CCATTCTATC CGGGGCCTCC CAGCAAATTC GCAACGTTGC     97200
     AACTGTTGGG GGTAATGTGC TGCAACAGAC CCGTTGTCCC TACTACTATG ACCGGGCATT     97260
     TGCCTGCAAC AAACGGCAAC CGGGCAGTGG CTGTGCGGCA CGGATGGGGA TGAATCGAAC     97320
     CCATGCTATT TTGGGTGCCA GCGATCGCTG TGTTGCTGTC CATCCATCCG ATATGTGCGT     97380
     GGCGCTGGCA GCACTGGATG CAGTGGTTGA AGTGGAGAGC CATCGAGGTC GGCGACGCAT     97440
     TGCATTCAGT GACGTTCATC GTTTACCCGG AGATACCCCT GAACAAGATA CCAATTTGGA     97500
     ACCTGGCGAA CTGATTAGAG CCGTCCTTCT CCCACCTCTA CCATTTGCAA AAACGGGAGT     97560
     TTACCTGAAA CTGCGAGATC GAACTTCTTA TGCATTTGCA TTGGTTTCAG TTGCAGCAGC     97620
     AGTAGAGATC AAGAGCGGTC TCATCACTGA TGTTCGTCTG GCATTGGGAG GCGTGGCACA     97680
     TAAACCCTGG CGATCAGCGA GTGCAGAAGC ATTTCTCAGA GGCAAACCTG CCACGGCTGA     97740
     AACCTTTCTC CAGACGGCGA ACCTGGTGCT GCAGGAAGCC CAGCCCCTCA CCCACAACCG     97800
     TTTCAAAGTA GAGATGACAA AACGTGCAAT CCAACGGGCC CTAACCCTGG CAGCACCGGT     97860
     TGGAGGTGAA ACATGAACCG GGTCATTGGC TCATCGGTCA GTCGTCGGGA CGGGGTTGCC     97920
     AAAGTAACCG GAACAGCGAC TTACACGGCC GAAAATAGAA TTGCCGGGCT GGTCCATGGA     97980
     TACTTAGTGA CATCGACCAT TGCCAAGGGA CGGATCAGCG CAATCTCAAC CCAGGGGGCT     98040
     GAACAAGCAC CAGGTGTGCT GGCGGTTGTG ACTCACAAAA ATATGCCCAG AGTATTTACC     98100
     CCTGCAAACG ACTTCAAAAG TTCAAAGCTG AACGAGGCCC GATTACCCCT GTCGGATGAC     98160
     CAGATCCACT ATGGTGGGCA AATTATTGCA TTGGTGGTTG CCGACACGTT GGAACGGGCG     98220
     CGGTATGCTG CTCAACTCAT CAGCATGCAA TATGAGCCTC ACCCCCCCCT AGTAGACCCT     98280
     CAACAAGCCA GCTATGAAGC CTTATCGGAG GTTGAATTTC GTAAGGGAAA TTTGGCTGCT     98340
     GGCATCGCAG GAACGTCGTT TGGTTCTGCC AACCCAGGAG AAATCACGAT TGACGAAACT     98400
     TACACCACTG CTAAGGAACT CCATGCAGCC ATGGAACCTC ACGCCGTCAT TGCCCACTGG     98460
     CAGGGAGACT CGCTGACGAT CTACGAAGGC TCTCAATGGG TAATGTTGCA CCAACGCACC     98520
     TATGCCGACT TGTTTGGACT TCCATCAGAA AAGGTACGGT TGATTACGCC CTATATTGGC     98580
     GGTGCTTTTG GCAGCAAGTG TTTTCCCTGG CCCCACAGTA TTCTTTGTGC AGCAGTTGCA     98640
     CGACAAATCA ACCGTCCCCT CAAAATGGTT GTTACTCGCC GTCAATTGAC GACTAACGCC     98700
     GGCCATCGCG CTGCAACAGA GCAAAACCTC CGGTTAGTTG CAAGGCAGGA TGGCAAACTG     98760
     GTTGCGATTT CTCACACGGT AAACTCTTAC ACCTCGATGG TTGATCGCTT CATCGTCGAT     98820
     TGCACTGCCA CAACTCCAGT CATGTATGCT GCGCCGCATC TGCAATTGCA ACAAGAACTA     98880
     GGCAGATTGA ATGTGAGCAC TCCCACCTAC ATGCGGGCAC CGAGCGAAAA TCCAGGAATG     98940
     TGGGCACTCG AATCGGCAAT GGATGAATTA GCCTGGACAC TCAACATCGA CCCGGTGGAA     99000
     TTACGGCTAA AAAATGAAAC TACGGGACAC CAGCGCAGTG GATTACCATT TTCAGCGAAG     99060
     CATTTTGCCG AATGTCTCAG GGTTGGGGCC GAACGGTTTG GCTGGAGCGA TCGACCCAAA     99120
     GAACCGCGTA GCCTTGTCCA TGAGGGGCAA CTCGTAGGGT GGGGAATGGC AGCCGCAACT     99180
     TTCCCCGCCA TGAGAGGAAA TACAACAGTT AAGGTACGAC TATTACCCGA TGGGACAGTT     99240
     CACATTCTTA CAGCCGGTAA TGATATGGGC ACAGGGGCGT ATACGATGGT AGCAATTACG     99300
     GCTGCGGAAG CGTTGGGAAT TCCCGTTGAG CAGGTGAAGG TTGAACTGGG TGATTCTCTA     99360
     TTTCCCGATG GGGGATTGGC GGGTGGTTCC CAGATGACCG CATCTCTTGC GCCTGCGGTG     99420
     CTGAAAGCCT GCCAGGAGGT GCTGAAAGCG GCGAACTGCC CCACTGCAAC CCATGCCTGT     99480
     ACTGTACTCA GACAATCTGG ACGAGCGGCT TTTGAGGCGA TCGCTTCTTC TGCTCCTGAT     99540
     GAACAGGCTC AGAAGTGGGC ATTTCAGTCT TGGGGGGCTC ATTTTTGTGA GGTCATGGTG     99600
     GATGAGGAAA TTGGCCGACT GCAGGTAAGC CGCTGGGTCT CTGTGATGGA TATTGGTCGA     99660
     GTGATCAATG CCAAATCGGC TGCCAGTCAG GTCCGGGGCA GTGTGATTAT GGGCATTGGT     99720
     GAGGCTTTGA TGGAAGAGTA CCATCTTGAT CCCAAGACCG GCTATCCCGT TGTATATGAC     99780
     CTGGCAACCT ACCACTATCC CACCCATGCA GATGTTCCCT GGATTGATGT CACCTTTGTG     99840
     GGCCAACCAG ATTTGACGTT TAACCCTTTA GGGGTGCGAG GTGTTGGCGA GGTAGGCATT     99900
     ACCGGGGTTG CGGCGGCGGT TGCCAATGCG GTCTATCACG CCACAGGTAA ACGATTCCGC     99960
     AATTTACCGA TTACACCTGA CAAGTTGATG GCATAGGTTT ATGAGCGAAC TCAAACAAAT    100020
     TCTGCAAGCC TTTGAGCAGA GCCAACAGGT CGGAAAACGT ACAGTTTTAG TAACAGTCGT    100080
     CCGAACGAGT GGGTCCGTTT ATCGGAGACC AGGGGTTCGA ATGTTATTAA CTGAAGACGG    100140
     GCAAATGATT GGTGCGATCA GTAGTGGCTG TTTGGAAGCC GATATTCTAG AACGATCAAG    100200
     GCCGCTCCTA GCTAACCATG GCGATCCCAT CCTGCTCAGA TATGACACGA CTTCTAACGA    100260
     TGACATTGTG TTTGGGTTTG GGATGGGGTG CAATGGTGTT GTGGAGGTTT TGATTGAATC    100320
     CTTAAGCCAG GATGCTGCGG TTCGTCAACT GACGTTTATG CAAGATTGTT TGCACACTCA    100380
     ACAGATGGGA GCAATCGCGA CGGTCTTTGC GGTAAAAAAT CTGCCCGATG TTAACGTGGG    100440
     CGATCGACTG ATGGTCAAAT CTGGCCGGAT GATCAACCAA ATTGCCAACA TTGATGTGGC    100500
     TGAAAGAATT GCAGCCGACA CCAATAAAAC GCTGTTGGAG CAACAAAATT TCGTCCAGTC    100560
     CTACACCCTA TCTTCCGGAA AAGTTGATGT ATTAATTGAA ATAATTCGTC CATCTGTCCC    100620
     TTTACTTGTT TTTGGAGCCG GATATGATGC CATTCCTGTC GTGCAGTTTG CTAGGACACT    100680
     AGGTTGGCAC GTAACAGTGA TTGATCATCG ACCGAAGTAT TTAACCCGCG AGCGCTTTCC    100740
     CCAGGCGGAT CAATTGCTCT ATTGCAGCCC AGACTCATCG AACACATACC ATCGTCTGCT    100800
     GACACCCGAG ACCGTCGCTG TTGTAATGAC CCATCGATAT CTCACTGATC TAGTATTTCT    100860
     TAAAACCTTG ATTCCTGCCC GACCTCGTTA TCTAGGTGTA TTGGGCCCCA AACGACGAAT    100920
     GCAGCAGTTG TGGCAGGACT TAGCCCAGGA GGGGATCAGC CTAACGCCCG AGCAAAACCA    100980
     GCAGCTTTAT ACTCCAACTG GGTTGGACAT AGGGGCTGAA ACACCTGAAG AAATTGCTCT    101040
     CGCGATCGTG GCAGAAATTC AAGCTGTGAT CAGACACCGG CCTGGCTGCT TCCTGCGCGA    101100
     TCGTATCGGT TCAATTCATT CCTCCCCACA ATTGGCATGT CTGGAATTGG CATCCTAGTG    101160
     TTGGCAGCGG GAGCTTCTAA GCGCCTGGGA CACCCCAAAC AACTCTTGCC CTTTAGGGGT    101220
     AGGCCGCTGA TTTTTGAAAT AGCAAAAGTA GCAGTCCTGT CTGGCTGCCA ACCGGTTGGG    101280
     GTAGTCTTGG GAGCCTACGC TGAATCGATT GAGCCTCATC TGGCAAATCT AGATGTTCAT    101340
     ATCATTTACA ACGAATATTG GTTAGCGGGG ATGTCAAGTT CGATTCAGTG TGGATTACGC    101400
     GAGCTCCTGG CAATTTCCCC TGACCTGGAG GCGATTCTCC TCATGGTGTG TGACCAGCCG    101460
     TTTGTCTCCC CCCATTTGAT TCACCAATTA ATCTTCGGAT ATAAAACATT TAATTACCCG    101520
     ATCGTTACCT CTGAATATGG AGGCATTAAA GGTGTTCCAG CCCTTTTCCA TAAGGATTTT    101580
     TTCCCGAATC TGGCCATGTT GCAAGGAGAT ATAGGGGCAA AATCAATTAT TCGCCAGCAT    101640
     CATTCCCATT GCTTCAGCAT TCCCTTTGAA CAGGGAGCCA TTGATTTAGA TATGCCTCAA    101700
     GATTTGTCTA TTCTTTCATT ACTTATCCCG CAACTGCAGG TCCCTCTCTA AGTAAGTCAG    101760
     TTTCGTTATG AACAAATGTG CTTTGTAAGG TTCCTATTAG AGCCTTTAGC GCCGGCTCAT    101820
     TCGCAAGCAT TAATTGATCC AGGTTCTCTT GGCTAAGTCA TAACCCTTTC TCCTATAAAG    101880
     ATGTAGCGAG TCTAGCCAAG TTCGAGCTTG GCACTTCAAA GTTAATGCCG ATTAGGATGC    101940
     TGGAGTGCAG GTGGAAGACA ATCTTCCAAG CTCCTGCTTG ATCGCCTCAA TCACGCAATA    102000
     TGTCATTTAA AGCCAACCTA CTTTAGTGAT TCATGCCTGT AACCACTTTA ATGAACAAGC    102060
     TGCAATTCAA TTTCCACGGG ATTACTTTGC AGCCAATGAA GAAATAGCCC GTATATCCAT    102120
     TTGAATGGCA TAGTATGATC ATTGAACCTA TTGAGTTGTT TATGTCCAGA GCAATTTATA    102180
     CAACATGGAA TCTAACCGAG AGGATCCTTC GAACTCAAAT TTCAGGAGTA CTTCGAGAAG    102240
     AGCAACTTGA AGAATGGAAA CACAGCTTAG AAGAGGCTAG CTGTCAAATT TCTCAGCATC    102300
     TCAACTTTGC TATGTTAGTT AATATTCAAG GCTATGAGGT AGGCGATCAA GAGAAAGCTA    102360
     TTCGTAATTA GTCACAGCAA GAAGCATGGC TAATTGAGAA AGCCCAAAAG CCCGACCTCA    102420
     GCTTTTATTC AGCAGTGGAT GGCAGCAATT GAGGGGGAGC ACGCTCAACC CCTGCCAGTA    102480
     GATTAAATAG TTCAGCCACC GCATTCTGGC CTTGCAGTCG CATCGTTTCC AGAAAACTGA    102540
     ACATCAGTGA CACTAACTGT CCGCCCCAAG CACTTCTAGC ACCACCACTG GTCTTACGAT    102600
     GAATCACTAC TGGACGCAGG GCACGTTCGG CATCGTTATT GTCAGGTTTG ACCTCTGGCA    102660
     TCCTCAGGAA GGTGAACCAA TCCGACCAAT AGCGGTGGAA GCGATTTGCC AAAGCTTGGG    102720
     CATCTGCTGC CCACCCAGTT TTCGGCGGGT GGTCGAGCAC GTCTGTGAGC TCCGCTTCCA    102780
     AAATCAGTCG TTGGGTCTGG AGTTGTTCTA CGGTTAAGTT GCCCGCATGA TAGCCTCGAT    102840
     AGGCTTGCCG CGCCCGCTCG AAGATAGCAC TGACTTGGCT TGCGAACTGC CGATTCGACT    102900
     CAAAGCGTGA ACCGCTAAGG GCTTCGAGTT CTCGTTGAAT ATGCGCCAAA CATTTCTGTT    102960
     TCGCCGTGGC TTGCTGGGGA CTATAGGCAG ACCAACAATC ACTGCTGAGA ATACCCTCAA    103020
     AACTTTTACC TAACAAGGAT TCCACCTCGG CAGAACTCCG ACTCGGAGCG AGAAACAAAA    103080
     CACAAACTTC CCTCGAAGTC GCCACCCACA TCCAATAGTT GACTCCATCG ATGGGATAGC    103140
     TCGTCTCGTC TACACAGCGC ACTCCAGGCT GCTGAATCAG GCTCCACCAG GACTCATAAC    103200
     TCGGATATAA ACTTTCGCAG AACCAGCGAT GCATCTTGGC AAGACTACCT TGCGACAAGG    103260
     GAATCCCAAA AATGATCGCA ATCAAATCCC GTTGCTTTGC CCAACTCAAA TGTCCGCCGT    103320
     AGCCCAGCCA ACCGACCAAA CTACTCAACC GTGCGCCATA GCTAAAGTCC TCTCGACAGC    103380
     CCAACGGCAG GGCAGCAGAA CCGTGCCAGC CACAAAGGGG ACAGGTGTAG ACCGGGCGTT    103440
     CATACTCCCA CACCTCAACC GGACGCTCGA CCAGTTCTGC GATCTGCTGC CGTTTGACAG    103500
     GGGTGGTTTC GTCTCGTTCC AACGCATTGC CACAGACTAG GCACTGCGCT AGGGAAAGCG    103560
     CCAAGCGATG GTCGACGGTC TCAAATCCAT AGCGCGTTTT GCCCTCATGT CCGTATTTCG    103620
     GTCCTTGCTT GCGTTGACGG GGCATCAACC CTTTGCTTTT ACGTTTGTAT CCATCTGACG    103680
     ATGGGGGTTG TGAGCTATTC CCACTATCGC GTTCCTTCAA CTTCCGCAGT GTTTCTTTTA    103740
     ACTCTTCTAC TTCCCCCTCT AATTGGGTTA ACTGTCTTCG CAATTCCGCA TTCTCTGCCC    103800
     GTTGCCGCAA ATACTGCTCA TACCAATACC GAACCCCCAT CTCTTCTGGG TCAAACTCGG    103860
     GGGCTGCCAT CCTGGCTGCT AAGTGGGCAT CGCTGGGCTC CATACTGCTC AACCTAACCC    103920
     ATCCGCTTCA ATTTAGCGAT TCCCATTTAA CCTTTCTTAT TGCGCTGACC AACTACAGCT    103980
     ATTCATCATC AACAACGCAT TATTATTCCG ACCTTTCTAG CCCAGCATGG TTTTGAAACT    104040
     GGATTTTTTC AACTCTTTAA AGTTCAGAAC ACTATTTTGC CTGATCCTGA TCGCGCCCAT    104100
     TGTATCGCGG TTGCTCATGT TCATCACGAT TGTGGCAAGA TGGAACTTTA CAGTCAAAAT    104160
     CTTGGGCGAT TAACTGAGCA ATTCTTTTGC CGTCTTGCAG AGGCTGAAGC CTGGCTCCAT    104220
     GCAGCAAATT TCGGGTTTGA CGTATGAATC TCTCCACATT TGAAAATCAT ATTGTCCTGG    104280
     TAACTGGTGG TAGCTCAGGC ATTGGACGGG CAACAGTACT AGCATTTGCC AACCAGGGTG    104340
     CAACAGTCGT TTTTGCCTCT CGTGGAGTTG AGGCAGGTAT GGCTTTACAG ACCGAGATCA    104400
     ACCAGTCTGG CGGCCAGTCC ATGTATCTGC AGGCAGATAT GGCAAAATCT GCGGATATTC    104460
     AAGCAATGAT CACAAAAACA ATCGACAAAT ATGGTCGTAT CGATCATGCA ATTAACAATG    104520
     CCGGAGCTAA TGTGCCGCTG GCCCCTACGG ACAAGTTAAC AGAATCTGAG GCGGATTACA    104580
     GTTTGGACGT TAACCTCAAG GGGGTTTGGT TATGTATGAA ATATCAACTG CAACATATGG    104640
     CACAGCAAGG CAACGGCACT ATTGTCAATG TATCTTCCAT TAATGGTTTG AGTGGGACTC    104700
     CCATTGGTGC TCTATACACA GCAACTAAAC ATGGTGTAGT TGGGCTGACT CGATCTACAG    104760
     CATTGGAATA TATTGGTCAG GGCATCCGTA TCAATGCCGT CTGTCCTGGC TTAGTCCATA    104820
     CCCGACGGTT GGAACTTCGA TGGTCAGAGA TGCCACCAGA GGAACGGACA AAATCCATGC    104880
     GGCATTTGGC AGAATCCATT CCTATCCGGC GGTTCGCTCG ACCTGAAGAA GTTGCGGCGG    104940
     CGATCGTCTG GCTTTCATCT GAGCAATCGT CTTATGTTGT AGGTCAGGCA CTCGTGATCG    105000
     ACGGGGGGTT GACCGCCTAG CAATCCCTAT AATTCAGCCC GATCTGTTGC TCTGTGATCT    105060
     AGACATGCCT CAGGTTGATG GCTATACGCT GATCCAACAA ATTAGAGGAC AGGGATATAC    105120
     GCAACAGCAA TTACCTGCCA TGGCGCTGTC TGCCTATGCC CGTGAGGAAG ACCGACAGCA    105180
     AGCCCTCAGT GCTGGGTTCC AGCAGCATCT CTCTAAGCCT GTAGACCCCA CAGCTCTAGT    105240
     TGTTGCCATT AAAAAATTGC TGATGGAAAG GATGTAAAAC CTGGGCCAGC AAATACAACT    105300
     ACAAAAGGAG AGTTGAAGTA GGGCTCATAT CCCGGCGCTG TTAGAAATCT ACAGATTTTC    105360
     GTTGTCTATG ACGATCCCGA ACTTGTAAAT TAATCCAATT TATTCATCAG GAACAGGGGT    105420
     GTGGCACTAT TGTTAGCAAT AAAGTACATT TATAGCTCGT TAATTCGCCT GATGGTTAAA    105480
     CGATTGGCTG TTTAGGGTTA CTTTATAAAT TAGCTCTAAG ATAAGCAGTA GCAAGTAACC    105540
     TCAGCAACTT CACAATTGGT TCTCATCCGT CTACTGCTAT GATATGATTG CTTGTGGAAG    105600
     TCAAAATATC CAATCACTTC ACTTTATAAT AAAGCAACAA AACTCCATTG TTGTAAATTT    105660
     TCCGATCAGT AAGTTCTAAA GCTGTTTGCT GAATCACTCC AGAAAAAAGT GGAATACCCG    105720
     AACCCATTAG AAAAGGATTT ACTTTAAGAA TTAGTTGATC AATTAAGCGA TTAGCGAAAA    105780
     GTTCAGTGGC TAAATTCGCT CCTCCACAAA GCCAGATGCC CTTACCTAGC CCACTCTTTA    105840
     AAGTTTTGAC GAATTGGATA CTATTCTCTG AAATGAGTTC AACATTTTCA TCTGGGCTTT    105900
     GTCCCATACT GTTTGAAAAG AGATATTGTT TCATGTGCGA GTATGGGCTT GTCACGCCAT    105960
     CTTTTAAACC TACTTCGTAA GTTTTTCGGC CCATAAGAAC GGTATCAAAC CATTTGTTCT    106020
     CGGCATGAAT ATTCATTAAG TTACGCAGAT GAGATGGAAC TGTCTCAGGA AAAAACGAGA    106080
     ATAAATCTTC AAAATATTCG CTGTTTTGGG AAAAGCCGTC GTGTGAACCA TCGGTATGCG    106140
     CAATAAACCC ATCAACACTG CAAGCTACAT AATATGTCAG TATTCGCATT TTCTCTACCT    106200
     TTGGTAATTA GACAACAAAT GTCTTGATAA ATGTTGTGAC GACAAATAAT TTTTCAGATA    106260
     TACAGCGTTT TCCGAGATAG TGAAACCCAT GCTTGACAGT AAAAAGCTGA TTGGCTAGAG    106320
     CTTCTGACGT GCTTATCTGA GTGGAAAACG CTGTATCCCT TTTCTGTCAC CCTAGTTAGG    106380
     CGAAAATTGG GGTTGAACGC TCAACCGATG GAGGAGGGGG CAAAAGAATT GATTCATCTG    106440
     GTCAATCAAG GGATAGCGAC AGGATACATA TAAAAACCTG CAAGATGAGG TTCAACAGAT    106500
     GTTAATCCCC GTCTGGGTAA CACCTCCAGA AAACAAGGCA GTACCAGAAT AGAAGTGAAT    106560
     TTCATATCAC CGAAATGCTT TCCCCTTAGT TGTAATAACT AGGGGGTTCT TGTCTAGGGG    106620
     ATGAATTTTC TACCCGTTTG TCAAATTCCC TATGCACTGA GATTTCACCA CCACTGCAGT    106680
     CATGGGCGAC CTTGTCCCTC CAGCTATGCG GTGCAGTTCA CCTATCTCCA ACCCCATTTT    106740
     TTCCTCCAGC GACATTTCCT TGCTGAGTTC TTCAGATTGT CCAAAGGACG TTTCAGTTGG    106800
     ATTCATCGGG TATCTCCTAG TGGTACGGTC GGTGTCTTTA AAGTACAGTA AGCAAATTCA    106860
     GCTCACAGTG TCCTCAGTTG CATCTACCTT GTATCCCTTC CACTTTCATG TATATTGCCC    106920
     CACCAGCAAT ACCTTTCAAG TCGTTTACAT CCAGTTCTAG ATCTTCATCT TCCCCTACCT    106980
     TAATTTGGTT GAACTGTTCA TCGGACAGCT GGGAGAAAAT TTTGGCATTC ATAGTTGGAC    107040
     TCCTAGAACA TTAGTAATTG CTTTAAGAGT ATGATCTGCA CATTGGAGTT GTAGTGACAT    107100
     AGATCCGCTG AGAGAATGAT CCTCCGCAGA TAGAAGGTGT GATCTTGGTC GTTTTAATTA    107160
     ACTCCACCGA GAGCTTTGCC CTTATGTTGT GCCCATGGGC AACTTCCCAT AATGCCGTCC    107220
     CAATGGCAAA AATTCGTGCT CTCGCGTTTC AAACGCTAGA GTTTCCGGAG TCGGGGAAAA    107280
     GGTTATCCAG ACTGCTTTCC AGGGATTGTC CTGAAATCTG AGGGGTGTGC GATCGTCATC    107340
     GAGCCAGAAC TGCTACACCC TCTTCATGGG GGCAGCATGC ATCCGTCACA CCCCGCCGAT    107400
     AGTCTTAGAA CATCAAACCG ATTCAATCTC ACTCAGGAGA AAAAGCTATG AACACTAAAA    107460
     CCACCAAAGA AGCCTTGATT GCCAAAGTTG CTGACAAAAT GAAAGCTGAA GTTATCGGCT    107520
     GCATCCTTGG GGCTGAACCA GTCAGTGCTG CCACAGCTTT CTGCCAGATA TTGTAATTGG    107580
     GGTTGCGACA GGATACATGT AAAAACCTGC AAGATAGCCC TCTAAGCCTT ACTTAGCCTT    107640
     GCTTCCAGAG GGTGGTTTGA CCTTATAAGC AGTTCCACAA TAGGAAAACT TCCATGACAA    107700
     AGTATGTAAC CACTGAAGAT CAGCGTTGGC AAGGAATCGA TGTCCGAGGG GTAACGATGG    107760
     AAGCCTGCCG TCTATGGGAG GGAGACTATA ACGTGCGCTC CGGATTTTTC CGTATGCCCA    107820
     AAGGCATGCA AGTCCCCATG CACCACCACC CTTATTGGGT TCAGGTGTTA GTCATGAGCG    107880
     GGAAGATGGA AGTGGAGGCC GAAGGAGAGG AGATACACAC GATCGCAGCA GGCGGGTACT    107940
     ACTTCGTCGA ACCTGGGGAA TCGCATGTTG AAACGGCTGT CGAAGATACC TTGCTCCTGG    108000
     TTGTATCAGA AGAAGAACGG GAAGAGCTGC GTCTCAGACC GTCAACGCAT TAAGTAGAGT    108060
     TAGTAGGGAT TGAAACAGGA TACTGGGGGT TTTTGCATAC CCCCCCGAAA AGGTATATTC    108120
     CACAATGAGA CGCCTGAGTC TTTATCTGCT GATTGTATGG CCTTCGTACC ATTCAGATAG    108180
     CAATACACAC TCGCTTTCGA GAGTTTGTAA TCCTTCATCA GGGTTTTGAT CAGGACGCCT    108240
     TGCTGTCGTT TCTGCCGTAG CTCTAAACAC TCCTGTTGCG TTAAGCTTTT TTCTCGCCCC    108300
     AGCCTCACCC CACGGGCTTT AGCATTCTCG ATGCCATCCA TTTGACGCTC AGCACGAATC    108360
     TCGGTCTCAA ACTGGGCAAT AGCCCCCAGC ATATTGAATA GTAGCCGCCC GGTCGCATCC    108420
     CCAGTGTGAA TGTTCTGAAC AGACCTTAGG GCACAAGCAG GTCTTGCCAG AACGAAAACT    108480
     GCGGAGTTTA GAGGAGTTTG TGGAACGCTT TGCGGGGGTT GAGGAGGTGA TTGTGGATGG    108540
     AATGGAACGT CCGATTCAAC GTCCTCAAGA CGCCCAACGA CAAAAGGAGC ATTACTCTGG    108600
     TAAAAAAAAC GCCACACCCG CAAACATATT ACTGGAAGTA CCCGTCAAAA GCGAGTGATA    108660
     ATTTTAACCA AAGCCAGAGC AGGGACGGTC CATGATAAGC GGCAATTAGA TGAGGAAGAG    108720
     TTGGTGGAAA ACATTCCAGA TGAGGTGAGG GTAGAGGGAG ATTTAGGGTT TCAGGGCTTA    108780
     CAACATGAGT TTGTGAACAT CCGGATACCT CATAAAAAGC CTAAAGGCAA AGAGTTGAGC    108840
     GAACAACAGA AGCAAGAAAA CCGAGAATTT AGCCGCCAAC GAGTTAAATG TGAGCATGCA    108900
     CACGCAGGCA TCAAGCGCTA TCAATCGGTT GCAACTGTTT ACAGAAATCG TGTGCCTGAT    108960
     TTTGATGACC GTTTAATGTT GAATGCAACA GGATTATGGA ACTTCTATTT GGATGCGGCA    109020
     TGAATTTGGA GAGAATCGGA AAAACTGTCT CTATGCCAAT GTTATTTCCC AACAACCCTA    109080
     TTATGTCTAA GACCCTTTGA GAATCGAATA ATGAGACATT ATTATAGGCA TGTCTCAAAA    109140
     GGTCTACTTT CTGAGACTAT CGTAAACGAC CGAGCCCCCA GCGCGATCCC TATTTCTATG    109200
     GCAGAGCAGA TAGCGGTCCC TACCCAAAAA CGTCTGCAAA TCCTGCGGGA AGACGAGATT    109260
     GCCGACCTCT ATGGTCTGCC TCACTTCACC CCTGAAGAGC AAAGCGAGTA CTTCGCGCTA    109320
     TCACCCAGAG AAACTGCCGC CATTGAGCAG CTGCATAGCA TCAAGTCCCG GATATACGCC    109380
     ATTCTACAAC TGGGCTACTT CAAGGTTCGC CATCTCTTTT TTGTCTTCAA ATTGCCAGCT    109440
     GTAGCTGCCG ATGTTCGATA TATTCAGGCA CGCTACTTTC CTAAATTTAA GCTGACTGAG    109500
     TTTGAACCCA CGAAGGTCAC TCGACTGAAG CACCAGCGCA TTATTCTTGA ACTCTGCCAC    109560
     TACCGTACTT GCGCAGAGAC AGAGCGTCAA GCGCTGATAA ACAAAGCTCA ACAGGCAGCC    109620
     AGAGTTTGTG GAAAGCCCAT CTACATCTTT CGTGAGCTGA TGCATTATCT CGAGGAGGAA    109680
     CGCATTATTG CGCCTGGATA TAGCTTTATG CAGGATGTGG TGGGTCAGGC TATTGCCTAT    109740
     GAGCAAGACC GATTGGTTGC CGTAGTGCAA CAGCATCTGA CAACGGCTGA TACTGAGGCC    109800
     TTAAACCGAC TAATAGAAAA TGCACCGGGG CTGTACGAAA TCACCCAGCT AAAACGAGAA    109860
     CCTAAAGATT TCAGCCTCGG CGAGGTGAAG CGTGAGATTG GTCGCAGCGA TCAGATTCAG    109920
     CCGCTCTATC ATTTGGCCCA AAAGCTGCTG CCTGCGCTGG AGATTTCCCG TGAGAGTATC    109980
     AAATACTATG CTTCACTGGT AACCTATTAC TCCGTCTTTC GGCTCAAGCA ACTGGCAGAG    110040
     GGCACGGTTC ATGTGTACTT GCTATGCTTT GTTTACCACC GCTACCAGCA GGCACAGGAC    110100
     AATCTCATCA ACAGCCTGAT ATATAACGTC AGACGGTATG TTGAAGAGAG TAAGATAGCG    110160
     GCTAAAGAAC AGGTGTATGA GTATCAGGTT GAGAGTAATC AAAACCTGCA AAAAGTCGGT    110220
     CAGATCCTCA AGCTGTTTAC CGACGATACC ATTGCCGAAA CCACCCCCTT TCAGGAAGTT    110280
     CAGACAAGAG CCTTTGAGAT CCTAGAACGC CAGAAGTTAG CCTTCCTGGC TGAGCACATT    110340
     GCTACCCAAG CGAGCTTCGA TGAGACGGCT TTTCAGTGGG AGCATGTAGA TACTTTAGCG    110400
     CGACAATTCA AGTGCAATCT CCGGCCTATC CTACAAGCGA TTGAGTTTGC CAGTGCCTTG    110460
     GGATATGCCC CTGTGCTGAA GGCACTTCAG GTCTTGAAAG CAGCGGCTCA AAAAGGGCGA    110520
     CCCTTGAGTC AATATCGCCC AGACTCGTTT CCCACCCAGT TCATTCCAGA CTCAACTAAA    110580
     TGCTATCTCT ATGCCTCAGC GGCGGCCGGT GGTCACCTAC TGACAGACCG CTATGAGTTC    110640
     CTGGTCTACC GCTTGCTGCG AAATGGTTTG GAATCTGGCG ACATTTTCTG CCGCGATAGT    110700
     GTTCGCTTCC GCAGTTTCGA GGATGACCTA CTCAGCGAGC AGCAGTGGAA AGCAAAGACT    110760
     GAGTTGATGA CAGCCACCGG GCTAAAGATA CTCAAGCAAC CGATTCAAGA GCATTTGACA    110820
     GCACTTGAGC AGCAGCTAAA ATCTCGGCTG GCTCAGGTGA ATCAGCACTT GAGCGCCGGT    110880
     GAGAATCCAC ATTTCGAGGT CAAAAAGCGG GGTTCAACCA TCCAGTGGAC GCTTCAGTCA    110940
     CCGGGCATTC GCGAGTCGAT CAACCATCCG ATGTTCAGTA CGCTCAAGCA CGTCAACCTC    111000
     AGTAGCATTC TGCATTTCGT CAATCAGTAT TGTCAGTTTA GCGAGGCTTT TGAACACCGC    111060
     TTGGGGCGTT ACGTCAAACA AAAATCAGAC GACAGTACAC TGATCGCTTG CTTGATTGCC    111120
     TGGGGCACCA ATATGGGGCT GGGTCGCATG GGCGAGACCT CAGATATCAG CTATTACGCC    111180
     CTGGCAAACG TATCTGACAA CTTCCTCCGT CCAGAAACGC TGAGAAAGGC CAATGATCTC    111240
     GTCAGCAATG CGATTGCTGA ACTCCCTATT TTTCGGCACC ACGATATTGG TGGAACCCTT    111300
     CACTCCAGCA GCGACGGGCA AAAGTTCGAA AGCCAGATTC AGACCGTTAA TGCCCGTCAT    111360
     TCGCCCAAGT ATTTTGGATT GAAAAAAGGA ATCGTTTCCT ACACCCTGAT TGCCAACCAT    111420
     GTGCCGGTCA ACGCCAGAAT CATTGGTGCG AATGAGCACG AGAGCCATTA TGTGTTTGAC    111480
     CTGCTGTTTA ACAACACGAC TGAGGTACAG CCCACAATTC ATTCCACGGA TACTCATGGC    111540
     TCCAATGAGG TCAATTTCGC TATCTTGCAC ATATTCGGCT ATCAGTTCGC CCCGCGCTAC    111600
     CGAGATATTC ATCACAAGGT CAGTCATGCG CTCTATGGGT TCAAACACCC CAGTCAGTAT    111660
     GGGGATGTCC TGCTCAAGCC GATTCGCAAG ATCAATACCC AGCTCATTAT GAACGAGTGG    111720
     GACAACATTC AGCGCATCAT GGTGTCATTG GCCCTGAAGA CCACCACTCA GAGCATCATT    111780
     GTCAGTAAGC TGAGTGCCTA TGTGCGCAAG AATAAGACCC GACAAGCGTT ATGGGAGTAC    111840
     GACAACATCA TCAAAAGCCT CTATCTTCTG GACTATGTCG ATTCGGCTCC CCTGCGTCAG    111900
     AATATCCAAC GGGCGCTGAA CCGGGGCGAA AGCTATCATC AATTACGCAG AGCTGTTTCC    111960
     TACGCCAACT TCGGCAAGCT TCGCTTTAAG ACTGAATACG AGCAGCAGAT ATGGGGGGAT    112020
     TGCGCTCGTT TGCTGACCAA CTGCATTATC TATTACAACG CCTTTATCCT GTCCGACCTA    112080
     TTGACTCACA GCGACAGTTG CGGTGACACG GCCAGGGTGG CCCTGCTTAG CCAGGTGTCA    112140
     CCAGTCGCAT GGCAGCATAT CAATTTCTAT GGTCGCTATG AGTTCAGTAA ACAACCTGAA    112200
     ATCATTGATA TGGAAACGAT TCTTCAACAA TTAATACAGC TCCCCCTTAA ATGAGACGAG    112260
     TGAGTCTCAT TGTGGAATAT ACCTTTTCGT GGGGTTATGT AAAAAACCCC GTGATCCTCC    112320
     ACTGGACTGG GAAAGCCTGC TGGAACGGCA GACAGGAACT GTGGTAATTC CAGGGGGAGA    112380
     AAACGACCCG CTGCATAAAC CTGGCCCACC CAGAGGTTTG GATCTTCACT ATTTTTAGAC    112440
     ACAAGAATTT GGCTCCAACC TGCACTGAGG AGTAAACCGG CCGTTATGGC CCTGATCGCT    112500
     ATATTACTCT CACTTCAGTA CAAATGTACG TATTGAGGAC AACCTTTTTT GCCTGCGATT    112560
     GTTCTACATG AACAGTGAGG CGAATGATCG GCTTTGGCAG GGCCTATCCA GTTATTTTTT    112620
     CTGGATGGTT TTCTGCTCAA CTTTCAAGCT GGCTTTGACT TTATCCAAAA ACCTGGGAAG    112680
     AGCTTTGGCT AAATCCTGAT CAGCACGGTT AGAAGGTCCG TCTGGCAGTA AACTGCTTAA    112740
     TTCCTCTAAA TTGGCTTCTA TTTTCTGAAG GAGCTTCAAC TTATTGAAAT TAGGAACTGA    112800
     GTTCCTAGTA TTTTCATACT GGTCATTCAG TACACGCCGA ACATAGCGGG TGGAAACACC    112860
     GATCGCTACT GCCAGAGCTG GTCCGAGAGC CTTTTCACCA GCTTTAGGAC GGCCGGGAAT    112920
     GTCCCGATAG TTGAGTTGAC GTAAGCGGGT TGCCAGCTTT TCAATTTGAT CACGAGAGTA    112980
     GTTAACTCGT TTTTCATTCT CAGCCAGTTC AACCTGTAGA GCACGTTCGG GTTCAGTTGC    113040
     GGCATCAAAG GACATCATCC GTACAGGAAT CAAATCATCT GGGCATTGCT GCCAGTAGCT    113100
     TTCTGGTTGC GTTTGTTTGA GAAGTTGTAG AGCTGCCAGA CGGTGGCCAC CAGCCAGCAG    113160
     TACACCTTTG CTGTCTACAA CCAGGGGTTC AATTAATCCC AGAGCTGCGA TCGATTCGGC    113220
     TAGATCTTGA ACGTGCTTTT CTCGTAGTGG GCGTGTGTCT TCCAGGCGCT GATGAATCTG    113280
     TCCCAGGAGA AGGCTTGTCC GTTGAGCCCG ATCGCTTTGC GATTTTTGCT CCAGTAACTG    113340
     GTCCTGCTGT CCTAAGGCTT CCGCTGCCTG AGTTCCTGAG GCAAATACCT GAGCAGCATT    113400
     TCTTGCCCTA GCCATTTAAT ACCCACTCTG CGATTGCTTT CAAATCATTG GCCCCTTTGG    113460
     AATGTGGCTC ATACTGCATC AGAGGAATCC GTTCTGCTGC CGCCCATGCC AGGTTTGAAT    113520
     CTTGATGGAC AATCATCCGC TCAGTGGCAG GGTAGGTTTG AGCCAGTTGT TCAGCCAGGG    113580
     ACTGATCCAG CGATCGCCGT AGATCAATCC GGGTCAGCAC AAAGGCCCAA CGGTTAGCCC    113640
     CTTTACGCCC CTTCTGCTGG CGGATTTTCA AATCATTCAC CACTCGCCCC GCTCCCATCA    113700
     CAGCCAGGGG ATGGGCATCT GTGCAAATTA GAGCAACGCT TGCTGCAACC AAGCCCAAAC    113760
     GTTCCAGATA TTCCACACCT GGTGGGCAAT CAAAGATCAG GATGTCAAAG TCCAGGGGAG    113820
     CAACAACATC TGCTAGATCT TCAGGGTCTA AGGACTGAAT GCTATGGCTC GACAGGTTGG    113880
     GCCCGCCTGG CAAAACAAAG AGATTTGGAG CAGCCTCTAG TGGTTTGGGA GTTCCACCCA    113940
     GTAAGAGATC GGCTGTTCCA GGTGCAGTCG GATCTGCTCC CAGCACGTAG GCAGCATTGG    114000
     ACTGGGGATC GAGGTCAATT ACCAGTACTC GTTGCCCTTT ACTGGCGAGG ACAGAAGCTA    114060
     ACCCGCAGGC AACCGTTGTC TTGCCAACTC CTCCCTTACG GGCTGCGATC GCGATTCGTT    114120
     GATGTGTCAT GGGCAGATTT TAGAGCAATT TCACCAGAAA CTGGTATTTT CGTTTTGCTA    114180
     CACTCCCCAG CATGGTATAG AGAGCTATGT TTATTTGTGG TGTATGAGCA AAGGAGAGGA    114240
     AAGGGCGTAT CCTGCTGGAT AAGCAAAAGT AAAAACCAGA CGAGGATACC CCATGAGTAA    114300
     CGACAATCTT ATTGCATTTC AAGCGCCAGA CCCTCCCGCA TCGTTTAGTG ATGCCCTGAC    114360
     AGAACTGGTC CGTAACGGTG CTCGCCAAAT CATTGCTCAA GCTGTGGAGG CGGAATTGCA    114420
     GGGGTTTTTA GCTCAGTACG AATCGCTTCA AGATGACCAG GGACGCCAAG CGGTGGTGCG    114480
     CAATGGGTAT CTGCCTGAGG TCCAGAGTGT GGAGGAGGTG CTGCCCTGGC TGTATCTCAA    114540
     GGGCATTTCA ACCGGGGATT TTTCCGAAGC CTTGGCATCC TTGCTGGGAG CCCAAGCGGC    114600
     AGGACTTTCG GCCAGCACCA TCAGCCGCCT GAAAGCCAAA TGGATCAAAG AGCACCAGCA    114660
     ATGGCAACAA CGATCACTAC TGGGGAAACG GTACGTGTAT CTGTGGGCGG ATGGGATCTA    114720
     CTTCAACATC CGCAACGAGG ACGACCGCCA ATGCATCCTT GTTGTCATCG GTGTCACCAA    114780
     CACAGGCAGC AAGGAACTGC TGGGATTGGA AGCCGGATTT CGAGAGTCCG AACTGAGTTG    114840
     GAAGCCGTTG TTGTTACGTC TGCAAGACCA GGGGCTCAAA CAGTCCCCCG AACTGGCGGT    114900
     TGGAGATGGC GCCTTAGGGT TTTGGAAGGC GCTCGCGCAA GTGTTCCCGA CCACTCGTGT    114960
     CCAACGCTGC TGGGTGCACA AAACTGCTAA CGTCCTCAAC CACTTGCCCA AGGGTCAGCA    115020
     ACCCAAAGCC AAATCAGCCC TGCATGAGAT CTACATGGCA GAGACTCAAG CTGAAGCACA    115080
     GACAGCGTTT GACCGATTTA TCAAGACCTA TGATGCCAAA TACCCCAAGG CGGTGGCGTG    115140
     TTTATCCAAA GACCGTGAAG CCTTGTTAGC CTTTTATGAT TTTCCGGCTG AACATTGGGT    115200
     GCACCTTCGC ACCACCAATC CCATTGAATC CACCTTTGCG ACGGTGCGCT TAAGGACGGA    115260
     TAAAACGCGA GGCTGTGTTT CACAGGAGAG CATTTTGTCC TTGGTGTTCA AACTGGTACA    115320
     AAGTGCCCAG AAACGGTGGT TACGCATTCG AGGCTTCAAA CATTTAGCAG AGGTAATTGA    115380
     AGGAGTGAAA TTCAAGGATG GCCTTCGAGC AGACCAGCAA CTCGATTTCA AGGACAGTAG    115440
     GAACGCCGCT TAATTCTTCT TCATACACCA GATTTGACAA TAACTCTGGT ATAGCCAAAC    115500
     TGAGAGACTG GTGACGATTC CATAAAACTC GAATCGTGAT CACTATAGGT TTAAAGTGAC    115560
     CAGAGCGGGA ATGAATAAGG CCGAAATAGT TTGGAAAATT AGAAAGTAAA CTTGGTTAGG    115620
     TTGATACTTG TTAGACTGTA ACTATTAATC CCAAGGGTGA GTTTATGAGT GACAATAATG    115680
     TGGAAGTTGC TGTGCTGAAA GGTTTGCGAG AATTGCCCCC CGAGCGTCAG CAGGAGGTTT    115740
     TAGATTTTGT TGACTTTCTG AAAAGCCGCA CTACCTCAAA TCGCAAAAGC TTAAAGGGAA    115800
     TTTTGCCAGA TCGCGATTTA TCGATTGAAG ATTTTCAAGA GGCAAGGCGA GCAATTTGGG    115860
     CTGTTGAGGC TGTTGAATAA TGGCTGCGGT TGTTGCTGAT ACCCATGCGA TTATCTGGTA    115920
     CTTTTCTGCA TCTAAAAAGC TTTCTGATCT TGCATCCACC GCTTTTGAAG AGGCACTTGC    115980
     TGATGGGCAT TCCGTTTATA TTTCAGCAAT CACGCTCGTG GAAGTTATTT ATCTAGTTGA    116040
     GAAAGGTAAA CTATTGACTT CTGATCTAGA GGCTATTGTT CAGGCTGTGA GTGCTCCTGA    116100
     TCCTACTGTT GTGGTTGTCC CTCTTGATCT GCAGGTTGCT CAGGCTGTGG CTCAAATTCC    116160
     CCGTGAGACG GTACCAGAAT TAGGCGACCG TATTATTGCA GCAACAGCTT TACACTTGGG    116220
     CGTTCCACTG GTGACGTGTG ATTCCAGAAT TCGGGCTTTA ACGATCGTTG AAACCATTTG    116280
     GTGATTGGTG AATGTCTGCC GTACGAGAGG AAGTGGGGGC TGAAATGCTC ACTAAAACTG    116340
     TCCCCCTACT GCTGAGATCT GGAATGACGA TCGAGCAAGT TGCCAAACAA CTGAAGGTTG    116400
     ATATTGAATG ATATTGAAGC AGTTCGTCAA GCGGCTGCAG GAAATTCCTG ACTTCTGTCG    116460
     TACCGAAGGG CTGCTTACAG CATCGTATAT GGCGGCTTGG TTAGTATGAT TAACTCGTGG    116520
     GATTGCCCAC CGTATTGTGA CCGAACTATG ACCCCTGAGC CGAGGAGCAA TGGGAACCGG    116580
     AAGGGGCTGC TTACTATAAT GGTGAGTTAA TCTTACAGCC CCCTAACTGG GAAATCAGTA    116640
     TCGGAGCCTC GCCGGTGATG AATCACCCAG CCAGTAATGC ACCATTGCTA ATCTCATTCA    116700
     GTCGATGACT TTAAGGATTT GGCGGCAGGG CAAACTGCGG CTTCAAAATA GCGCGGCATT    116760
     CCCCATTGGG CGAACGGGTG GGATTATTCA CAAAGGCAAC GCCCACATCT CTGGCGCATT    116820
     GGGAAAACTG CAACACGCCA TGCCCCCCAT TCGGAAATTC CAAAAAAAAG CCATTCTCCA    116880
     ACCCGACCAT GGACGGTCTG CCCATAGCAG TCGTGGTCTG GGTATCGTAG CGGCTCTGGA    116940
     GGACGAGGGT GGGAATCTTA CTTCTAACAG CGGTGCGATC GCTCGCCGGA GCAGGCTGAG    117000
     CGGACCAGTT CTGGCAAATT GCATAGGCTT GCTTCCCAGC ATTGAGGGCT GATTGTCCCA    117060
     ATTCTGGCAG CGTCATTTGT TTAAAGAGTG ATTGAAGGCG GGCAGGATCA CTCCCAGTCA    117120
     CTAAATCCTG GCAGTCGATA CTGCGAAACG CTCCCTGGCT GATGCCCTGC TCCCAGGGAG    117180
     AGGCTTTATC CAAAATACCG AGAATCACCT CATAGGTATG ACGAATTTCA GCCGGAGATA    117240
     GGGTGTTGAG GGATTGGATG AGCGGCTGCC GCAGTGGGGC TGGGAAAATC TCGGCGATGA    117300
     TGGCGGCTAA GGTATTGCGA TCGCGGGGTT GACCCTGCAC AAACCCCACA CCATAAAAAT    117360
     TGCCTCGGGC CAGTACACGA TCGGCTTGTG GTAAGGTCTC AATTGCATTT AGAACTTGCT    117420
     GAACCCACTG CTGGGAAGGA CGTTGACTTT CTGCTAGGGT GATCTTTTCG GTCAACAGTT    117480
     TTCGTGCCTG TGCTCGCAAT TCTTCCGCTT TAGCCAGAAG TCCTTGCGGA TCGCCAAGGG    117540
     GTATGGTTTT CTGGGCAGGA GTCGTAAAGA TCTTGCCAGA AACGACCCCC ACATAGGTCG    117600
     TAGTTACGCC CCGCTCCAAC TCAGACACGA TCAAGGGGAC ATACTGGGCG ATCCGAACCC    117660
     TGGCATCACC ATTTATAGAC TTGAACAATT CTACGATCGC ATCGACATCC ACCTTTCCTG    117720
     AACTAGATTT GACTAATTCG GCATCGGCTT TTGCTAACGG GATGGGTTGT TTTACCAGGC    117780
     GTTTCAGCAC CGAGACCATC CGTTGTTTGA GATTCGGATA AGCACGATTG CATACCGCAT    117840
     CGTTCTGACA GTCTTCGATC AAGTTTAGGG CAGGTGTCTC AAAAATTCCC AGACTCGCTT    117900
     CATACTTCAG GACATTGGGG GGAATCGTAG AATCAAGCAC CACACTCCGA ATTTGCTGGG    117960
     GATAGTCCCG CATCACCCGC AAGGCTAAAT AGGTGCCATA GGAAATCCCG TACAGGTTGA    118020
     TCTGGTCATA GCCCAGTGCG GACGCCAGAC TTATCACATC ACGGGCGTTA TTGGCGGTGT    118080
     TGTACTGGTT GAGATCAAAT CCGTGGGCAG ATAATACGCT GGAACATAGG GTCATCAAGG    118140
     CAAGAGTTTC ACCATCCAGA TCAGCCTCGC CTTTTAGCCG TTTAGCAAGG TTTTCAAACT    118200
     TCTTGCCCCA TGCATTGCCA GGAGCCTTGA TCACGGTTTC CAAAATATTT GCTGTGGGGG    118260
     AGCATAGCAA AGCCCCCGAA TACCTGGAAC CCCGCTGATC AAACAGGATC ACGTCCCGGT    118320
     TCTGGCGCTG TTGACTGTAA AGCATCGTAA AGTACGGGAT TAAAGAGATG TCACTGCCAC    118380
     CGGGCCCTCC ATGCAACGCG ATCAGGGGGT CAGGCTGGGG GGAAAGACTT TTACTTTTTA    118440
     GCAGAGCATA GGTTAACTCG ATTTGCCGCC CGTTGGGTTT GCGATAGTCT TCGGGCAAAG    118500
     TGACAACACC GCAAATAGTC GTTTTGCCGT CAATCTCTTC TGGCGCGATG GGGGTTGGAC    118560
     AGGGAATCTG GGTATTGCGA TAGGAAGGGG CGGACTGGGC TACGGTTGCA GTGGCATGAC    118620
     AAACTGGTTC GATTACCATC ACCATTACCA TCAGTCCCAG TTGGTAAAGT CGTTTGATCA    118680
     TAATGTTCCC TGATTTGAAA AGTTTGGCGA TTGGTTGACG GCTAATTTCA ATCCAATAAG    118740
     GAAATCAGAA TTGCCATTTC ATTTGGACGA TAGACAGCCA GCAGCAAGCC GGACAGAGCG    118800
     GCACCATCTC CACTTCTAAA TTCGGCTTGA CTGGGAGTGC CATACAATGC CATCAAAATT    118860
     GACAGGATCG GGCAAGGTCG CAGTCACCTA CAGGCCGCTG CCATACGAGG TGAAGATTCA    118920
     TAGCCAAAAC ACAACACGGA GAACCCACTG CTAGCGTTAC CAGGTTGCCG TACCGGGCCA    118980
     CTTTTGACAG TGGGTTCACA TTAGTACTCT GCCCAATCCC CGCCGGCAAA AAGAACTGAG    119040
     CCTGCCCAGG ATGTCCTACC GAGTGACCAA TCCCCAAGAC GATTGTAAAA GCCAGAACAA    119100
     ACGTTAAGAG CTGTCTTGAG AAAATGGGCA TCAGGGACCA ATGGGGAGGC ATAAAAGCAA    119160
     AGGAATTTAC AACGCGCCTT CACTGGTATT GCGCTGATTA TCTCGGTAGG GATAGTTGTA    119220
     GAACTCTTTC CCAGTGACAA CGTTGATGAC AACGACTCGT CCTACCTCGC GATCGTACAT    119280
     CACCCGCACC TGTCGATCTT GGGCAATGTA AGTGTTTCCA GAACTGCGGG TGAGAACTCC    119340
     ACGGAAGTTA AATTCTCCAT CAGTAATTTG AACTGCAATT TGATTGTTAC TTTTGGGAGT    119400
     CATGTAGGTA TGCTGAGGCG CAACAGGCTC TTGTCCTTGA ACCATTTGGA AAGGTGAAAT    119460
     TTCAAAGCTG CCAGCTTGGG CAAGAGGACA GAAGCTTGAG CTACCTAAGA GCACAGCGAT    119520
     TGCCAGAAGG GTCATTTGAG GTTTCATATT ATTGTCTTAC TCAATGTTTT GCAGGAAGAA    119580
     TTCAGCGATA GAAGATTTCG TTTATGAACT ACCTTTTATG AACGCCCATC GCTGGGGAAG    119640
     ACAATGAATT GAGGACGAAT CCAGTAGAGC GCACCAGAGT CTAGAAGCTA ATCAGGGCAC    119700
     TCGTTGAATT TATTAGGGAT TGCAGTCCGC ATCAGAAACA TAGATGATCG AGTCGTAACG    119760
     CCCCTGTGAC GTGCGAATTG AAACACAAGC ATTGCTGCCA GATTCACGCC ATAAGCTGTA    119820
     TTTATCAGGA TCGGCTGTGA TCGTCTTGAC AAACTGATAG CCCCGGTTCT CTAAAGTAGC    119880
     TTCTGCCTGT CCCGCTCTGG CTCCCACTAG ATCGGCTAAA ACTGGCACTG GGCTTCCGGG    119940
     TTGTCCAGGG GGGATTGAAG AGGAAGGTGA TGAGGATACC CCAGCCTGAG ATGCACTGAT    120000
     ATCGGGAGAC CAGGCCCAAC CCTTGATCTG GGGATTGTCG CGCTGTTCAA CCTGACACCA    120060
     GGTAGGTGAC CCCGGTTTGC AGCCCAAGTT TCGCAAGATG GTGCCCTTGG GAATGTTATC    120120
     TGCAACTGTT TTGGACAATA AGCCAGGTGA GGCTTTAATA AGGTTTTGGA TGCTGTTACT    120180
     ACCCAAAATT CTGGCCCCCG ACCAGCCGAA TTACTGCTCG CCGAATTCGT CAACTTAACC    120240
     GACAATACGG TGTTGTCGAT CGTGTTAACG CGACATTCTG CGGTTTGCCC TGTTTTCTTA    120300
     TTCTGCATGT TGACGGTAAC TGCGCCACTC TCAGCACTAA CTGGACCGAC ACTCGCAATG    120360
     GCTACATCGA AGACCCCCAC GCCCATTTCT TCCGCTGTGC TTCGAATACA AGCAGTTCTA    120420
     GAACTCTGGG GGATGGCTTT TGCGATGAGT GGATGGCTAA CGATGAGAAA GATCGCGGCA    120480
     ATTGCACTAT TCCTAAAAAC AGTCTTAATC TTCATGATGA ATTAACCCCT CAATAAATTC    120540
     TCAGAACTAA TACTGATCCA ATATTTATTC GCCACCATCG GCAAAAATGA TGAAATCGCT    120600
     CCAAACCCAG CTGTTTGCGT TTGACTTGAC AAACTCTACC TGGCACCAAT TAAAATCACT    120660
     GCCAGCCGTA TCTCGATCCT GAACGCACTT GATCACCTTT ACCTTGTCTC CCGGTAGTCC    120720
     ATAGTGGGGG GAATTGGAGT TAATCGTGAG AGTTGTTTTG CCACTTGAGC AAAGGCAGGG    120780
     GGATCTCAAT GTTGTAGAGC TTAGAGAATC CTCAAAGTAT TTCAACCACT TAGATCAATC    120840
     TCACAAAGGA GTATTGGAAT TGATTTGCAC CTGGGAACCA TCCTTACTGA CTGTCACCAC    120900
     AGTTCGAATA TTTGGGGCTT GTCCAGGAGG TCCTCCTGTA AAAGTGAATG TCCAAGTTCC    120960
     GTTACCATTA TCGACATAGG GAGCCTGATT AGCAGGTCCA TGCATGGAAG GTTCCGCTTG    121020
     ATATTTGCTT AGTCCCCCAT TAGCTTTTTC AGCAGCCTGC CGAGCTAAAT TCTTTGCACG    121080
     ATCGAGGCTT CGACTATTAA TATCAGAATC ACTTGGCGAT TGCGCTTGAG ATACAGAGGT    121140
     AGTCTGTGTC TGGGCTACCA TGGGTAGAGT TATCAAACCT AACGTGATCA TTAGGGATAA    121200
     AAGTAAGAGG GGTTTAGACA TTATGGATAC TTCTATTGAA GTGGACAAAC TACACTTTGC    121260
     ACCAGTTCAA GTCACTGCCA CAAGTATGCG ATCCTTGACA CCCTGAATTA CTTTTACTTT    121320
     GCTACCCGGT AAACCATAGT TTGGGTAACT GGAGTTAATC GTGGGTTGCG ATGCACATTG    121380
     CATGGATCCG AGTCATTGGC TCTCAAAGTG GAAATGATCT GCTCCAGAAT TAGAGATCGA    121440
     ACCTCAAAGG TTTTTGAAAC TTCCGAGGTC CCTATAGACT ATTTACAGCT CGAAGAACCG    121500
     TAAACAATTG AATCGTAGCG TCCGTTAGCG GTACGAATGA TCACACAATA GTTGGTCTTG    121560
     GCTTCCCGCC AGTAACTATA GATGGCATCA CCCGAAGGTT CCGTTCTTAA AAACTGATAA    121620
     CCCCGTTGTT CGATAGTGCT TTCCGCCTGT CCAGCCCTAG CACCGACCAG ATCGCTTAAG    121680
     GGAGCAACAG GGGTGCCTAC CTCCGGGGCG GAACTTGTCG CCGCCATGCC ACTGTTAGCA    121740
     CTTCCTGGAT TTTGTCCATA GGGAGCTGTA TCCCAGTACA CATAGATGGA TTCATTCACG    121800
     AGGCGAAAAA TTTGGCCCTT GTCACCCAAT CCAGATTGTT GATAGGCGGC ACGGCCATTT    121860
     TGATCCCGAT AGTGGTTGGG TTGATTAGCT GGCACCAGGT CATAGCGCTT GCCGTTTTTC    121920
     AATTGAATCC CGATTACTCC CTGTCGTTGT GAAAAGGTAC AAAGACCGGA AGAGGTGGCG    121980
     CGGTCTTCTC CTTTCGGGTA CACATCGCAG CGAGCGGTTA CTGTATCTGC ATAAACTGCA    122040
     ACGGGAATGC CAAGGGAGGC GATTGTAGCG ATCGCCAGTC CAAAATTAAA TTTTGCCAAA    122100
     CCTACCATCT TGTAAACATC CTGAGTCATA CGAGAAATTT AAGCTGTAAA TTGAGTTACG    122160
     AATGCTGAAA CTTTTGTAAA CAGAAGTTAA TTAGCACACG AAAGAAGACA ACACCAAAAC    122220
     TCTCAAGCTA GCCTTGATAC GTAGCTGTAT CGTTAACGGC TTTCTAGAAG AGCCTTCCAT    122280
     CCAGAGACAG CAAGACAGCA AGAGCCAATA TATTCAAGAG TTGTGGGAAA TTTATTTAGT    122340
     CTGGCCAAAT TTTATGAAGC TTTAAGATTT TGCTGTCAGG GTAAAAATGC CTTTTTACAG    122400
     GAGAAGCATT TCTTTGAAAC AGTGAGAATG AGTGATAAAT GAGCGAGTAT TTTCAGCTTT    122460
     CCTGTGGCTT TAAGCGATAA CCTAACCCAT GCTTAGTTTC AATTATTTCT TCTGCACCGA    122520
     CTTGCTTGAG TTTCTGTCGC AATGTCTGAA TGTAAAACCG GATTGTGGCA TCAGCCCGTG    122580
     AATCGTCACC GGCCCAGAGG CGATCAATCA TGTGGGCGGG GCTAAAGACC TGCGTCGGAT    122640
     GTCGAAGCAG CAGTTCTAAC ACGGCATATT CTTTGGAAGT GAGGGGCACA ACCTGTTGTC    122700
     GAAACTTCAC TTCGTAGCTG CTGGGGTCAA GCTGCAACTC ACCCCAGTGC AGGATGGGCG    122760
     ATCGCTGCCC CATTCCCCGA CGCAACAGCG CCCGAATTCT CGCCAGCAGC TCATCTAAAT    122820
     CGACAGGCTT CACCACATGG TCATCGGCTC CCGCATCCAG GCAAAGAACT TTTTGCGCTG    122880
     TGGCTGATTC TCCAGTCAGG ACGAGAATAG GGATTTCTTG ATTTGGTGCA GCATCTGTAA    122940
     CCCGTTCCGA ACCCCTGCGA ATTTTTCTGC AAAGCTCAAG ACCACTGAGT TTGGGTAGAT    123000
     AAAAATCTAA TAAAACCAGG TCATAGGCTT TCACTTGGGC CAGTGCCAAC CCTGCTGCTC    123060
     CATCGTCTGC CCAATCAACC TGATAGAGAT TGCTAGTTAA ACCCTTCATG AGAGCAGTGG    123120
     CTAGATCTGG GTCGTCCTCC ACAAGAAGAA TTTTCATCTG AGGTTACACT CGCCCAAACG    123180
     TTGTTCAGTC CGCCCTTAAT CTACCTCCTA AGATAAAGAT AAACAAGCTG CTCTCTGGCT    123240
     GCTGCCCATG CCCGCGCCCC ATATTCGCCC GCTGGCTCCA ATTCCACTCC GCTGGGTCCT    123300
     GATCGTGCCC TTCATCCTGC AAGCCGTTGG TGTTGTGGCG CTAGTGGGTT ATTTGTCCTA    123360
     CCGTAGTGGA CAGCAAGCGG TTTCTGACCT AGCAGAGCAG TTGATGGTCG AGGTCGGCGA    123420
     TCGCACCACC CTTTACCTTG AAAAAACGCT CGAAGTTCCT CACCTGGTCA ACCAACTCAA    123480
     CGCGAACGCT ATTCGGTTAG GAATGATTCC CGGATTTGAT AGTACCAATA CCGCTTTCCT    123540
     GGAGCAGGTA TTTCTGCAAC AAATCAAGCA ATTCCCAACC ATTAGCACGA TTGCGATCGC    123600
     CAATGAGCGA GGGGGGATGG TAGGCTCAGT CCACAACAAC CCTGGTTTAA GCGTTTATCG    123660
     TACCCAAGGG TTTACCAGGG GCATCTTTTC GATTTCTGAG ATTGATGCAA TGGGTAAGGA    123720
     AGCCCCTGCG CTCGTTATCT CTAAAACTTA CGATGCACGC AAACGGCCCT GGTATCAAAC    123780
     ACCCAAGCAA GCGGGGCAAG CCACCTGGAG CCCAATTTAT CATCTGATGG CGCGTGTTCC    123840
     TCTCCTCAGC GTTTCGGCGG GGCTTCCCTT CTACGACAAG ACGGGAAAAT TTCAGGGGGT    123900
     GCTGGCGACC GATATTATAT TAGACAATCT CAACCAATTT CTGGCAAAAC TGAAAATTGG    123960
     TAAATCTGGA CAGGTCTTTA TTATTGAGCG ATCGGGACTG TTGGTTGCCA GTTCAAAGGC    124020
     GCAGCCCTGG TGGACATTAG ATGCAGACAA ACCGGAGCGA GTCAGGGCAA TAGAAAGCAC    124080
     CAATCCACTC ATCCAAAATG CAATGGCTTA TCTGACGCGA TCGTTGAATC TGGAGAAAAT    124140
     CAATACAGCT CAGCAGCTTG TGATTCGTCA GGAAAATGCG CATCAGTTCG TGCGGGTCAT    124200
     TCCCTTTCGC GATCGACAGG GGTTGGACTG GTTGATTGTG ATTGTGGTGC CCGAGTCCGA    124260
     TTTCATGGCT CAGATTCAGC AAAACACACG GACAACGATT CTACTTTCGT AGTTGGTCAG    124320
     CGCAATAAGA AAGGTTAAAT GGGAATCGCT AAATTGAAGC GGATGGGTTA GGTTGAGCAG    124380
     TATGGAGCCC AGCGATGCCC ACTTAGCAGC CAGGATGGCA GCCCCCGAGT TTGACCCAGA    124440
     AGAGATGGGG GTTCGGTATT GGTATGAGCA GTATTTGCGG CAACGGGCAG AGAATGCGGA    124500
     ATTGCGAAGA CAGTTAACCC AATTAGAGGG GGAAGTAGAA GAGTTAAAAG AAACACTGCG    124560
     GAAGTTGAAG GAACGCGATA GTGGGAATAG CTCACAACCC CCATCGTCAG ATGGATACAA    124620
     ACGTAAAAGC AAAGGGTTGA TGCCCCGTCA ACGCAAGCAA GGACCGAAAT ACGGACATGA    124680
     GGGCAAAACG CGCTATGGAT TTGAGACCGT CGACCATCGC TTGGCGCTTT CCCTAGCGCA    124740
     GTGCCTAGTC TGTGGCAATG CGTTGGAACG AGACGAAACC ACCCCTGTCA AACGGCAGCA    124800
     GATCGCAGAA CTGGTCGAGC GTCCGGTTGA GGTGTGGGAG TATGAACGCC CGGTCTACAC    124860
     CTGTCCCCTT TGTGGCTGGC ACGGTTCTGC TGCCCTGCCG TTGGGCTGTC GAGAGGACTT    124920
     TAGCTATGGC GCACGGTTGA GTAGTTTGGT CGGTTGGCTG GGCTACGGCG GACATTTGAG    124980
     TTGGGCAAAG CAACGGGATT TGATTGCGAT CATTTTTGGG ATTCCCTTGT CGCAAGGTAG    125040
     TCTTGCCAAG ATGCATCGCT GGTTCTGCGA AAGTTTATAT CCGAGTTATG AGTCCTGGTG    125100
     GAGCCTGATT CAGCAGCCTG GAGTGCGCTG TGTAGACGAG ACGAGCTATC CCATCGATGG    125160
     AGTCAACTAT TGGATGTGGG TGGCGACTTC GAGGGAAGTT TGTGTTTTGT TTCTCGCTCC    125220
     GAGTCGGAGT TCTGCCGAGG TGGAATCCTT GTTAGGTAAA AGTTTTGAGG GTATTCTCAG    125280
     CAGTGATTGT TGGTCTGCCT ATAGTCCCCA GCAAGCCACG GCGAAACAGA AATGTTTGGC    125340
     GCATATTCAA CGAGAACTCG AAGCCCTTAG CGGTTCACGC TTTGAGTCGA ATCGGCAGTT    125400
     CGCAAGCCAA GTCAGTGCTA TCTTCGAGCG GGCGCGGCAA GCCTATCGAG GCTATCATGC    125460
     GGGCAACTTA ACCGTAGAAC AACTCCAGAC CCAACGACTG ATTTTGGAAG CGGAGCTCAC    125520
     AGACGTGCTC GACCACCCGC CGAAAACTGG GTGGGCAGCA GATGCCCAAG CTTTGGCAAA    125580
     TCGCTTCCAC CGCTATTGGT CGGATTGGTT CACCTTCCTG AGGATGCCAG AGGTCAAACC    125640
     TGACAATAAC GATGCCGAAC GTGCCCTGCG TCCAGTAGTG ATTCATCGTA AGACCAGTGG    125700
     TGGTGCTAGA AGTGCTTGGG GCGGACAGTT AGTGTCACTG ATGTTCAGTT TTCTGGAAAC    125760
     GATGCGACTG CAAGGCCAGA ATGCGGTGGC TGAACTATTT AATCTACTGG CAGGGGTTGA    125820
     GCGTGCTCCC CCTCAATTGC TGCCATCCAC TGCTGAATAA AAGCTGAGGT CGGGCTTTTG    125880
     GGCTTTCTCA ATTAGCCATG CTTCTTGCTG TGACTAATTA CCTACTTTCT TTATTGGCAT    125940
     TAGCAGGGGC GATCGCATTT GGAATTTTCA TCTCAAATCG GGTCAATGCT CGCATTAGCC    126000
     AACTGAATCA GGCCAATCGA GAGCTGGCAA GAGGGAATTT AGCGCACTAC ATCACACAGC    126060
     CGTTGCCAAC TGATAGCTCG ATCGCAGAAG TGCAGGGATT AACCGAATCC TTCAACCAAA    126120
     TGGCAGAGCA ATTGCAACAA TTTTTTCAGA CGAAGGTTGA AGCAGAAGCT AATCGACAAA    126180
     GTGAAGCCCG GTTTCAGCAG TTAGCGGCAG CTGTCCCCGG CATGATTTAC ACCTTAACTC    126240
     AGTCCCCTGA TGGTTCCCAG AAGTTTGAGT ATGTTAGCTC GGCAAGCCGC ACGATTCTCG    126300
     AACTGGAATC CGAACAAGCT CTTGAAGATA TTAACAGCGT GATCGAGCAA ATTCATCCCG    126360
     ACGATCGATC AACTTACGAT GAAGTCTCCG CTCAAAGTGT TTCCCTGATG GAACCCTTCT    126420
     CCCTGTCCTT CCGGACTATC ACACCATCAG GCCAGCTCAA ATGGGTGGAG GCAAGTTCTC    126480
     GTCCCTTACT GAATACAAAT GGTAGTATTA CCTGGTATGG AATTTTGTTG GATGTGAGCG    126540
     ATCGTAAACG AGCAGAAATT GCACTCCGAC AATATGAGCG AATTGTTGCC AATACCACGG    126600
     ATGGTATCAT CCTGATCGAT ACCCAATTCC GTTATCAAAT TGCGAACCAG ACCTATTTAC    126660
     TTTGGTATAA CAAATCCATC TTTGAAATCA TTGGATTTCC AGTGAGCAAG ATTATCGGCC    126720
     AGGATGTATT TGAAACCAAC TTTCGCCCTT ATCTGGTTCG TTGTCTGGCA GGCGAAACGA    126780
     TTGAATCCAG AGAGTGGTTT GAGATCCCGA CACTAGGACG GCAATTCTTT AGTGTGACTT    126840
     ACTCGCCCTA CTTGGATGAA AATTTGGCGA TCGCAGGAAT TGTCGCCAGT TTGCGAAATA    126900
     TTACCTCCCT CAAGCTAGCA GAACAAGAAT TAGAAAAGGC AAAAGAAGAA GCTGAAAAAG    126960
     CAAGTCAAGC CAAAAGCCTT TTTCTAGCAA ACATGAGCCA CGAACTCCGC ACACCGTTAA    127020
     ACGTAATTTT GATCATGACT CAGATGATGA ACCGTACCGC TAATAAAATC CCAGAGTATC    127080
     AAGAATATAT TGATCTGATT TCACGCAACA GTGATCATCT GCTCAAAATG ATTAATGATG    127140
     TCCTGGATTT ATTCAAAGTT GAAGCTGAAA AAGCCTCTTT AGAAAACAGC GAAACGAATC    127200
     TTTTTGAGCT ATTACAGTCA ATCTATGTAA CTTTCAAACA ACAATGTACT GATAAGCATA    127260
     TACAAATAAA TCTGGAAATT GATGAAAAAG TGCCCCGATT GATTCTGGTA GACGTACAAA    127320
     AACTACAGCA AGTGTTGATT AATCTCATTG GAAATGCTGT CAAGTTTACA GAACATGGGG    127380
     AAATTACAGT ACGTGTCACC GTTGAATTGA CGCAAGATAA AACGAAATGG CAGGATGCTT    127440
     CTATTCCTTT AGCTTTTACG GTCGAAGATA CAGGAGTTGG AATTGCGCCG GAGGAGATGA    127500
     ATCAAATTTT TGATGCCTTT GCCCAGGCAG CAGCAGGAAG GCAAATGACA GGCGGGACTG    127560
     GGTTGGGATT GAGTATTAGC CAGGGACTGG TCCAGCTCAT GGGTGGAGAA ATTACTGTTA    127620
     AAAGCACCCT GGGAGTTGGA AGTACATTTC ATTTTGTGCT ACCCGTTCAA CCTGTGGCGG    127680
     AAGCGATTAC CCAATCTTCT TTGAGTCAAA GTGTGTTAAG TCTGGCTCCG GGCCAACCGG    127740
     CCTACCGCAT TCTCGTTGTC GATGACCAGG AAGCGAATCG AATGCCACTG ATACGGCTAC    127800
     TATCCCAAAT CGGATTTGAG GTAGAAGAAG CGGTCGCGGG AGAGGAGGCG ATCTCCCTCT    127860
     GGCAAAAGTG GCATCCTCAC CTGATTTTGA TGGACTTGCG AATGCCGGGA TTGAGTGGTT    127920
     GGGATGCAAC AAAACGCATC CGGGCAGAAG AAATGGATGA ACGTATACGA CAGGTCAAAC    127980
     GAGAAGCAAT GGGAAATACT TCAAACGCAT GTCCAACCTG GCCGGTTGTG ATTGTGGCAG    128040
     TGACGGCTCA AGCGTTGGAG GGCGATCGCA AACTTGCACT GGCAGCAGGC TGTGATGACT    128100
     ACATTAGTAA ACCGATTTCT CTAGACATTT TATTGAAGAA AATCGCCCAG AACCTGAACC    128160
     TCACTTACAG TGGATTCGGA GTTTATGAGG CACAATAGCA GCGATGTGTA AACCAACTTC    128220
     TGAGATGTCC AGGATTCATC GAAGTCTCCG AGAAACCTCA CCCTCTTCAG GATAGGGAGA    128280
     GACAGAAGCG TTGATTGAGC GCAGCTCGAT ACCACCGAAA TCACTACTCA AGCTTTACAA    128340
     TTTTTTGAAC ATCTTAGTTT ACTATGCCAG AGAATGCTTG CTGACGGGGT GACAAACAGG    128400
     TTGAAAACTA GATAGAGCAA GGGTTAGAGC AAAGTGTGAT AAAAAAAGAT AGGTCAAGTT    128460
     TTGTCAACAA GACCCATCTA ATGAAAATGT TACCTCAATT CTACCAAACC CATCTCCAAC    128520
     GTCAATTGAT TCCTACGGAT TACTTACTCT TAGCCTGCTT GATTGGACTT TTGCAAAAGA    128580
     TAAAGCATGT GCGCCTAGAA AGCCTGGCGA CCGCTTTACA ACTGCCGATT TTATTTCAAA    128640
     GTCGTCGTCG CAAACTGCAA CGCTTTCTCG TGTTACCTCA CCTTAGTTTT AAGACTTTAT    128700
     GGTTTCCCAT TCTATTCGCA TGGGTACAAC AAAATTACAC CCGACAGGAG TGGTTGTACC    128760
     TGAGTATAGA CCGCACAAGT TGGGGGAACA TCAATCTCTT GATGATAAGT TTGATTGTGA    128820
     ATAAACGAGC GATTCCAATT TACGGACAAC TGTTAGAGAA AGCTGGAAGT AGCAATTTGG    128880
     TGGAGCAACA ACGGGTCATT TCACCTGTTC TAGAGCTGTT AAAGGACTAT CGTGTGATGG    128940
     TGTTGGGTGA CCGCGAATTT TGTTCAGTAA AGCTGGGAAA CTGGCTGAGA GAGCAGCGGA    129000
     CGAACTATTG TTTGCGATTG AAATGAGATG AATATGTTGA GCGAGAGCAG GGGCTTTGGG    129060
     TTGAACTGCA ACAGTTAGGA TTAAAACCGG GTCACCGTCT GTTTCTTGAG GGAGTAAGAG    129120
     TGACGAAGTT AAAAGGTGCA AAACCGTTTA ATGTGGCGGC AAAATGGCAG CGAACCTATC    129180
     GCACTCAAGG GGCAGCAGAA GGATGGTTTA TTCTGACAAA CTTGACGACG GTTGAGCAGA    129240
     GTGCATCCCA CTTTTGCAGT AGACCTGTTG GGAAATAAGG GATAATCAGT AGCAGTTGCA    129300
     AGGTGCTCGA CCCATGCTGA GTCTAGACCG TATTCTCAAC AACGAGAGTT ATTGTCAAAT    129360
     CTGGTGTATG AAGAAGAATT AAGCGGCGTT CCTACTGTCC TTGAAATCGA GTTGCTGGTC    129420
     TGCTCGAAGG CCATCCTTGA ATTTCACTCC TTCAATTACC TCTGCTAAAT GTTTGAAGCC    129480
     TCGAATGCGT AACCACCGTT TCTGGGCACT TTGTACCAGT TTGAACACCA AGGACAAAAT    129540
     GCTCTCCTGT GAAACACAGC CTCGCGTTTT ATCCGTCCTT AAGCGCACCG TCGCAAAGGT    129600
     GGATTCAATG GGATTGGTGG TGCGAAGGTG CACCCAATGT TCAGCCGGAA AATCATAAAA    129660
     GGCTAACAAG GCTTCACGGT CTTTGGATAA ACACGCCACC GCCTTGGGGT ATTTGGCATC    129720
     ATAGGTCTTG ATAAATCGGT CAAACGCTGT CTGTGCTTCA GCTTGAGTCT CTGCCATGTA    129780
     GATCTCATGC AGGGCTGATT TGGCTTTGGG TTGCTGACCC TTGGGCAAGT GGTTGAGGAC    129840
     GTTAGCAGTT TTGTGCACCC AGCAGCGTTG GACACGAGTG GTCGGGAACA CTTGCGCGAG    129900
     CGCCTTCCAA AACCCTAAGG CGCCATCTCC AACCGCCAGT TCGGGGGACT GTTTGAGCCC    129960
     CTGGTCTTGC AGACGTAACA ACAACGGCTT CCAACTCAGT TCGGACTCTC GAAATCCGGC    130020
     TTCCAATCCC AGCAGTTCCT TGCTGCCTGT GTTGGTGACA CCGATGACAA CAAGGATGCA    130080
     TTGGCGGTCG TCCTCGTTGC GGATGTTGAA GTAGATCCCA TCCGCCCACA GATACACGTA    130140
     CCGTTTCCCC AGTAGTGATC GTTGTTGCCA TTGCTGGTGC TCTTTGATCC ATTTGGCTTT    130200
     CAGGCGGCTG ATGGTGCTGG CCGAAAGTCC TGCCGCTTGG GCTCCCAGCA AGGATGCCAA    130260
     GGCTTCGGAA AAATCCCCGG TTGAAATGCC CTTGAGATAC AGCCAGGGCA GCACCTCCTC    130320
     CACACTCTGG ACCCGTTTGA GGTACGGAGG TAACAGCGTC GAATTGAACT TGATCCCCCT    130380
     ACCACTGCGG TCGCGCACCT TAGGCACTTG AATGGCAACC TCCCCCACGC CAGTCACAAT    130440
     CGTGCGTTCA GGCAGATACC CATTGCGCAC CACCGCTTGG CGTCCCTGGT CATCTTGAAG    130500
     CGATTCGTAC TGAGCTAAAA ACCCCTGCAA TTCCGCCTCC ACAGCTTGAG CAATGATTTG    130560
     GCGAGCACCG TTACGGACCA GTTCTGTCAG GGCATCACTA AACGATGCGG GAGGGTCTGG    130620
     CGCTTGAAAT GCAATAAGAT TGTCGTTACT CATGGGGTAT CCTCGTCTGG TTTTTACTTT    130680
     TGCTTATCCA GCAGGATACG CCCTTTCCTC TCCTTTGCTC ATACACCACA AATAAACATA    130740
     GCTCTCGTTT TGTTTTACCC CCTTTTTGCG TGTCTCCCTT TGTATCTTGA GGGGAGAGTG    130800
     GTAGACCGTG ATCCCGCTCT GACCAGTGGA TCTTGCCCTG GCTGACCAGG TTGGATCTGG    130860
     TGTCATAGGT TAAACCTATT ACTCTTACCA GTTCATCCCG GCTGAGCCGC TAAGTGATCT    130920
     GGAGTGCTTC GAGGATGCGA TCTCGGGAGG TCTGTGCCGT GGCAATTCTG CGGTTGTTAA    130980
     ATTTGAGTTG CATAAAGCGG TAAAGCGAGG GATTAAATCG CTTCTTAATC ACCAAGCTCA    131040
     GCAATTGTTA ACCGGACAGT TTACCCAACA GTTCGGGGAG CTTTTCCCTC TAGACTTTCT    131100
     CAAGATATAC TAGAATCATC ATATCATCCG TGATATGTTG CATCTGTGCG ATTGGTTCTT    131160
     GATACTGATG TGATCATTGC TGCACTGCGA AGTCCTGGAG GTGCTTCTGC TGCACTACTT    131220
     CAGGGGGTTC GACTCGGTAG GGCAATTGCT TTACTAAGTG TGCCAATGGC ACTTGAGTAC    131280
     GAAGCTAAAT GCACCCAAGC TCAGCACTAC AGTGCTGCCG GGCTTAGCGA CTGGGAAGCA    131340
     GTAGAGTTTG TGACGGCGGT TATTGCTTTA GCTGAGCCTG TCAAAATTCA CTACTTGTGG    131400
     AGGCCAAGAC TGAAAGATCC AAATGATGAG ATGGTTTTAG AAGTTGCGGT CAATGGAAGT    131460
     GCTGACGCGA TCGTCACGTT CAACCAGAAG GATTATGGAG CAATTCCGGG TGAGTTTGGT    131520
     GTAGATGTCC TGTTGCCGCG TGAAGTGATA AGAAGGATTT AACGATGGAT AAAAACGATG    131580
     CAGCCCCCTA CGCTCTACGG CTACCGCGTT CTTTGAAGGC AGAGGTAGAA AACCTGTCAG    131640
     GGCAGGATGG CATTAGTATG AATCAATTTA TTGTAATGGC GGTAGCTGAA AAAGTTTCTG    131700
     CCCTGGAAAT AGAAAAGTTC TTTGAACAGC GACGCAATAG AGCCAATTTT TCTGTCTTAG    131760
     ATCGCCTTTT GACTCGTGCT GGTGGTGAAC CCCCCAGGGA GGGCGATGAA CTAGACGAAG    131820
     CTCCCACCTG GCTGAAACCA CCGATTGAAT CATAAAAAAA GCTTGCTAGC GAAGAACCAA    131880
     CAGGCCGAGA TGAGTAGGAC GGTAAAAACT GTTGAGGAGT AAAGCTTAAC GAGGAGCAAC    131940
     AGCAGCGGTC GCAGGGGCTT GAATCGTAGC GGTAATCCAG TTAGCACTCT GGGTAACAAC    132000
     TCTGGCTCTT AGCCCTGGGA CGGGCATTGT ATCAGCAATC AGACCAACAA TGGCGAAACT    132060
     TAGGATTAGG GCGGGCACGT TGATCTGAGT GGCTTTCATG GCTGTTTCTA GGGTCAACTC    132120
     ATCTCATGTC CCTACTATCG GTTTGCCGAG CTTGCCCGCG TATATAGTTT TAAGAAATCG    132180
     TAGCAAAGAA ATGTTTCGGC GTGTTCATCA GCTTCGAGTA TCTGATATAT ATTTCTTCTG    132240
     GTGCTATATA GTAGAGATTG AAAGATGGCT GGTGCTAAAC CGTTTCTTGT TTTGCTACTT    132300
     ATCATCATGG CTTTATCAAA ATTTATGATT GGCTGTGGTC AATCCTCTGG TGATGCTTAT    132360
     CAGCAATGTC TAAATGAAGC TAAAAACGAG GATGAAAAGC TCCAATCCCG GGAAAAGCTC    132420
     TTGTAATTCT CTAATCCTAA TCCTCTATTA AAAAATATCC TAGTAGTACC CTACAAACAA    132480
     AAGAGGTGAT TGGTTCTGAT GTCAATCACC CCTAAAAATC AACTTTACTC ACTCTCACAC    132540
     GAATGCGGCT ACCCCACCTT CAGTGGATAA ATCTTTTAGG CATAGCGCTT GATATAGCAG    132600
     GACTTCCCAT CCCATTCATG GCGTTGCTCC GCAATCTTAG CTTCAAAGTG GTTTCCAAAA    132660
     GTTCCTACTT TGTAGTAAGG CTTGTTAGAA AATGTACGGC AGAAAACAAT GTAGTAATCA    132720
     TCACGGCTGC CTGCAGAAGC TTGAAGCGGG GTTAGTGTAG GCAAGACCAA AGCTGAGAAG    132780
     AAAAGTAGAC CCGCGACAAC TTTCTTATTC ATTGAAGTGA CTCCTTAAAC CTTGATACTA    132840
     AGTAATGTCG CATTTCGATC GAGAACATGA TGTAATCAAA ATCGCTTGAT GCTGTGATCT    132900
     TGCTGACTTT TAATTATGCT TAACTAATAA AATCGTGATG ATCTAGATCA ACTCAACCCT    132960
     CAATCCAAGC AATTCCCTAG GGTAACCAGG CTAGTGGGAT TATTAGCCAC CCAGTCAACG    133020
     CTGTCCTAAT GGGAAAAAAC GTTAGAGGGT ATGAAGCTTG ATGATATTCT CGAGATTGAA    133080
     ATTTAGACTG CGGACGGGAT TCAACGGGTG AACTTCATTT GCACTCTCGC GTTTAAATCG    133140
     CCAAAGTATT CCCGGCTCCA AAGAAAAGCT TATCCAGAAC GCTTTTTAGG GATTGTCCTG    133200
     AAATTGTTAA GGGGAGGCGT CGCGAAGGCT ACCCCACCCG ACAAAAGGAT GGTTCACATC    133260
     GGGACCTGAT CGATCGGGGA TTCACGATCG CTGCTGCCTG TGGGTACAAG CCTGCCTGGG    133320
     TGGCATTTCG GGTGTTAGAC TTACCAGACC AACCCTTATC AGACTTGCGA TATGTGGCAT    133380
     CCAAGCTTGG ATATAGTTCC GGTTGGGCAT TCTATAAGTG GAACGAGCAT AATTCAGTGA    133440
     CAGCCTGAAT AGAAAGCATA GTTGCTTATC AACCCAGGTT CTTACTTCTG TATCTCATTT    133500
     TTTTGAGAGA ATCATGATGG TAGAACGACG AAAAGCTCTT TATATCCTCT TAGGTATACT    133560
     TCCCTGGGCA GTTTGGGCAG GCATGATCAT TGTGTTAAAA GCTCTCGTCC GAACCTCAAG    133620
     GGATCCGAGT CTCTACACAG GTACCTGCTA CAAGCTTAAT GGTCTCGCTG TCCAATGCAG    133680
     TCTGGATCAG TGGCTCCTAT GGGATGCAAC GCCGGCGCTT GATATCTTTA CCTTCATTGG    133740
     TGCTATTGTG GCTGCTGCGC TGTCCGGCTA TGTATTCATT CGATCTAAGC GGATAGGTTT    133800
     GCGCAATCCT TAATTTCCGT GCTGCACCCC CTGTTCCCAA CGATCGATTG TCGGTAAACA    133860
     GTTTCCCCAG TTGCCCTGGC TCGCATTGCC AGTTGTACGT TCTGTTCATC CACCCAGCTA    133920
     TCCTCGATCG GGAGAACCAC AGTTGCTCCG TCTGGAATGT CGCCGAGCGC TACGATTTTG    133980
     CCTACCAGGA TAAAAAACTT TAGACCGAAA CGAAACGAGC TACTCCCTGC AGTGCGTTGC    134040
     TGACCTATTC ACGAGCTGCC ACTCTACAGA CCCGGTCAAA ATGACTAAGG TATGGCTTCC    134100
     TGTCTATACT GCCTATTGGC ACAAATTAAT TCACACCAGT AAAACCTGAT GGGAGGTTGA    134160
     GAGAAAGTCC TTCGGCATTG GCACATCCAT ACCGACACTT TGGCTACAGG ATTACCAATT    134220
     TGCGTCTTAC CCTTTCGGAG CAAGTTGCCT TTTGGGGACT TTTAATACGC TAGCGGGGGG    134280
     TTGCAGCGTA ATAGAGGTAC TGTAGGACTA TGTTTCTGCC CAGACAGTAA CGATCGTCAA    134340
     CGCTATTAAG TGTTCTTGAT CACTTGTAGC GGGTAGCCAG TCAACTAAAA TTAGAACGCT    134400
     TATACTTATA ACAGAGAATA ATACTCCGAA TCATGGGGGT AATCCTTCGG AGCTTTCTTA    134460
     CACGTCATTT CTAGATAACA GATGCGCTAA GCTTCGCGGA TTATTAGTTT TGTGTAGTGG    134520
     TATTAGTTGT GATCGGGCGG GCTGGACAGT AGGGACCGGA AGGACGTCCA TCATTAGGGC    134580
     AACAAAAGCC TTGGGGAGAG TCTGGATGGC ATTTAGTACC TTTGATCACA ACCTGTGCTT    134640
     CAGCGGGGGA GAGGGAGACA CAGACGGTAC CGATGGCGAA AGCAAGAGCT AAGACTTTCA    134700
     TGAATGTTTT CTCCGTTAGA TCGAATGTCT TGATGTCCTT AGTATCGAAA GTTCAGATTC    134760
     TGGAGAAAGT GATTCCTTCG CGGGGCAGAC GTGATTTTCC CTGCTCAACG CTGTGACTTG    134820
     TAGCAAGATG GGGTAAAGTC TCAATCTGGC TGGGACTAAA GACCCGTACA CGGCTGCTTG    134880
     CAGCATTGGG AGGGAACGAT CGAAATCAAT AGAAAAAAAT TATGTACTTA TACTTTACGC    134940
     ATGTAGTAAA GGCCTTCAAA CTCAGCCTTA GTTAACTCAA TCTCCCCATT TTTTACACGG    135000
     AATTTAAGTT CTTCCCACAA ACCATCATCT TCAATTTCAA AAGACGTTGA TGTTTTCTTA    135060
     CTCTTGATGC ATATAGTGTG GTTAGAATAA CTAATTCTAA AGAAATTTGA AGACTCTACA    135120
     GTACTTTTTA CACTTTGTAC AGGTGGTTTA AAGAATTGAA AAACCCAAGG AATTTGCTCG    135180
     AAAAAATTTT TAAGACCTTT GAGCTTATTC AGAAGTAGCT CCAATTCATG TTTAACTTTT    135240
     GGATTATTTG AAGTAATTTC TCTCAAGTGC TGCATATAAG CATTAAACTT CTCTTCTAGA    135300
     GCATCAGCAC CCTTATCAAA AGCTTTTGAA GTATCGTTCC AATAGTCATC ATTACCCTTA    135360
     AGATACTGAT TTAAAACCCG CTGCTCTTGA AAGTGACTAA TAATTTTTTT GGCTAAGCGG    135420
     CTCTGCCAAG ACTCACCAAA AAGTGCCCAC CCTATAAAAG CCGCTATAGC TACTATACCA    135480
     ACCGCCAAGG CAATAGGTCC TCCGATTGCA GCAACAAAGG CAACAGCATT CGCAACGCCA    135540
     CCAACGCCAA TCCCCAAAGC AGCAAGTAGG CTAACCCCTT TGGCAACCAG AATATAAGCA    135600
     CCAAGATTAC CTAATGCAGA TGCCCAAACT GCCAAAGCAC CAACACCACC TAAACCAACG    135660
     AGCCCTCCTA AAAAGGCCCC TTTAGGATCA AATGGAATAT GTACAGAACC TGCATTTAAC    135720
     CTAGGTAGTT TAAGTAATGC CTCTTCATAT AATTCCAAAA ACTCGTCAAT ATCCTTTTTA    135780
     AGTATTTCTG AGTTTTCCTT AATAACAACT TCTAGTTTTG TTTGAAGTTT TTCAACTACG    135840
     TAGCCCACAG CGTATTCTTG AGCCTCTTTC TTATTGTCGT AACGCTTACG AATCATCTCC    135900
     TCCAAGGTAG ATGCAATAAG TAAATCATTA AAAAAACTTT GAAAGGAAGC CTTAGATTTT    135960
     GATTGCAACT CGCTGATGCA TTGATGAATC TTCTTACGAC CTAATTTGAT TTTAGATTGA    136020
     AAATTTGGCT GCTCTTTCTC AAGTTGCTGA AGCTCTTGCC GTCGTTGCTC AATTTCTGCA    136080
     ATTGTCTGTT GATAAGCAAG AATTTGATTT GATATATTTT TGGGAACTTT ATACTTAAAC    136140
     TCAGAAATTT CGCATTCGAT ATTATGCCGT GTAACTTTAG GAAAATGCTC GTCTAGAATC    136200
     ACAGTCAGAT CTTCCCTAAG TTTCTTACAC CGATTAGGAA GTTCAGACCA AAATGTAAAA    136260
     AATCGATCGC TCACTTCCTC AAGCGTTATA GGCTTACCAA TTCTCTGACC ACGCTCAGAG    136320
     AAAACAAATT CATTTAGTTC TTTATAGAAT CTTTTTGGGC CGACTTTCAT AATTTGCTCA    136380
     AGCTGCGAAT CATTAATGCT AGGAGAAGCA TGGGTGGCCA CAATAAAAAG ATTGCCTAAT    136440
     TTAGGAAAAT CTGTCTTGGC AATTTCAGGA GTAGGCAGTA CCTTTAGAAG ATAGCTTAAA    136500
     CGTTGAATAT CTTCGGCATT TATAAAGTTA TTTGCCGGAG AAGTATATAA AACTAGATCT    136560
     GCAATCTGGG CCGCACTATT AGCTTTTTTA ACATCTCCAG AAAATTCATC AGACTTATCT    136620
     GAATAGCCAG GAAAATCCAC AACGTTACAA GCCTTCAGAA GGGGAGAATC AATATAAACA    136680
     ACTGCTGAAT GGCCGTCTAT TTCATCCTCA CTTAAGTGAT CATGCAAACC GTGTTCACGC    136740
     AAAACTTCTA GAGAACCCGA ATTTATGCAA TAGTCTTCAT ATCGTTCTTG GGAATCTAAG    136800
     GTAGTTAGAT CAAAGATAAA ATTTCCTTTT TCATCTTTGG GCCAAAATTC TTCATCTAGA    136860
     ATGCAAACTT GCTCACTCAA CCATGTTGGA CGATCGTCAA TATGACGCAC AAATGTAATA    136920
     ACTCTTGTAG CAGGTTGATA CTGAGATGGC AAACATTTAA CTCCCATCAA AGCATTAGCA    136980
     AGGTGTGATT TTCCTGAATC AAATCGGCCT ACCAATACTA AATTGGGCTT TTGCCGGTAA    137040
     CGCTTAATTT GAAGTCTTAG ATTATCTGGT GTTGGCAATT GGTCTGGGGT TAAATGACTC    137100
     TTTGCAGTAT CTAGTTCGCT AAAGTGAGCC GCAGAAATAT ATTGCTCTAA TAGATTTAAG    137160
     TCATGCCTTA ATTTTGCATA AGGATCACCA ACTTCTAGCG GTGTCAAAGA GGGTAAAGCA    137220
     TTGGCTAAAA GAGTCGGTAT ATCCGTACCA AGAGCTTGCG CCCATCTAAT TAGCAACTCA    137280
     GTTGAAATTG TCCCAGGGTC CTGCTCGTAA CGGCTGACTT GAGCTTGGGA CAATCCCAGC    137340
     ATGGCTGCAA TTTGAGATTG GGTTAAGCCT GCTCTTTCTC GAACACCACG CAGATCTATG    137400
     TTCATCGGGA AGCTTTATAA ATTACCATTT GTGAGCATGA TACAGGCTTT CAAAGCAAAA    137460
     CGCAAGGGAA TGATATACGT AATATGCATA AAGGAATTTA TCTCCAATTC GAGATAAATC    137520
     TTTAATTTTT GTTAAGCTTT AAAATCTCGT AGCCCTGCCA AACTGTAAGG CGAACCGTTC    137580
     ACCATACTGC CAGGCTCTAA TATTTCTTCG CTAGAAAAAA CTGTAGTGCC GTTGTCATAC    137640
     TTCACCACCG GACACATCCC TCTACTCTGG TGCTGCTGAA ACCGAACGAT TACACTCCGT    137700
     TGCTCCGTAG GCGAAGCCAC TACTTTGGAG TATCGCGTCC CCTTCAGCTC CACTACTCGA    137760
     TCAGCTTGCC GTCCCGAAGG GAATTGCCCA CAACGAATAC CTTATGCTTA CAGGAAACTC    137820
     AGGTGGTGGT ATTTTGTAAA GGATGTGGAA TAATCAGGTT ATCCAGAAGG CTAGGTGGCA    137880
     AAGTTTCGGC AAAGCCAAGC GGTTTTTCTC TGTCCTTTAC AAAAGAGTAC TACCCAAGGA    137940
     TGGTGACCAC CCAGGAGGGT TTCGATGGCA TATTCACCAA CAGTTTCTAC GGCAGTTTGC    138000
     AAGGGATTGA GCTGCCACCC CTGGTCAAGT AGCCAGTCGA GCGCCCATTG GTTAGGGCTA    138060
     CACCATTGAT GATCTCTGCA AGGTAAGAAT AGAACACTGT CCTCTCCAGC AATGGCATTG    138120
     ATATAAACTC AATCAGCGAT GCTGGGCAAA AAATATCCAT ACACCAGGAT GGCTCTTGGA    138180
     TCGCTCTCAA GTTGGCTGGC TTTCCAGAGG ATCTCGCTTG GGTCCAACCC ATGGGACTGA    138240
     TACAATTCGG TCTGGTAAAC AGTGAGGAGT TCAGCCAGTT GCTGCAGGTG ATCGCTACCC    138300
     GTTGCTCTGA GCTGCTCCGG GGAAATGCCA CTGCTGAGGA CGGCGATGAG TGCAGGTGTC    138360
     CAGGCACGAG CTGTGCCAGC AATATCAACG GGAGATAGAA TTTGTTTGAC TGCCACCTGG    138420
     AGGGTGTGCT GAATCGTTAA TAAGGGCGCT GTATGCCAAC CGTGGCGGGA TAACTGGGAC    138480
     TGAGCTAAGC GCTTCAGCAT ACAGCGCTCT ACTCCCAAGG TGATAGCGAC CGGACGAGTT    138540
     GGGGTGATGA CCTGAAAACT CTGGGTCTGG AGCAGGTTCT TTGCCCGTTG GTAGGGGTGC    138600
     AGGTCGGTAT AAATTTTCGC TGCATAGGTG TGGATTGATG TCTTGCAGAA CCTCTGGTGC    138660
     ATTGCAGGGC AATGCAAGGA GAAATTCAGC CAGTCCTATT ACCAGAGATT TGATTAAAGA    138720
     AAGCTAACAA CTTCCGCTTC AAATCCGAAT TCCTTTTAGA CTGTTTTTAT ATAAAAACGC    138780
     TGGAGTTGCA CCCTTATATG TGCTTTAGCT TCAGGTATCG TTGTGCTTTA AAGTTAGGGG    138840
     CTCAGATCAA TTGCTTAATT CCAGAAGTTC AACGATCGTC CCTTTGGTGG CACTCTAAAC    138900
     CAACCTGATA AATCTTAGGT ACTGTGGCTT CATCTTTTAG CTGGCTGGAC TATTCTGAAC    138960
     AGGACAAGCG CAAAATGCTG GATGTCATTA GCTTGTTCAA CGAAAAGGAC ACCCGCGACG    139020
     AACTGGGAAT TGGTTCCATT CGGGATGCTT TTGCCGATCA ATTGTTTCCT GGTACCAGTA    139080
     CAATCCAGAC CCGAGCCCGC TATTTCCTCT TCATTCCCTG GATCTACCAG GAGCTGGAAA    139140
     GGCGCAAAAC GCCTTCTAAT CAGATGGATG CCCGATTGCG GCAATGGGAA GTCCAACTCA    139200
     TCTATACCCT CATCGACGCT AGAGAAACTG GGGTGATTGG CGCTCAAGCA CGAGAGAGGC    139260
     TAAAGCGGCT TCCCAGTAAT ATTTACTGGT ATGGATTGGG AGCCTGGGGT ATCCGTTACT    139320
     TTCCCGGTTC TCAGGATGAA TACCACCGCT CTCTGGATAC CTTCTACCCA AGCAGCCGTA    139380
     AACAGCGAAA TGATGATGGT GAACCGGTTG ATGGCAGGCT TACCTGCAAC TGGCATCCGA    139440
     GTCTGCCCGC TGCTCCCGCT AATTTCCCCG GTGTTGCCAA CTTTACGCTC ACTCGTTCCG    139500
     AAGCAGAGTA TCTGGCTGAA CGAATTATTA CCCGGCATCC CAACAGCCTG CTGGCCTTCT    139560
     TAGTTAATGA GCGTGAATCT ACTGCTGTTG TTAGGTTTGC CTGGGAACAT CCCTTATGGG    139620
     AGCAGTTTCC ATCTCACCTA CAAAAGCAGT TAAGCCATGC GCGCAACTTC TCTGAAACCC    139680
     TTCAGGGAGC CGCGCTGCTC TATAATCTGA TGCTTGCAGA AGAAAAAAAG GCACAGGACT    139740
     GGATAGAAGA TTATCGCGAG GAACTTCAAG GCTGGGCGGC GCAATTAGAT ACACGACGGC    139800
     AGAGTCTGAG ACAGTGGGAT TTGTCAGAGT TCTGGACGAC GGTGACGGCA GGCGGTGCTC    139860
     AAGTGTCACT CTCAACTAGA GATTTTATTC GTCGTTGGCT TACCTTTGCC CTCAATCCTG    139920
     AGATTGCCCA GACGATCGCC AGCCACCCTG AGGCGCGTAA CCATATTCGG GAACGTGAAC    139980
     TATTTCTGAA GAAGGGCCAA GCGCGCCTGA GCAATACGCA GGCCCTGGAA CTGTGGCAGG    140040
     GAGAGTCCGG GATAGCACAA CTGGACTACC GCTGGGGTTC AGCGCAACGA ATCCTGCTCG    140100
     ATATCCTGAA GGGTTTTACC GAGGAGGAGG TTGATGCTGC AGCCTAACGA TCGTGCTCAC    140160
     CTGTTCGAGT CCCTGCGTCC CCCGGAAGGC TATTCCCTTG ACTGTGGGAT TGGTACCACC    140220
     TTTACGCTTG ATTTACTGGC TTTGCTCACA GCCCCCCTTG CCTTCACGAC CTTTGACTGG    140280
     GCAGATGAAG ACGGACATCT GGCCCGCAGC CCCCAAGCTT TGCTGGCAAC GATGCAACAA    140340
     TACGCCGAAC GCATTACTAT CTTTTGCCAG ACTGGTAAAA TCGCTATTCC TTCAAACCGG    140400
     AATTTGCTCC TCTATAGCTT TCTTGAAGAG TCTGTGGTTG AGGTGAACGC TCCTCGAGCA    140460
     GGCGGTCTTT TTCACCCTAA GATCTGGCTT TTACGTTTTA TTGCTCCTGA ACACCCCCCT    140520
     CAGTACCGCT TCCTTTGCCT TAGCCGTAAC TTCACCTTCG ATCACTGCTG GGATACCATT    140580
     TTGCGGCTGG ATGGTCAGGT GGTGGAGGAT GGCAAGGAGT TCGTTGCGAA TCGTCCCCTA    140640
     TCTGATTTCA TCAGAGCCCT GCCTACGTTG GCTCACCATC CACCCCTATC AAACCGGATA    140700
     CAAACTCAAA TTGATCTGCT TGGATCAGAA CTGCGACGAG TAGAATTTGA ACGCCCCCCC    140760
     GGATTTGACC AACTCCTGTT TCACCCTTTG GGACTGCAGG GCAGCTCAAC ACCACCCATT    140820
     GATGGGCACA TCGATCGCCT GTTGGTTGTA TCCCCCTTCG TCAGCCAGAA CCGCTTGCAA    140880
     AAGCTGTCAA AGCTAGGGAA AAACAATATT TTGATCTCCC GTCCTGAACA ACTGGATCAG    140940
     ATTCCAGCAC CGGCCTTAGG TGGCTTCGCA CAGCTTTTCC ATGTGAGTCC GGCGGCAAAC    141000
     CTAAATGATG AGGCAGATCA TGACCCAGCG GATGCTGCTC CTGCTCCCCT GGCAGGTCTG    141060
     CACGCTAAGC TTTATGTTGC TGATTCAGGA CAAAAGGCTC GAATCTGGAC AGGTTCAGCC    141120
     AATGCAACGG ATGCCGCTTT TGAACGGAAT GTGGAGTTTC TGGTTGAACT ACTGGGTTCT    141180
     AAACAGCAGT TCGGTATAGA TTCCCTGCTG GCCTTTCAGG ATAAGGAAGT TACTTTCCGC    141240
     AGCTTACTGG AATCGTATAT TCCACTAGAA GAGCCAGTCT TAGATGAGAA TCCACTCGCA    141300
     GACCTGGCTA ACTGGGCCGA GGTTCAGCTA TTGCAATTAC ATCTATCTGC AACCGTTTTA    141360
     CCAATCGAAG AGCCAGATCA GTATTGCTTG CAACTTCAGT TTGAAGCAGT CGAACTACCG    141420
     GAATTTCCAG CCGAAATTCA AGTGAAATGC TATCCCATGA CACGGCGTGA TCTGGCCACC    141480
     CTGCTTGATG CTCAACCTGC AAGCACGATT GATTTTAAGC CGCTCACTTG TCAGGCAATA    141540
     ACGTCTTTCT TTGCTTTTGA GATCTGGACC AGTGATAGCC AACAAAAGCT AAGCTCCTTT    141600
     ATGCTCAACG TTCCGTTGAT AGGTGTTCCA GCGAAGCGAA GACAACAGAT ACTGCGATCG    141660
     CTGCTCCAGG ACAAGAACCA GGTGCTCAAA TTACTGATGT TTTTACTATC AGATAATAAA    141720
     GCTGAAGTGC GTGAGCTGCT GGATAGCTTT GGTATTGACT CTATTACGAG CGCTTCTGGG    141780
     TTGAATGCTA GTAACGGAGG TAGTCCATCC CTCTTTCCAC TTTTTGAAGC GATGGTGAGG    141840
     GCGCTTGATC GCAACCCGAT GAAGTTGGAT CAGATTGCTC GTCTGGTAGA GGATTTACGG    141900
     CAATTACCTG AAGAGGAACA AGTTCTACCC GATAACTTTG TAGCCATCTG GCAACCCATT    141960
     TACACTGCAC GCCAAAAACT GAACGTAACC GTTCAGAGGG TGCGATCTTG AATTGGTAAC    142020
     AAAGAGGGTG CTGGTAGACC CTGCCTGGAA GCGCGGCACG CTTGCACTAA ATACTCCAAT    142080
     ACCGAACGAT TTTGGGCCCG CAAAGAAGTG GTGACCGTGA GCATTCGAGA GACAAACAAA    142140
     CTGCCTGCCT CACTCTGGGA ACCGAAACTA TTTTTGCGCC ATAGTACCGC TGGACGAAGT    142200
     GCCCGCTCCG CCGCATTGTT GGTGGGTTCG ATGCCCTCAG TCGTCACAAA GGTCCAGAGC    142260
     GCAGGTTCGA TTTTCAACAA TTGCTGGCAA GTGCGAACGG TTTTCGCCAA GGGAGTTTTC    142320
     TCTTTGGGTG CAATCTCATA CCCTGCCCCT TCTGTGAGCA ATTGCTTAAA TCGTTCTCGA    142380
     ATCGGTTGCA CTGTTTGAGA AAACTCACTT CGACTGAGGG TTCCATCGCG CACCCGATAC    142440
     CAGTGTTCAA ACAATAAATG CTGTTGTTCC AGTAAGGCTT GACCCAGTTC TCCCGCCACA    142500
     CCTTTGCGTT CAGCGATTTG AGTCAAATCC CTTTTGAGAT GCGCCCAACA CACCTGTCGG    142560
     TGCTCAAGGC TCAAATGCTG GTAGGCACTG TAGCGGTCGC TGCCAACGAT GCCTGTAAAC    142620
     GTCTCACCCA ACAACTGCTG GCAGACCTGA CTAGAACGGC TCAAACACAC CGCAAAGTAA    142680
     CTCACCCATG GGGTCACTAG CACCCACAAC CAACCCTTGC GTCCCTCAGT ATTCTTGCCA    142740
     TCGTTGTTGC CTTGAGCAAA GCTCGTTTCG TCCATATTCA CTTGCTCTTG CTGTTGCACA    142800
     TAGTGGTGAG CTTCCTCCAC TGCGCTGGCG ACCGAGGTGC TACTCTCCTG CCGCAGTTGG    142860
     TTGATGCTGC CGGTCGATAA CTCAACCCCA AACAACTGGT CGAGCAACCC TTGCACCATC    142920
     CGATGCGACT GCCGATACTG CCCACTCAAG AGACCCACTG TCGAGACAAT CCGTTCCCCA    142980
     TACCGACATC CATTGATGAT GACTTCATCC CAAGCTCTGG TTCTCACACC ACAACAGGCA    143040
     CACTTTAAGG CATGAAACCG ATGTTCCCTC ACGACCGGCA CTACTGGAGG AATCTCGACC    143100
     TGTTGAACCC GATACGGTTC TGGGTCTTTG CCCTGCAACC TCCCTCCACA GTTGATGCAG    143160
     CGTTCGGGGT AGTGTTCCGT AACCGTCTCA CACGCTTCTA AAGGATAAAA TTTCCCTTCA    143220
     TGACCCTCAT GCCCCAATTG CCCACCTCGT GGTTTCTTCT TCTCCTTCTC CTGCTTTGCC    143280
     TTGGGCTTAA ACCTGTTGCC CTGATCCTGG GACGGGGGTT TTGACGAGTT TTGGCTATTG    143340
     CGCCTAAGTT GCTCTCGCAG CATTGCGTTT TCCGCTTTCA ACTCCTCGTA TTGTCGTTCT    143400
     AATTGCTCGA TGCGTCCCAA AAGATAACGC TTCACACTCT CCGGTGTTTC GACCCACTCT    143460
     GAATCGCTAA TCTGCTCAAT CGACACGGGA AGGGGTTCCA TCATCCTGCT ACCCTAACAG    143520
     CTACCCCTGG TTTTCTCAAT TAAATTTTGT CAACCCCTTG AACAGTTACA ACTGAACTGA    143580
     TGAAAAACCG AGCCCCCTAT CCTGACCCAG AGCAGATCCT TAAAGGACTA AAGGATTTCC    143640
     AGCGCAATAC GGTCGAATAT GTGTTCCGTC GCCTCTATCT GGATAAGGAT GCCAGCGATC    143700
     GCTTTTTGAT TGCAGATGAG GTGGGTTTAG GGAAAACATT GGTAGCCCGA GGATTGATCG    143760
     CGAAGGCGAT AGATTATCTC TCTTTAAGGG TTGATCGCAT CGATATTATC TATGTGTGTT    143820
     CGAATGCAGA TATTGCTCGT CAGAATATTC AACGGCTTAA CATTACGGGG AAAAAAGATT    143880
     TTAGTCTTGC TTCCCGGATT ACATTATTAC CATTAGAGTT AAATAACCTT AACCAAAATC    143940
     GTATTAATTT TGTTTCATTT ACTCCTGGTA CGTCTTTTGA CTTGAAATCA GGTACTGGAA    144000
     TAGAGAAAGA ACGTGCTCTA CTTTATTGGC TACTTTATGA AGAGTGGTTT TTTCGAGGCA    144060
     AAGCTAGTCC TCTAAATATC TTACAAGGTA GATCTAGGGC AGATCGCTTT CGCGAATATA    144120
     TCAACAGGTT TCGTGATATT TTCCCAATTG ATGCTACCTT GGCTCAAGTA TTTATCGAAA    144180
     AGCTGAGGCA CAAGATTCAA TACGAAGAGC AACAAGGACA ACCTGATCTT TTTACCCGGT    144240
     TTACAGAGCT TTGTGAGCCA TTTAGCCACC ACACCAATAA CATATCCTGG GAAGACAACC    144300
     AGAAAAGAAA TCAGTTGATT GGAGATCTAA GGCTCCTGTT AGCAAAAGCT TGTGTCTCAG    144360
     CCTTAGAGCC TGACTTAATT ATTCTAGATG AGTTTCAACG GTTCAAGCAC CTACTGGAAC    144420
     CTGAGAATGA ACTTAACAAA ATTGCCCAGG AGCTATTTAA TTTCTCAAAT ACTCATTCCT    144480
     CTACTAAAGT TGTTCTACTT TCTGCAACTC CTTACAAAAT GTATACCCTA GCCCATGAGG    144540
     CTGCAGAAGA GAACCATTAT GAAGACTTCC TGCGTACCAT TCAATTTTTA CAATCCAATC    144600
     AAAACCAAAC AGACTACCTG AGAAAACTTC TGGAACAGTA CCGCCGGGAG TTGTTTCGGT    144660
     TGGGCCAGAA TAACTATGAC AATCTCCTGG AACTGAAGTC CGGGCTAGAG TCGGAATTGC    144720
     GCCGGGTTAT GGTAAGAACG GAGCGATTAG CGGCTTCTCC TGAACGAAAT GGAATGTTAG    144780
     TTGAAATTCC CTGCTCTAAT ATAAAGCTAG AACCGCAGGA TCTGGAAACC TATCTAAGTT    144840
     TGCAAACGAT TGCTCGTATT CTGGGCCATT CCGATACTCT GGAGTACTGG AAGTCTGCTC    144900
     CCTACCTGCT GAACTTCATG GATGACTATG AGTTAAAGCG ATCGTTCATC CAAGCCCTGG    144960
     ACGATCGAGA TCAGGAAACC AGCCTTGCTC ATGCCATCGC TACGAGTTCC GCCTTACTCC    145020
     TTTCACGCCA AGATATAGAA ACCTACGCCA AAGTGGATGC CTGCAATGCT CGTCTAAGAG    145080
     GGCTGTTAGA AGACACGATA GGAGTGGGTG CCTGGAAATT ACTCTGGGTT CCCCCTTCCC    145140
     TTCCCTACTA CAAATTAGGG GGAGTATTTA GCAATGCCAA GCTCACCCAG GTTACCAAGC    145200
     GGCTCGTTTT CTCATCCTGG CGGATTGTAC CGAAAATGAT TGCCTCCCTG CTGAGTTATG    145260
     AAGCCGAGCG AAAGATGATT AAGTCTTTTG AACAAAATCC ACAAAACACT CCAGAGGCAC    145320
     GGGAACGGCG ACGACCTCTA CTTCGGTTTG CTCGTTCTAA AGATAATAAA ATCAGGCTTA    145380
     CCGGAATGCC GGTGCTGGGG TTACTTTATC CAAGTATGGT TCTAGCCATA GAAGGCGATC    145440
     CCCTGTCCTT TGCGATTAAG ACCGATGCAC CAGGAATTCC TGCTCTAGAA GAGGTACAGT    145500
     CTCGCATTGC AAATCGCATA GAAGCACTAT TGCAGGCTCT AAACATTGAA CCGTTTGAAG    145560
     CTGGCGCTGA GGATGAGTCA TGGTACTGGG TTGCTCCTAT TCTGTTGGAT CGGCACTTTG    145620
     AACCCCAAGC AACTCATGAT TGGTTTTCCC TGCCTGATTT AGCCAGTACC TGGGCGGGTA    145680
     AGGAGCACGA GCAGGAGGCA GATGAGCCAG ACCCATCCCT GTGGGCTGAG CATATCAAAA    145740
     TGGCAAAGGC TGTCGTGGAT GCGCCGTTCC TTAGCCTGGG TAAGCCTCCC AAAGATCTGT    145800
     CCCTGGTTCT GGCTCACATG GCGATCGGCG CGCCTGGTAT TGTTGCCCTT CGTACCCTAA    145860
     GCCGAATCAC AGCAAATCCT ACCCTGCTGA CAAACTCGGC TGTTAGAAAC TATGCTGCTC    145920
     AGACCGCTTG GTCTTTCCGT ACCCTCTTTA ACTCTCCAGA AGCAACGGCC TTAATCCGGG    145980
     GGTTAAATCC CAAGGCATCT TACTGGCGAA GTGTGCTCAA CTATTGCGTT AACGGTTGCT    146040
     TACAAGCTGT TCTGGATGAA TATGCTCATA TTCTACAGGA GTCGCTGGGG TTACTTAACC    146100
     AGCAAGGAGA GGAAGCCGAA AAGAAAAATG CAGAGGAGAC CGCAAAGGAA ATTTCTGAGG    146160
     CAATATCTAC AGCCCTGACG CTGCGTACTT CTGTCATGGA AGTGGACGAA ATTGTGGGGG    146220
     ATACAAGGGG GAGGTCTACG GTTTTGATGG CGGTAAGCGG GTGAAAGGAC GGCGACGCCA    146280
     CCTCCTGGTC GATAGCCTGG GTCTGCTGTT GAAAGTCGTT GTGACTCAAG CCAATGCGGG    146340
     GGAACGGTTA GTCACTGCCT ATGCGCTGAT GGAATTAGTG GAACAGTGTC CGAAGGTGCT    146400
     TCAGAAGGTG AAGCTGTTGT GGGTAGATGG CGGTTACAGT GGAGATGCGT TTGCCCTGGC    146460
     CGTCTGGTTA ATGATTCAAG CCCGGGTCGA GGTCATTAGT CGCCGCAGTG AGGGGTTTGA    146520
     AGTGTTGCCG AAACGCTGGA TTGTCGAGCG TACCTTCGGC TGGCTGAACT GGTATCGCCG    146580
     TTTGAGCAAG GATTATGAGT ATTTACCAGA GATGAGTGAA GCGGCCATTT ATGCCGTGAT    146640
     GACCCGCCTG ATGTTGCGCC GACTGACAGT GGAAGATCAA CTGACTTTAT AAATGGGCTC    146700
     TAATGAATCC ATAATAAGGA TTTTATAACA AATTTGCGAA CGATCGCCCT GAATTTAGAG    146760
     GGAATCTCTC AATATTGCTT CAATTTCCAT GCGAATGCTC ACGCTATCTT GCAGCGACAA    146820
     ATCCAAAGCT TCCTTAAACA TTCTTAACAG GCAAAACTGG TCATTTTGCG AATCTCTTTG    146880
     GTAATCAATA AATCAGGTAA TCTGGCTTTT CATATACAGG ACGACCGCCC CAGACCTTAA    146940
     CCTGTTCTAA GGCAAGTTGT GGTGGTAGGG GGTAAGCCCG TAAACTATCT TCCTTAAGAT    147000
     TGATATACTT CAACCATTCC TTTTGGGCCA GGTTTAAAAG AGTTTCGCGA TCGAGGGGGC    147060
     ATTCAAAGAC AGAGTATTGC ACCCGTTGAC AATGACGTTC CAATGCCTTT GCCAGTTTTG    147120
     TGCGGCGTTT ATTATTGTGG ACATCGTAGC AAACTAACCA GAGATGTTTC ATTTGATCGT    147180
     AAAAGGTTCG TAGTCAGGGG TTTGGGATTG GAGACAACGG GATAGCCAGC GGCATTGTTC    147240
     CAGAAGAATC TGGCTAAGTT TGAGATTGCG GTTTTGGGGA GGATAGAGCA AAGGCTGGTT    147300
     TAAGTGCTGC TCCAGTGCGC CAAGAAAGAG TTTTTTAGCA ACCTCTCCCA GCCAAATTCC    147360
     TTCTCCTGTG GGTGAGGGCT GAAAATCCTC CAATCCTAAA ATATCCGTTT GAATCAGATG    147420
     GATGACAGTT TGATCGACAA CGATCGGGCG GAATTCCTCC ATCAGATCCA GGACTAAATT    147480
     GGGACGATAA GGAGCGATCG CATGAAAAAA GCCGAGATAG GGATCTAAGC CCGCCTGAAC    147540
     GCAGGCCGAA AAAGTGCGAG AGAGCAGTAC ACCATAGCCC CAGCTCAGTA AAGCATTGAT    147600
     CGGATCAAGA GGAGGCTGGC GATTGCGACC CGTAAAATTC CATTGCTCTG GAAACCAGTA    147660
     ACGGAGAGCC TGATAGTAAT AGCGAGCACA GCTTCCCTCC ATGCCCATTA GCTGGTCACG    147720
     GTTCAGATCC GAACTTGCCT GTTGCAGAGT TAATAGGGAA GCGGCGATCA GGTCGATCGC    147780
     TTCAGTCAAC TCACTATAGC GATTCTGAGT GGCACGATTG CGCCGTTGCA GCAATGTACG    147840
     CTGATTACGG ACTTTGCCAG CCACCATCCG ACGGGCCAGG CTTAAGCCAA AGGGGGTTTC    147900
     CACTGCCCGA TACTGGGCCA GACGGACAGC AGGATTGGTG TGGAATTGTC CCTGTAAGCG    147960
     CCCCCGAAAT CCACCATCAC CGCGTAGAAA AATGGTCTCA ATCCCGCGAT CGAGGAGTTG    148020
     AGCGATCGCC ACACTGGTGA GCTGCACCCC TGGGAGGACC ACAACAATAT CCAGTTCTGC    148080
     CAGGCGGCAA GTGCGAATTT GTTTTTGCTT AACCACCTGC AAAACTTCAT TTTGATAACA    148140
     AACCACCGTT CCGGGTTCTG TGAGGTAAAG GGCTGTCATG GTGAATGTGA TCGACCCCTC    148200
     CAGTAAAGCG GTCAATTGAA CTGCCCTGTT CGAAGCCAAG ACAGAATTAG TCTGAAGATT    148260
     CAGGAATATG AAAAGATGGG AAGAAGAGGG GTACGGCAAT TGTTCTGCTA CCGAACCGGC    148320
     ATCGCGGCGA TCGTGAACGC TGGGATGACC TGGATCGTTT TGATCATTGC CCCACTGGGT    148380
     TTGTTTGCCG TGATTTTATG TACATTGCTG GTCTTTCTGG GCAGCCTAAC CACGGGAGCC    148440
     GTGAGCGATC GGCTATTGCT GAACGTGCTG GAGCCAGAAC TTCCCTTACA GGTGGGAGCT    148500
     GAACGGATTA ATCAGCAAGG GAAACTCAAC CGAGAAGAAG GTCAAAAGCG ATTGCCCGAA    148560
     GAGGATTAAA GAGCATCTAA CTGAGCAATT ACTTCCAGAG GTTCCAGTTG GGAGGGGGTA    148620
     TTCCAGGCAG AGCCGCCCAC AGTACGCCGA CCGCCCCAGG AGCCAGATTG GGGTTGCTTG    148680
     AGCCGTTCCG CTAGAGTCAA TCGCTCAAAA ATGCCAGCGG TATAATCCAG AGCAGCCGTC    148740
     TCAGGATGGA CAGGCAGACA ACCCAGCGTA TATTGATAGC CACCCCTGCG ATGATCGCGC    148800
     AGAACAAGGG TTTCAGGACG AAGACCAGAG AGTCCAAACG CCTGAGCTAA ACCACGGTGA    148860
     AATGCCCTCG GATCAATGGG TTGATGCAAA TCCAGCAGAT TACAGAATCC GATCGCTCCC    148920
     CGATCAGTAG GGATTAACGT TATTCTTTTT TCGCACAGAA GTTGTCGCTC AACCTGGGCC    148980
     AGATGTTGCC AGTAGGGTTC CGCTTCACCG GCTGCACCGG GATAGGGGCG TTCACCCTTG    149040
     GCAGCGGCAA TCAGCCATTC TGTTCCTCTG CGAAACTGTT CAGAGTTGAA GCATTCCCAT    149100
     TCTTCTTCAG ACCAGCTCCG TCGATCTGGC GGTAATTCAA GTGCTTGCAA AGTTTGGTTA    149160
     GCCAGTAATT TAAGAGTGGC AACGGCATTG GCGGCAAACT CCGAGAGTTC CTGTAAAGGT    149220
     GGAGGCACAT GGAGGTGGTC ACAATCCCAG GCGATCGCCT TGAGCCGTGA AATTGTGGCA    149280
     GGAGTTAACA CCGAGGCGGG CAATTGGAGC CAGGCGGCCG CACAGCAAGC ATCGGCATCC    149340
     ACCATCGTGG TTACTATACA GGCAGACTCG ATCCCATAGG TTTGAATCAG GGATTGCTCA    149400
     GCAGGAAACG GCATTTCATC GATTTGAATC TCTGCTCCCC CTGTCCGGTG ATGATCCCAA    149460
     TGGTGATCTC CCAGTTTTGC TAGCCATCCC GGTACCGTTC CATCCACCAT CAAGATGGGA    149520
     ATGTTTTTAG GGAGGCGATC GGCATGAGTG GTGACCAGGT AGCGCATGAC AGCAGGGGAA    149580
     GAAGGGTAGG GGGTTAAGAT CAGGGGGACA GGGATTTAGC AAGACCAGTG ATGAAGGAGA    149640
     CGTTCTTATG GTCGTACAAA TTCCGATTCG GCGTATCCAG GTTCCACCAG GGCAACGAGT    149700
     TCTGTTGCAG GATGTGAGCT GGGAAGAGTT TGAGGCGATT GTACAGGAGT TGGGCAATCA    149760
     TCGTGCTGCC CGTGTTGCCT ATGATGAGGG TCTGCTAGAA ATTATGTCCC CGCTACCCGA    149820
     ACACGAATAT TTTAAGGAAA CGATCAGCAT TGCGATCGCA GATATGGCAG AAGTGCTGGA    149880
     TCTGAACTAT GAGAGTTATG GCTCCACCAC CTGGCGAAAA CAGGCCACAC GGGCCGGCTT    149940
     GGAACCCGAT AATTGCTTCT ACTTCCAGAA TGAAGCCAGG ATTCGCGGTA AATTACAGTT    150000
     TGACCTGAAT CAAGACCCAC CCCCCGATCT GGCCTTGGAG ATTGATGTCA CCAGCCAGTC    150060
     CCTCGATCGC TTTCCCATCT ATGCCCGTCT GGAGGTGCCT GAACTCTGGT GCTACGACAG    150120
     CGGAAATCTT AAAATCTATC ATCTCCAGAA TGGTCAATAT ATTGAAGTTC CCCGGAGTGC    150180
     TATCTTTCCG CAACTGGATA TTGGCGCATT ACCCCAACTG ATTGAAGCAA ATCGAGCAGC    150240
     GGGACGACTG GCATTACGGC GATCGGTGAG AGCCTGGGTG AGGGAGCAGG TGAAGAGATA    150300
     AGGGGGCGAT CGACACAATC AATCCACTAT AAACGGCTGA ATATAGTTTT GCCTCATTGT    150360
     TGCCAATTTT CGATTTCAAG ATCCTGAAAA TTCTCAAAAT CTGAAACATT GGAAGTTACA    150420
     AGAGTTAATT GATTAACCGC GGCAATTGCT GCAATTTGAC TATCTGCAAA AGAGGGCGGT    150480
     TTACCCAGTT GAAATAATCT TGCCCGTTCC CGGCTATGCC AAATGGCTGC GTTTTCGTCA    150540
     TAGGGCAAAA TTGGAATCCT TGCTTTGACT ACTTCATTAA TAAACTTCTC AAGTTTGCTA    150600
     CGCTTACTCG ATTCAGGTAG GCGATCGCAG CCAAACTGAA GTTCGTGCAA CACAGGTGCT    150660
     GATGTTGCCA ATACTCCTTG ATACTGTTGA AAATGAGCTA GTATCTGTGC ATCAGGACGG    150720
     GGGCGCATCA GATTAGAAAG AATGTTTGTA TCAAGCAAGT ATCGCAATGT CACAATTCAA    150780
     CATTCCTGCC AGGTGATTTA TCCCGAAGAT TCGCAAAAAC ATCTGGATCA TCGTCAAATT    150840
     CTTCCAGATC GACTTCCTGC CGGAACTGTT GATAGGCATT CCACAGCGAC GGTTGAGCCG    150900
     ATTGTTGTAG CTGCTGGAAG ACCTCTGGCT TGACTAAAAT GGCGATCGGC TTTCCAGCCT    150960
     GTAACAGTTC TACCGATGAA TCCCCTTGAA ATTCCCGGAG AATCTCATCC AGATTGTCTC    151020
     GCAGTTGCTC GATCGTATAT TGTTTCATGG GTTTTCCTGG GGGCGAGTGG GATGCTTTTA    151080
     TGGTATCGAA GGTGGGAGGG AGGCGTAGTC AGAAGTTGGT TTGGTGAGTA GAAAGGGAAA    151140
     ATATACTTGC TTAGTAGATT TAAGGCTTAA GATTGGCTAG CAGGAAAAAA CTTTACGTGA    151200
     TTAATAGTGC CATCTTCTTT AAGAGATTTA ATTTCCACCT TGACAATTGC TCCTTCAGCA    151260
     ATTAAATCAA AGTTTTTAGG TTCTCTTTCT TTAAACTCAA AACCTAAGAG TTCGTAGGTT    151320
     ACCTGTTTTC CCTTAACCTG TTTATTGACA ACTTTTGCAT CTAAAGTTTG TCCTTCTTTC    151380
     AGTTTTGAAG TTGAAAGCTG TTGTAATGCT TCTTGCATAG CTATAACTTT GGGTGAAGCC    151440
     AAGTTCTTAG GTATAGAGGG CAATTCTCCT ATTGGAAAAG TTTTATAATA GTGCATGAAC    151500
     CGCACTGCCC ATCCCAAAAT TTGAAGCATA TCAGCAGGTT TCTCTTCATA CCTGCGTAGA    151560
     TATTTATTAT AAACCAATTG AATGCTTTTG TAGTATTCAG GGGTTTGGTT GCTATGTCCG    151620
     ATTTTGCTAC CATTTTTAGC TAGAGCTTCA AGATAGCTAA AGAAGTTTTT TCCTGGATCT    151680
     TCTTGACCCG AATAAGCACG GAGGTAAGAT ACAGCTTTTC TGAGTTCTGT CAAACTTCCA    151740
     GAACCTTGTC GAGTAAGTTC ATTAGCAATC GCGTCAGCAA TTTTCCATTG AATTTCAGTT    151800
     AAACCCTCTG CTGCTTGCAT TAATACATTC CCTCCGGTGC AGTTCGCTCA GTTGGATATT    151860
     TCAGTACTTC TGCTATCTCT TGGAGTTGCT GCTGCTGTAC GAGTTGTGTA TTTTTAGCAG    151920
     CCTGCATTGC TTGATCCATG AATTGATTCA AAGCATCTCC AGTGAGAGAA TTGGATTCTG    151980
     GTAGAGAGTA ACTTAGATAG CGATCGCGTA TGTTGCGTGT GGAATTTAAA AGATTGTTTT    152040
     TATCTTGACT CCATAGTTCT ATATCCAGAA TATCAACAGT CATACTGCCC ATCCCAATGG    152100
     GCTTTCCAGC ACCTACTTTC AATGCAAAGT TAAAACTTGA ATTTTTACCC AGTGAAATGA    152160
     ATAAAGCTCC TAACTGTTCC TTGGTCAAAT TCATAAAATT AAGATGAGTT GAAAAAGTAT    152220
     AACCAACCAC TGCTCTCTGA GTATCAATTC CTTTTTCACC TTGATCTACT GAGCCTATAA    152280
     AGTTATAGAA AAACTTACGT CCACCAACTA CCTTGCTACT AAAGTTAGAG TAATAGCCTT    152340
     CTCTTTCAAG ATTGGGTTTA TACAGAGAAG GGGCAAATTC TACCTCAAAG CCTTCTTGAT    152400
     CACACTGAGC ATCTGCAAAT CGAACAATTC CTTGCCAATT CATTGCTCCG AAGATTTGAC    152460
     AAGCTGGACA AACTTTAGCT TGTCTAGTCT GAATATCTCT TTTTTCAGGT TTACATTCCT    152520
     CATGATCTGC TGAGGGTAGT TTAATACTGA TACGACGATT ATCGATCCTG AAATTATTAG    152580
     TAACTTTGCA AATACAGCTT CTTGTGATTG CTTCGTAGAT TGAGCGAACA GTTCCTTTAA    152640
     GCGAACTTCC TGGAATAATC AGTCTTCCAT TTCTTTCAAC AGATGGTTTG ACGAGTGGAA    152700
     CTCCTTGAGG GTTTTCAAGT AAATCACTTT TGAGAACTGT CAGACCTGAT GCGACAGCAG    152760
     TTGCAGTTTT TACATTCAAC CGGAGTGAAA TACTACCAGT AAAATACTTT GGCTTGTACT    152820
     GATCCAACCC TGCTGGCTTT TCCCTATGTG GTAATAAAAT ATTGCCAGAA GTATCTTTAG    152880
     GAAAAGAGAT TAACTTGTAG GGCTTTCGAG AATCATTATC CATTGATGAA TGACTTTCAC    152940
     TAGGCTGATT AACAGGTTGA GGTTTTTTCT TAAGCTTAGG TTTCTCAGTC ATGCGACCTC    153000
     CTTTACTGTT AAAGCAACAA AATGAACTAT TGAAGTTTTT TGATTTATAA AGTAACGCTG    153060
     TCCAAGCTTA ATATCATTTT CTGCAATTCC CTTAGGAAAG CGAGTGGTCG TGGCAGAGTA    153120
     CTGATAAGCA TTCCGTTCTT GTATTGTCCA TTGAATTTTA TGCTCAGAAT TGATTGGAGA    153180
     GAATCCAACT TCATCATCCT CTGCACTTAA AAGCAGTATG TTGAACTTCT GCCCTTGTTG    153240
     TTTCCAGCGC AACTCACGCT CTTGGTTAAA TAACTGTCCT TCTGGACTGG GAAAGACTGT    153300
     GGGTAAGGTT TTCTCAAAAC CGCTGACTTC ATGTGCCCAT CGTAGGAAAT AGCGACTAGA    153360
     GCCATCCTCG TATTGTTGAA GTAAATCCCG AAGTTCGTCT GCTGTTTCTA CTGTCTTCAC    153420
     GCCAACAAAT GCCATTATGC TACTCCTAAC ACGCTACTCC AGGATCTCAC TGCTCTAGTG    153480
     AATAGGTCCT TAACTTGCTC CTCTCCTGTC CAAGTGAGTT GTACCCCAAA TCCTAAGTCC    153540
     ATTGGTTGAG CTGCGACAGG AGTGTCTTGT TGATCGGGTA CAGGAAACCC ATAATTATTA    153600
     GCTTCAGGAC GTTCAAGAAA TTCACCAGCA CCCAGCAAAT TAGTGAATGA CCATTGCTTC    153660
     TGAGAACCAA TTGCCTTAAT TTGTTCGCCT TCCAAAGTGC AGCCTGGATA CTGAACAACA    153720
     GCCGAATTCA GCTTCACTTC TACCAAGCCC ATGCCGCGAG ATTTAGCAAA GCCCAACCCA    153780
     AACCAGCCAT CATCTAAATC ACGAAGAACC AAGCCAATTA AGCCTAGTTG AGCGAGTGAG    153840
     AAGTTTTTTA AGTGAATTTT GGTGCGAAAT TCACCTGCGG TACACACTTG ATAGTTGAAG    153900
     GGACCTACAG CAACAGAACC AAACACACGA TCGATTGCTA CTCCATTACG CTCCTCAATT    153960
     TTGAGGTGAG AACGATCTAC TGGATAAGCA TCTTCGATTC TAATTCGGCT GGCAATCTCA    154020
     GTGCTACCAA ACATTTGGTC TGTAAAGCAG GAAAGCTTAT ACATAGCAAA AATGAAAAGC    154080
     TACCTGTCGA GGGGGTCACG GCAGATTGTG CGAGAACAGG GTGTATTTGC CAGCAGAGCC    154140
     TGAGCAACTT GCTGTTTGGG CAGGAGTTTC AGATTGAGGT AAATCCTTGG CTCAGAGATA    154200
     TGGAGTCCCT GACAGGGATG AATAGCGAAA TCCTGAGACA AGAGATGGCT AAAGCGCCCT    154260
     TTTCTACAGT GCATCGTTCG ATCCGTCAGG ATTTATCTCT ACTTGCCCAA TTGCAATGGT    154320
     TGCGGGCAGG AGAAAGGGGA CTATTCATCC GTCAACCTGA AGCAAAACTA CCCCATCCAG    154380
     GTGGCTTAAG CAAGGCAGAG TTAGAACCGT CCAGTCAAAG CCGCGATCTG TACTGGCTGC    154440
     TTCAGGAAAT TGCATTTCTG CAACCCAATC TGAGCAGAGT TATCAATACC TTGTGGGAGC    154500
     ATCACTCTGC AGCAAGGGAA TGGCAAGCAG AGCACACCAG AAATACTCAA CGCTTATTTT    154560
     TACACCTGGA TTTCCTTTCG GAAGAAATTG CAGAGCAGGT GGAGGACTAT CAAGCCGGGC    154620
     TGGAAGAACT ATGGCAGCAA GGAGACCGCC CCATCCGGTT CATTTACCAG CTAGCTCAAG    154680
     CAAAACGTCA GGTTAAGGTG CTGGTCTATC CTGTTTGCCT CCATTATGCC CGCCGAGCCA    154740
     AGTACCTGAG TGCCTATGGT ATCGATCCCT ATGGGCAGGA GAACTGGCAC AATTACCGTC    154800
     TCGATCGCAT TCGATCTTCC CAGTTAGACG TACTGGATTG GCAACATCCA GATATTCCAG    154860
     ATTTCCTGTT GAAACTGAAG CAACAAAACC AGCTCCCCAC CCCTGAAGAG GTGCGAGAGA    154920
     AGCTGGAAGA AGCCTGGGGA TTAGATTTCT ACCGCCCCGC TCAGTTACTG ATTTTGCGAT    154980
     TTCCCGCTGA CTTTGCTCGC TGGTACGTCA CAGAAAAGTT TAATCGCCTG AAGCTTGAAA    155040
     AGCTGAGCTA TCCCCAATTA GTTAAGCGTA TTCGCAAGGA GATTCTAGAC TCGCAGGAAC    155100
     AGCAAACCCT CCTGGAGCTT GTCCATCAGC GGCAATCCTC AGACTCCAAT AACAATTATG    155160
     TTTATTTCTG CGCTCAGGTT CGGGTCGGAG ATATCAACGT CACCATGCGG TTACGGGATT    155220
     GGCGACCCCA GGGAGAGGTG ATTGCACCCT TGCAACTACG TGAGCAAATG AAACGGGAAG    155280
     CGCTCACTGA ACTTGCTCAC TATCAGAATG GTTCCAACTG AATTAGTTGT CCCCATAGGG    155340
     GGATGGAATC AATTAAAATT ACCTGGAATG ATTCTAAAAC CCTAACCCTA TGCCACAACG    155400
     AAGAGCCAAA GCGACGGTTA ATCTACCTGC TTTAACCCGT TGGAGGTCAG ATGCTGAACT    155460
     GGTGGCGATC GCACTGTCCA TCAAAGCCGA GCAGACGGTT ACACTTTACC CCCAATATGT    155520
     CATTGCTCTC CACGCCTGGT TTCTAGATCA GGTGCGCCAG CTCAATCCAG AGCTATCTGC    155580
     CTACCTGCAT GATGGAGAGT CAGAAAAAGC CTTTACCCTC TCTGGATTGC TGAACACTTC    155640
     AGACAAAGGA GAGCACCAGG TATTTCAGTT GCAGGCTGGG CAGTCCTATC AGTGGAACCT    155700
     TACCGCCCTC TCCCGCCCCC TGGTGCAGTG GTTTGAACAA TGGCTAACGG TTTTGCCCGC    155760
     TGCGATCGAT TTGCGGAGCG TACAACTGCA GATCAGTTCC TGGAACATGG CTTATCCCCC    155820
     CCTCACCTAT GCCGAGCTTA AAGATGAACC CCCTCCAGAA CGCCTGACCC TTCCCCTCAC    155880
     CTTTATCTCA ACTACCAGCT TCCGTCGCAA AGGCTATCAC TTACCGCTGC CCTGGCCCCG    155940
     CAATGTCTTT CATAGCTATC TGCGGCGCTG GAATGACTTT TCTGGTCAAC CCATTGAACA    156000
     AGATCCCTTT CTTGACTGGG TAGATGATGC TGTCGTCATT TTGCGCCACC AGTTGCAATC    156060
     CCAGAAGGTG CAGGCAGGTA AACGTGGTTC CGTTACAGGT TTTACTGGGA AGGTGGAGTT    156120
     TGGCTTGTCT CCTACGGCAG AAGAGAATCC TGAATATGAA CAGTTACTTT TTGCCTTAGG    156180
     ACAACTGGCC CCCTACTGTG GCACCGGCCA TAAAACCACC TTTGGACTGG GGCAAACCCG    156240
     ATCGGGCTGG CTCTCTGAGA GTATGGATCT GGCTCCTCCT TCCCTCCAGG TTGCCCTCGG    156300
     CGATCGGATT GCGGAACTCA CTGAGGTGTT TATGATGCAA CGCAAACGAC GGGGTGGGAA    156360
     TCGGGCAACT CAGACCGCTG AAACCTGGGC AACAATTCTG GCACGGCGGG AATTGGGAGA    156420
     ATCGTTGGAG CAAATTGCTG CTGATCTGGA GATGAACTAT GAGACCGTAA AGACCTATGT    156480
     GAAATTAGCC CGCAAAGCAT TACTTTCTGA CCGATCGCAA CAATAGAACA ATTAGAGAAA    156540
     TTTTGAAGAC GGATTATATT TTTGATGCTT GACAATTCCC TGGTTTTGCT TTTAAGCTGG    156600
     CTTTTATCTT CCCATCGACA CACCCCCTCA GATCCTTGAA AACCTCATAA GTTCGTTCAC    156660
     ATCCGTCGAT GCCTTATCCA GTAAGCGTTT GAACATTTAT TTTCTCACTC TTATTGCAAA    156720
     GACATCCAGG CTTGTTGACA CCAAAATAGA CCTGTGTCGA TTTGCCCCAT TGAAAGGCCC    156780
     ATTAGCCATG CTTCCTGAAA GGGGCCTCTT TCACTACTAA ATCCCCGCAA GGGGACGGAA    156840
     ACGAATCATA CTGCTGCTTG GCAATCCACT GTTCAGTGGG CTTTCACTAC TAAATCCCCG    156900
     CAAGGGGACG GAAAAAGATT CAGGAGTCCT ACTTGAACAG CAGGTGATTT CCTAGGATTA    156960
     ACGAATAGGA AATAGGAGCC ACTACAGCCA GGACTTGAGT GGGGCTGTTA ATGGACAAGC    157020
     ACCCTGATCG CAGGTTTTAT GGCATGAGTC TTTCAGCGGA AAAACTAAAT TTGCACTTTT    157080
     TCCAGTTGAA CAACGGCTGC CTGTAATCGG CTCAGAAGAG GCTTGCATAC TCCTACCTCA    157140
     GCAAAGGCAC GGGCTAGAGC TGGATAATAG AACATCACTC CCTCTCTTCC CTGGCTAAAC    157200
     CGTTGCCAGA CCTCCGTTCC CACCACCTCA TAGTCCCGTA GGATGCAGAG CAGGTTATGC    157260
     AGCTTGTCAC AACAGGACAC CAGATGAACA GAAGGAGAGG CTTGAGGGAG ATGGTCAATA    157320
     TAGGCTTGTT TGCGTTCCCA CCAGTTTTGC TCTTCCGTTT CAATCTGCGT ACAGCCTTCC    157380
     ACAATCTCCA GTACCTCTAA CCCGAAATTG TAGGTAATGT AATTTTGAAT ATCCATGAGA    157440
     GAACGACCGC TGTATTGCGG GCCATCTTCC AGCGCATCAT GGAGCAGGGC AGCGATCGCC    157500
     TCTATTTCAG TGGCCCCATG CTCGATCGCC AGGAGTGACA CTGCCACGGG ATGGGTAATA    157560
     TAGGGAGTCT GTGTGCCTTT ACGAACCTGC GACCGATGCA GCCAGGTGGC ATATTCCAGC    157620
     GCATTGTTAT AGTTCAGCGA AAAGTTCATC GATTCACCTG CTGAACAGCG GTCTGGTAGT    157680
     CTACCTGGCT ATAGCAGACC AGATACACCT GTTCAATCTC AGGATATTGA GCCAGACCAG    157740
     CATTAATTGC GTCAACAGCA ATGGCGATCG CCTCCCGGAG CGGGTAGCCA TAACTTCCGG    157800
     TGCTGATCAA TGGAAAGGCC AGGGAGCGCA CCCTTTCTTC TCCAGCAAAC TGCATACAAC    157860
     TGCGATAACA CTGCCGCAGC AATTCTGCAT CTTCAGTTTT ACCCTGGTAA ATTGGCCCGA    157920
     CGGTATGAAT GATCCAGTCA ACCGGCAAAT CAAAACCAGA GGTAATCACG GCTTCACCCG    157980
     TGGGGCAATA ACCAATCTGC TCACAGGCGG TTTTAAGTTG CTCATACCCC GCAGCGGCAA    158040
     AGATCGCACC ACACACGCCT CCACCTGGAC GGAGTTCGTT ATTCGCAGCG TTGACGATCG    158100
     CTTCCACCTG CAGTTGAGTG ATATCCCCCT GAATGATCTG AAACCGTTCG GCAATGGTTT    158160
     GTGGCATTAG TTCAATCCTT GATTGGGCTA TAGCTTGAAG AACCTGGGGC GAAACTGGAG    158220
     GTGGACATTG TTTGATCCCA CCCCCTGCTC AACCCCCTGG AGCGTAAGAA ATCTATCCAG    158280
     CAGACTGGAG TTTATTGGGA ATGAAAGCCG TCAGGGGACT CACCCCAGAG GTACAAATCT    158340
     CAGCTGTACG TTGTTCCAGG TCAATATAGC GATTTGCAGC TTTGATCAAC GCCTTGCTGG    158400
     TGCAGGAGCG AAAGCTGATC ACATCGACTG CAATGCCCTG TTGCTTCAGT AGTTGTAGGG    158460
     CTTGAGTGAA GTCCCCATCC CCTGAAACCA GAACCGCTCG GCTGAGCGTA TCGGCAAGGC    158520
     GGTACATATC CAGTGCCAGT TCCACATCCA GGTTGGCCTT TTCCGTGCCC CCCGGCTGGC    158580
     GCACTATCTT TTTAGTCACG AGCTGATAGC CAATTCCAGT TAACCAGTCC AGTTGCTTTT    158640
     TCTGGCGGGC ATCCCCTGGC CGTTCTCCGG TGTAGAAGAA CACCCGTGGT TGCTTCATTC    158700
     CTTTAGTGAG AAAGCGATAG ATCTTCTGGT AGTCCAGCTG TAGATTCAGG TCACGGGCCG    158760
     AGTATTCTAG ATTGGCTGCA TCAATAAAAA TTGCTGGGGT CTGAGGTTCA GAGGGCTGTA    158820
     CGACCTGGGG CGGTTCAATG TCTAACCGGT CCTTTAGAGA GGACTGGACA ACATCAATTT    158880
     GCTGTTGTAG CTGAGGAATG TCCCGCAGCT TGAACTGCTT GTTTTCAATC TGCAATTCAC    158940
     GAATCTGGTT GATCACAGGT TGCAAATGAG TTTTCGTTAG GGCTGCAGCA GGTTGGGACT    159000
     GGAACTGATC AAAGCGGGAC TGTAACCCAC TCAACTGTTG TTGAATCTGC TGACTCGACT    159060
     GCTGAGACTG TTCCTGCCAG CTTGCGATCG CCTGGGTTTG TTTGCTCTGG TTTTGAACGA    159120
     GTGCCAGATA ACGTTGTCGA TCGCGAATCT GCATCAACAG GAGATTGAGA TAGAGGGGTA    159180
     GACAGGCCAG GAGCAGTTGC TGGGTAAACA CCCCCACCAG ACTGCCCACA ATTGAACCCG    159240
     CCAGGGGGAA GTAGCTCAAG TTATTCCGAC TCGATGATGA CTGGGCAGCA GAATCTGTCC    159300
     GCATGGCTTC CTTCCTTGCT TTAAATAGAA CGACTCTGAA CTAGACAATT AGAGAATAAC    159360
     CAGGGTTTGA ATACCCCTGT TCAATATCTA CAGGTCTTTG CGGCTGCGCT GGCGATAGTG    159420
     CTTCTCATAC AACGCCTGCT TCCGGGAACT CTTATAGTCC CGTCGTTGCA TCTTCTCTTC    159480
     CAGGTCGGAC AACGCCTGGA CTTCCTGCTG CATCATCGGA GAAGCGGGCA TGCAAGCGAC    159540
     TTGGTCCCGC ACATTTTGCA GCACATGCAG GGCCTGGTCA TAATTGCCCC GATCCATCTG    159600
     CTGAATCGCT TCCTGCCGGG CCCGGGCCGC CATCAAAAGG GCAACCTGTT GCTGCACCTC    159660
     CTCATTCAAG GGAAAGTCAG CAAGCTGGGC CGTGCTCACA ACGGGTAAGC GCAACGCTGT    159720
     TTTGAGCACC TGGCGCTGAC GTTGCTGGGG CTGATCCCAG GCGAGGCGAA ACTGGCACAG    159780
     GTCTGCCGAT TCTGCCAGAG GGGGGACTTT CAAGCGCACC ACAACTTCAA TCGAATTTCC    159840
     CACGACCAGG TTAGGCAGTT TATAGCGTCC GTAGGGGGTT TGCTCAAAAT CGTTCAGCAC    159900
     CTCGACGACC ACAACTCCCT GTTTTGGCTC AATTCCCAGG CTAACCGTCT GTCCCAACGT    159960
     CCCCATCAAT CCCTGCAATT CAGCCTGGAA AATAGCTGCT AACTGCTCCG TGCGTTCGAT    160020
     GTGATAAAAA CTGCCTGCCC CACTCCGGGC CATCGCTTCC AGCAAATCTT CGCCATAGTC    160080
     CTCTCCGATG CCCATCGTGG AGGTACTCAC CCCCCGTTGG GCCAGCCCAT GGACGTGCTG    160140
     GGCGATCGCG TCTGGGTTGG TTTCTCCCAC ATTGGCCAGA CCATCAGAAA GCAGAATTAC    160200
     CCGGTTGAGG TGGGCCGGAT TGAGATGCTG ACTGACCTGA ATTCCCCCCT GCACCCAGCC    160260
     ATCATGTAAG GCCGTTGAAC CCCGAGAATG AATCCCCTGG ATCGTCCGAA TAATAGTGGC    160320
     TTTGTCCCGC ACCAGGGTTG AAGGCACCGG GCACTCCACC CGATCGTCAA AAATCGTGAC    160380
     ACTGAGCCGA TCGCTGGGTA AGAGTTGTTC TACTGCAAAG CAAGCGGCTT GCCGAGCGAC    160440
     CTCCATCTTG GCGCCCTGCA TCGAACCGGA GCGATCGATC ACTAGACCCA AATTGAGGGG    160500
     TGGGCGTTGA GGTCGGGTTT CGGGAACCGG CGGAATAATC TTCACCAGTA CGTCCAGCGT    160560
     CGTGGGCTGG TCTGAAGCAA CCGCAGCGCG TAAGGGAAGC AATTGGAATT GAGGCGTTGT    160620
     CATTTCGATC GTCTCCGTTG GTGAATGAAT TGAATCAGCA ATTGCCCGAT CAGTTGCAGC    160680
     AGAGTTTGTT GTTCCTGGCT GCTGCTGGGG TAGATAAAGT CCTCGCGCAC ATGCAACTCC    160740
     AATCCCGGTA TCACCTCAAA CCGCATCCAG GATTTAGGAG CAGTTGCAGA GGTTGGGGTT    160800
     GAGCTTTGAT CCACGAGGGG AGCCGCTTTT TTGGCCATCT CAACCACGCC CGGTGTAGCC    160860
     TTTTGCAGGC TTTGGAGAAA GGCAAGGGCA GGATTAGCCG CCTGGACGGT GAGTTGAACG    160920
     CCGCCCTGAA GTAAGGCTTC TAATTCAGGG TTTGATTTAG ATAACGTCAG CTGGTTGATA    160980
     GCGTTCGCAC TGTATCCCTC CATCTGCAGG CGACGAATCA CCAGTAATTG CAGTAAATGC    161040
     CGGTAGGTGT ATCGTGCCTC TCGCCCTTCT TTTAAGGGCT TGTCAATCAA ACCGAGGGTA    161100
     GTGTAATGGC GAACCAGCCG GGGGTTGACT TCCTCCTGAA CCCGTTGATC ACTCTCCTGC    161160
     TGGGGCAGGA ATTGAGGTAA AAGTTGATTT GCCGTTTCAA CCAGTTGCTC CAACGTCCAC    161220
     AAGGGGTGGG ACTGGGCAAA CTGTTGTAAG CTGAGCATGG AACTATATTG ACAGTATCTA    161280
     TTGTTAATGT CAATAGTATA TGGCAGAACC TTGGCACACA CCGCTGGCAG GAGCGCGATC    161340
     GCCTCGATTT TGTAGACACC CCCCAAAGGG GAACCTGTAT CAGACCGACA ACAAACAACC    161400
     AAAACTAGGG GTAAACAACC ACAACCCTGG CGACATCTCT CCCATGCCCC AACAAACAAC    161460
     CACGACCTGA AGAGCAAAGA TTAGGAATTC AAGTCTGCAC AAGGCAGTTG GCTGATACAG    161520
     GTTGCGGCTG TCAGTCGTAG TCCGACTCAC TTTTGGCTAA GCCAGGGCAC ACCACGGCAC    161580
     CCAGTCGTTC AAGCGGCAGC AGTTCCCATC AATTGGAGGG ACGCTTCACT CAGCTCAATC    161640
     TCCAGGGTTT CCTGGTTATT CAGCCGCGTA ATTTCATCTT CCAACTGGTC AATCCGACTG    161700
     GTCAGGGACT GAATTTGCTG CTCAATCTCT GCTGGAGTGA TCACCTGGAT CTCTAACTCC    161760
     GTTTTACCCT CCATGTGTTT GAGGTCTTCC CGTAACTGTT GCGGATCGAT CGCTTCCACC    161820
     CGTAGCGGTA CAACTTTGCT ATCTGCGTAT TGACTCTGAG TATGCTTGTA CAGGTTCAAC    161880
     AGTTCCCGAC ACAGATCAAT GTCACTCAGC CGCTGGGAGA TGCCACAGCG TTGATTGGCC    161940
     ACAAACAGAC TTTCCCGCAG GCGGTAGTAG TCCTGGCAGA TTTGTAAACG ATTGTCCAAA    162000
     GCGTCTCGAC GGCGACGATA CTGCTCTTCC AGAGTGGCCC GTAACTCGTC GTTACAATCA    162060
     CTCAGGCGAA CGGTGAGGGA GAATGTGGGC ATGGCCGCCA GGTAGTCATA GTGACGATAA    162120
     CTGCGGCGGC TTTTGAGTTG TTGCAGCAGA CGGTTCGCTT TATTCAACGT CAATCTCATA    162180
     AAGAATCCCG TAAAAAAGAG AAAAAGGAAT TTGCGAGGGA GAAATTATTC AAGGTCAAGC    162240
     CAGTCCAGGT CCTCCGATTG CACCTGAGGT GTCGATTGGG TCCGGCGGGA GTCCTGTTGT    162300
     CTGGATCGGT TTTGTTCACG CAGAAACGAA CGGCGCTGAG CCTGGCGGAG CTGACAGTAC    162360
     GACCAGAGTT GCCGACTGAA CTTTTGCAAC GGCTGCTGTT GAAAAAAATG ATGCAGCAGG    162420
     AATCGATCCA CTTCTTCCCA GTCCTTCAGG GGGGACTGCT CTTCCACCAG GGCGATCGCC    162480
     CGTTGGGGAT CTTGCAACCA GTAGGTGTAC AACACCAGCG CCAGGGTATA GGCAGAAACG    162540
     GAATTGGAAT GGCTGTAGAG GGCAAAGTTG AGGTCATAGC CAAAGCGTTG CAGGCAGGTT    162600
     TCGACAAAGC GAAGACAGTC GCAGAACTTG AGGTCAGGGG GGGTTAGCTG ACAAGACCAA    162660
     CCGCAGTGGT GATAGGCAAC CCGTAAATAG CGATCTGGGT GATTCTGCTC CCACAGTGAG    162720
     ACAGGCAACT CTGCCACTTC GTTAATTTCG GGAGAGAGGA TAGCTATAAC TGCAGTGGAT    162780
     TGGGATAGGA CTGCTGCTGC CGTGCGTTCA TTGCACACTA GAAAGGCAGG CACAGGAAGA    162840
     CTCTCCTAAT TCCGCAAGAA TGGATTTTGC GTAATCGGTC TAGGACTGAG CAAAAATATT    162900
     AACAAGATCA AATCACAGCC CGATAACTCG TACTGGGGTG AGGTGGGGCA GACTCGTTAC    162960
     TAGAATCTGA TGTCAGGTCA AAGTAGGGAT GAACGTGATC GTCACGGGAG GCTTCAGGAA    163020
     ATTTGCAGAG ATTAGAGCGC ATTCATTCAA CTCCGGTAAG CATTAAGACT AGCCGAAATA    163080
     CAGAAAAAAT GTCATTACCC TACTCAAGCT TCAGGCGACG AGGGGGGAGG CACTCATGAC    163140
     AGGCAGTACT CCGTTGGCCC CGTCCGCGCA TCACGGTTTG CGGAGGTCTA TCCCTCAGTC    163200
     GCTCGGTTGG GAGAAGGCGG AGCAGCCCGA TATTTATTTG TTGTGAAGCT CACAAATTTA    163260
     GACGGAATCC TAATATAACC AGCAGTAACA ACCTCGTCAA GAGGTATATT TATTTGTTTT    163320
     GGGCTGTTAA TAAGCTTGCA GTTTGATAAA AGGGGTCCTG CTGTTCTAGC CTAAATCCAC    163380
     CGATCAATAA CCCTAACCAG AGTTCGATCA AGCTGATCCC CAACCCCTGT CTCAGGGTCT    163440
     GTAATGAGAC CTTTCCTCGG TGCTTAAGGT AATGCGCGAT CGCGGCGATC GTCTCCTGGA    163500
     CGTTTTCATC ATGGGCAAGA TTGAGAATTC CCTGCTCCAC TGTTGCTGTG TCGGGGGGAA    163560
     CCTCCACACG GGTTTCTTCT ATCCAGTCCA GCAAGTCTGC TTTAGCAACT TCTCCCACGA    163620
     TCGAACCTGT CCGCTCTGCC ACTTTACGAT GGATTGGATA AGCTACAGGT TCAGCTTCTT    163680
     CAAACAAATC AGACACATCC AGGGAAAGAG ACTGAACGAA CAGATCCGCA CAGTCTTCCA    163740
     GGTCAATCAC GGTTTCCTGG GGCTGATAGC GCCGTTCCCA AGCCTCAATC ATCCCCGCAG    163800
     CTCGATCCGC ATAGACCTCA GAAAGCTGCA CCATCGCATT TCCAGCGATC GCCAGTTGGT    163860
     TTGTGAGTGC CTGCCCCTCT AGCGTCCGTT CCAGTACCTG ATAGAGCGAT CGCAGATCAG    163920
     CGGTTTGCGG CACTTGGGCG GCGGCTTCCA GAGAACCCCA CAAGTCCAGT TCAAGCTGCT    163980
     GCATCATGGC CCGAGTCCTT CCGGGTGGAG AGGGCAGGGA CGAATCGGGC AGTAATCCGG    164040
     GTGCAGTTCC ACGCTGGTGC GAAACCGTTC CACCTTCCGT CCACACTGCT GTGAGAATAG    164100
     CGCCAGAATT TGGATCAGCA AGGCTTTCAC CTGGGACTCC CTCAGCCCCA AGCAATGAAC    164160
     GGGTTCAATC CGGGCCGTGC GGTCATTCCC CATCCACAGT TCCGCCCCGA TCGCGTGCAA    164220
     CGGCGCATCC TTGGTCACTC GATACCAATG CACTACCGCG GCGGGAACAG CTGGAGCCGG    164280
     CAGTTCCAAG ACCACGGTTC CCCCCGCGAT TGCTCCTGCC CTGGCCTCCC GTCGCCGCAG    164340
     TTTACGTCCC TGATTGCGGA CCCCGCGGTG GCGGTAATAG GAGCGGCGGT TATAGCAAAC    164400
     CTGAGGCGTC CAACAGCCAT CTCCTTCAGG ACCATGGCGG TGTTGAGCTT CCTGAGCCGT    164460
     AAGCTTGGCA CAAAGGCGGC ATTTTTCTTG ATCAGGTCGA GCCATTGCAC AAGATTGGAT    164520
     CAAGAGAAGC GGCGGTGACC TCAGGCATTC GCGAGATCCT CAGCCAGTTC GGCTGCCCCT    164580
     AAAGAGAAAG TGTTGACGTC ATACTCTGCT AGCCGCGCTA GAAATTCAGT CCGAGGCACC    164640
     CCAGCCAGCA CCGCCGCTGC CCCTGAAGAT AACCGGCCCA GTTCATAAAG TTTCACACCC    164700
     CCAACGAAAA GCAGTTCCTG GCTCAGCTGC TCAGGCGTGG TTTGCAGGGC TTGCAGGGTT    164760
     TCATCGGAAA TTGCCAGCGT GATCTTAGGC ATGGAGGAGC CGTTCGCGTC TGTCCCTTCG    164820
     TCTGCGCGGT CTGAACTCAT TATAGAATCC CCTCCTCTGA ATCGAGTATC AGTTAGTCAT    164880
     AGAGCAAATA ATGTTCCCAG GGTTATCCTG ATCAAGCAAA GGGACATTAA CGTTTAATTC    164940
     AGATGTACAA CTCAGTCAAA CAGGACAGTG CGGTTATGGC CAAACTAGAA CGGGATGAGG    165000
     AACGGGAAGA GCGGATCACC ATGGAGATCT TGGTGGATGC CTATGGCCCA GAAGAGCAGG    165060
     CAATGGGCTG GTATTACTAC TTGCAGGGGA ATTTCCAAGG ACATCTGCTC CAGCAACACC    165120
     CGATGAGAAC TGGCTCCAGA CGGCAGAGAT TGATCCACTT GCTTGGCCAC TTCCTCAAAA    165180
     ATCCGCTCAA CACCCATATA GTAGTTTTGT AAGCTTAATG CTGCTGCCTG ATAAAAATCA    165240
     GCATCCCCGC TTTGCTGCGC TTTGCTAACC TGGGACTGCG CTTTAGCTAC AACTTTATCC    165300
     AGCATGCTTA ACTCATTTTG TAGCCGGGCC ACCAGCACTG TGTATTGACT CATAGTTCCA    165360
     TACCTTGAGC GATCGCTGCT TGCAGGTAGG GGCTTGCAGT TTCTGCCTCA ACCAGATCAA    165420
     TAGTGAACCC TGGAAGTTCC ATCAGCCGGG CGATCGCTTT GATGTAATCT GACGAGTTAA    165480
     GCTGCCAAAC TGCCAGATCC AGGTCAGAGC TTTCATGGAA ATCCGTTTCA TTCAGAATCG    165540
     AGCCAAATAG GACAACTCGG CTTACTTCGA ACTCTTGACG CAGAATTTTA GCTGCCTCCT    165600
     TCCCCAGTGC CACTCCCTGT TGCCGTCGCC GCTCTAAAAA CTGTTTGCGT TGTTGCTGTC    165660
     GTTGCCGGGC AGCTTCAATG TAGATCTGCA TTTTAGAAGG GATGGGCAGC GTCATACAGC    165720
     AGGTTAGCTA TCTCTTGTTC TGTACCGAAG TTAGACCCAC TCCCAATCTA CTCTACTGAA    165780
     GCAAACTCCC GCAGTTTAGC CTTAATTCCC AATATAGTCA TAGATTAATC GTAGGTTAGA    165840
     TAATGTTGCC TTGCCTTTGC TGAGTACTAT CGAGTCCTGT GCGACGATGG CGTGATGACC    165900
     GTCCAATTCA ACTACAAAGA CTCCGGTGCA TGGGTTGTTC TTGCTCAATC CCTGATTGAT    165960
     ACTAGCTTTG AAATCACCGC ATCCTGAGGA GCCAGCACCG CAAACCCGCA AAACCTGCAC    166020
     TAGGCACAAA AAATTCTGTC TCTACCACCG TCCTCCCTAT TTGCCGCAAA CGCGACCCCA    166080
     ACGCCGGACA AGCCTGGTGG GATGACCTCC GCCTCGATAA CGCCACAAAA AGCGGGCATT    166140
     CTCCACCAAA CCAGATGAAT TCTCTCCTCG CTACCTGGTT GGTGGACTTC ATGCTATCAT    166200
     TGCCCTCTAT CTGGAAGAAG GGACGATCGA GCCTGTCCGC CGCTTTCTAA AATCCAGTGG    166260
     GTTATTGACC AATGATTTGT TTATGCGATC GTAGGAAGTA GCCCTAAAGG TAATTCCTCG    166320
     TATTGGCGGT GAACGTAAGT GTATCCCTGA AGAAAAAGCT CTAGCTGACT TGTGGTTGGC    166380
     AATGGATGAA ATTAAAGCCA AAGTTATCCA CGCCCAACCA CAGCTAGAGT TAGGCTACGG    166440
     ACAAACAACC CTCAATTTTG CTTCAAACGA GGAGGAAGAA ACCTGATGCT AACTGGAATA    166500
     CGTCAAAAAG CGATCGTCCA ACCAGGGGGT CTAATCGAAC TCCATTCATC TGAGCTACCA    166560
     GAAGGCGCAA CGGTTGAGGT AATCGTGTTG GTAGAGGCAA GCTCAACAGC TCAAAGATCC    166620
     CTGACCAGTT TCATTGGAGC TGCAAAAGGT AACTTTGCAA CCCCTGAAGA CGTGGACCAA    166680
     TTTATTCGTC AGGAAAGAGA TGAATGGCAC TCTTAAATGC GATTCAGGGC GATCGAGTTT    166740
     ACCTGGATAC CAACATCTGG ATTTATGCTC TAGAAGGTTA TCCAGCATTT TCCCAAGAGT    166800
     TAACTAATTT GTTTCAGGCG ATCGATCAGG GCAACCTATC AGCAGTCACG AGTGAGCTAT    166860
     CCCTGGCAGA GTTGCTGGTC AAGCCAATAC AAACTCTTGA CGTTGCTCAA CAAGATACTT    166920
     ATAAGCAGGC AATCACCAGC TCACAATATC TTTCCGTAAT CCCTGTACAA CGAGATATTT    166980
     TGATTAATGC AGCTATCCTT CGGGCAACGA CCTCACTTAA ACTTCCTGAT GCCATCCATG    167040
     CAGCCACAGC CCTGATAACC CAGTGTTCAA CCTTTTTGAC CAATGATCAG CGATTCCAAA    167100
     CAATCACGGG CTTAAAGGCT GTTCTGTTAT CACAAGCTAT TACCCCTTAA GGGTTATAGC    167160
     AAACCGGAGG CGTCCAGCAG CCATCCCCTT CAGGACCATG GTGGTGTTGA GCTTCCTGAG    167220
     CCGTAAGCTT GGCACAAAGG CAACATTTTT CTTGATCAGG ACGGGCCACT TCTGCCCTCC    167280
     TCATGTTTCG GTTCCTCCCC CAGATCGTTC AACCCCAAGG GTGACGGGTC AAGCTCTGCT    167340
     TGGATCTCCA TAAATTGTCG TTGCGTCCGC TCACTGCCTA ACAGTACCGC CAGTTGGTCC    167400
     AGTCCATCGA TCACCACAGC AGGCTGATCA ATCCTGAGCG CTGCGAAACA GCGATCGCGA    167460
     ACCTGAGGAT TCGACTGAAA AGCAGCAATG GCCTTCACCA AGGCTGGAAG GACCGCGTAA    167520
     GCTTGCTCCG CTTTCGCGAT CGCAATCTCA GGGATATCGC CATCCCGCCG AGCCAGTATA    167580
     CACAGATCAA TCAGGTCCCG TGCAAACGTG CTGGCATCGT TCCAGCGATC AGCATTTGCC    167640
     AGTAATTTCG TCGCCCACTG ATCAATCGGG TGGAGGCAGG GCACTGGAAT TGCGGGGAGC    167700
     ACCACAGGCG GCTCCAGGGG AATCCGAGCT TCACAGATCA CTTCCACTTT GACTGCCGGA    167760
     TCCCCAACCC GAAATCGCAC CGCGTACATG TCCGTTAACG GTGGGCGGGC CAGGGGAAGG    167820
     GCGGGGTCAA ACAAAGGAGC CGTGCCCTCG GCTGCAATCG CATTGCGCAG TTGACGATAA    167880
     GAGGCCCCTT CTGGGCAGAT CAAGTCAATG TCATAACTAA GACGGTATTC CCCTTGCAGC    167940
     AAGCACAGCA GAGTCCCCCC CCCAAACCCA ATCCCCAGGT CTTGCAGCCA GGTACGGTTC    168000
     ATCGCGGCCA GGAGTTGTAA AACCTGCTGG TGCTGCTCAA ACCTCATGAG ATTCAATCAC    168060
     CGCTCCATAG GTAGCAATTA AGTATTGAAT CCAGTGCTGC TCGGTCTGAG TCAGGACCAC    168120
     CCCTCGCCGG TAATGCCAAT GCCGCTCATA AATGCCCAAC ATTTCCGACT CGCTCAGCAG    168180
     AGACGGATCG GCAATATTCC AGCAAAGCTC CTTCAGAAAC GGCAACGATT CAGGGCAGGG    168240
     CATGGGCCTC TCTAAGTGCA AGTCAAATCA AGAGGAGTCG TGGATCTAAG ACCAGGCTAA    168300
     CCTGACCCAG CCAACCCTCC AGACTCTAGA CCTCTATAAT AGCTCTCCGT CCCAAATATA    168360
     GTCATAGTTT AGTCGTAGGT TAGATAATGT TCACTTATCT TACTTAAAAT CGGGTAAGCT    168420
     CAAGGGGAAC AACGGAGAAA TCAGACATTA GAGCAGCAAA TGGAGCCCGG GGTTGTCTTA    168480
     TTCTCCACGC CTTGGTTAAG CGCCAAGAAT GTTGGCGAGA TTCCCTGTTC AAAGTCAACT    168540
     GAAGGCTTGA CAGGCAAGAT AATCGCTAGA ATTGAATCCC ATCGCAGCAA CTCCACCTTA    168600
     CCTGCCCGCA ATCCGTGACG AAACATCATC AGGTTCAGGG AGCGATGCTC CAAAGAAGTA    168660
     GCTTTGCCTA CGCGCAGGGG ATGACGGCCC CGATCGCCTG CCGCTTCAAT CAACTGATTC    168720
     ACTTCAGCCA GAGTGAGATA TTCCCGGCTG CGATAGCTGG CATTGGGCAA GCGGACGGGG    168780
     AGAACTGCTT TCATTGATAA CTGTCTGAAG AAAATACCGG TTTTCCACCG GTCTCTCTTT    168840
     GTCATGTAGA CCACATTGGT CCATCTTCTA AGGTATAACT TCTACCCAAT AGTCAGCCGT    168900
     AATAATATTT CCATTTCGAT TAAACTGTCC CCAGAGCTTG TATTTACCTG GTTGTGGAAA    168960
     GCTGGTAACA AAGTGAACCT GATTGGCAGG GGTGTTCTGC ACTGCATGGG CATGGATATA    169020
     ATCCTTCCTG GATAAGTTTT TGGATTGACG CAGAATTACC AAATGTCCTT TCTCTCCCAA    169080
     GTAAGGCTGT AAATCGGTGA TAGGCTGCTG AGTTGTGGCA TCTTCCAAAT TGAACTGTAA    169140
     AGTAACATCT TCCTCTGCTT TGATAGCTAC CTTGGCTGGA GCAAAGCTAA CGATTGTCTG    169200
     TCCAAAAGTT TTGGTGCGGC TCCAATTGAT TTGGGAAACA AAAGGGGTAT CCCCATCCAC    169260
     TTTCGTTTTC AGTACGGAAA CTTGTTCTGC CTGCCCTGCC GGTTGGTAAT CACTGAATAA    169320
     GGTGTAATTT CCGGACTTGG GAAAATGGGT TGCAACAACA AATCTTCCAT TGCCTTGATA    169380
     AGTAGGGTGA AGGTGTTGGA AAATCTGTAA GTCTTGACTA ACTGCAATCA CGTGCATGAT    169440
     CTGTTCCTGG AAGCGATCGA ATTGAGTGAG AGCGTTTCCA TTCTGATCCT TGACATCAAC    169500
     TTGAAGGGAA ACAGGAGTAT TGGGTCTAAT TTTGTCGGGT ACAGTCAGTG TTGCCTGGGT    169560
     TGATGGGGAA GGTGGACTAT GAGTATTTCC ATGAGAATCA TGGCTATGGC TTGTTTCAGC    169620
     CACCGAATGT TCTGAATGCT GTTGGGTTAT CGTTGTTATA GGAGGTTCCT CCTTTGCATT    169680
     GGGTACTTGT GCGCAACTTT GAATGATGGC TAAGCTTGTT ACGATAGCAA GCGTATTCAT    169740
     TAAACGATTC ATGTCTAACC TCTGAGACTA GTTTCAAAAA CAATGTGTAG TGCTATAGAA    169800
     GGTGAAGATT TTCTTCTAGC CAAATCCGTA CTTCTTCTTC AGAATTCAAT CGAATGTTTT    169860
     GTCCGGTTTT AGGAAAATAG ATATTCCACC AGGTGTGACC AGACCAGTCT TTTGAAGACC    169920
     AAACTTTTGG TTCATTAGAG AATTTTATGG CGCTGGCAAT TACTTGCCAG GTTCTAGTAA    169980
     GCCAGTCTTT AAACAAACTC GGTTTAGGCT TAGAAACAGA TTTGTAGTTG GTCAGCGCAA    170040
     TAAGAAAGGT TAAATGGGAA TCGCTAAATT GAAGCGGATG GGTTAGGTTG AGCAGTATGG    170100
     AGCCCAGCGA TGCCCACTTA GCAGCCAGGA TGGCAGCCCC CGAGTTTGAC CCAGAAGAGA    170160
     TGGGGGTTCG GTATTGGTAT GAGCAGTATT TGCGGCAACG GGCAGAGAAT GCGGAATTGC    170220
     GAAGACAGTT AACCCAATTA GAGGGGGAAG TAGAAGAGTT AAAAGAAACA CTGCGGAAGT    170280
     TGAAGGAACG CGATAGTGGG AATAGCTCAC AACCCCCATC GTCAGATGGA TACAAACGTA    170340
     AAAGCAAAGG GTTGATGCCC CGTCAACGCA AGCAAGGACC GAAATACGGA CATGAGGGCA    170400
     AAACGCGCTA TGGATTTGAG ACCGTCGACC ATCGCTTGGC GCTTTCCCTA GCGCAGTGCC    170460
     TAGTCTGTGG CAATGCGTTG GAACGAGACG AAACCACCCC TGTCAAACGG CAGCAGATCG    170520
     CAGAACTGGT CGAGCGTCCG GTTGAGGTGT GGGAGTATGA ACGCCCGGTC TACACCTGTC    170580
     CCCTTTGTGG CTGGCACGGT TCTGCTGCCC TGCCGTTGGG CTGTCGAGAG GACTTTAGCT    170640
     ATGGCGCACG GTTGAGTAGT TTGGTCGGTT GGCTGGGCTA CGGCGGACAT TTGAGTTGGG    170700
     CAAAGCAACG GGATTTGATT GCGATCATTT TTGGGATTCC CTTGTCGCAA GGTAGTCTTG    170760
     CCAAGATGCA TCGCTGGTTC TGCGAAAGTT TATATCCGAG TTATGAGTCC TGGTGGAGCC    170820
     TGATTCAGCA GCCTGGAGTG CGCTGTGTAG ACGAGACGAG CTATCCCATC GATGGAGTCA    170880
     ACTATTGGAT GTGGGTGGCG ACTTCGAGGG AAGTTTGTGT TTTGTTTCTC GCTCCGAGTC    170940
     GGAGTTCTGC CGAGGTGGAA TCCTTGTTAG GTAAAAGTTT TGAGGGTATT CTCAGCAGTG    171000
     ATTGTTGGTC TGCCTATAGT CCCCAGCAAG CCACGGCGAA ACAGAAATGT TTGGCGCATA    171060
     TTCAACGAGA ACTCGAAGCC CTTAGCGGTT CACGCTTTGA GTCGAATCGG CAGTTCGCAA    171120
     GCCAAGTCAG TGCTATCTTC GAGCGGGCGC GGCAAGCCTA TCGAGGCTAT CATGCGGGCA    171180
     ACTTAACCGT AGAACAACTC CAGACCCAAC GACTGATTTT GGAAGCGGAG CTCACAGACG    171240
     TGCTCGACCA CCCGCCGAAA ACTGGGTGGG CAGCAGATGC CCAAGCTTTG GCAAATCGCT    171300
     TCCACCGCTA TTGGTCGGAT TGGTTCACCT TCCTGAGGAT GCCAGAGGTC AAACCTGACA    171360
     ATAACGATGC CGAACGTGCC CTGCGTCCAG TAGTGATTCA TCGTAAGACC AGTGGTGGTG    171420
     CTAGAAGTGC TTGGGGCGGA CAGTTAGTGT CACTGATGTT CAGTTTTCTG GAAACGATGC    171480
     GACTGCAAGG CCAGAATGCG GTGGCTGAAC TATTTAATCT ACTGGCAGGG GTTGAGCGTG    171540
     CTCCCCCTCA ATTGCTGCCA TCCACTGCTG AATAAAAGCT GAGGTCGGGC TTTTGGGCTT    171600
     TCTCAATTAG CCATGCTTCT TGCTGTGACT AATTACACAG ATTTTATAAT TTGTTCTGAT    171660
     TCACAGTGAA GCGGTTTCTG TGCATTTGTT TGCATAGTAG TTTCTCCTTG AATGAGTGAG    171720
     TTACATTTGG ATTACACAAT GATTGAAAGT CACTTTTTTT GTAGTTCATT CATATTGCAA    171780
     AGCGATAGAA ATTGAAATCT TTCAGCTTAT TGGGCAGTGT TTTAATAAGC CTTTATCCAA    171840
     GCCTGTCATT ATCTTAGAAT ATCCAGTGGA CTGGAGAATC AAGCCCTGAA CCAAAGTTTT    171900
     TTGCTTTGTG GTTAGGCTAA CTCATTTACA GAATGAATAG ATTTTGGACG TACCAGTTTT    171960
     TCTCGAATTT TACCAATCAC AATGTAGAGA ACTAGGACAA TAAATAGACT GAGAAATGTT    172020
     GCAATGAATG TGCCACCAAA AACAGCCGTT CCTAAGGACT GACGACTGGC AGAACCTGCA    172080
     CCTGTAGGAA ACAGCATGGG ATATGAACCC AGTAGTGCCG CGATCGCGGT CATCAAAATT    172140
     GGACGTAAAC GGTCTTGAGA GGCTTCAATG ATGGCTTTGG TGACAGACAG TCCTTGAGAT    172200
     CTTAATTGAT TGGCAAATTC CACCATCAGA ATCGAGTTTT TGCTGGCTAA ACCAATCAGC    172260
     ATCAACAGCC CCACTTGGCA GTAAATGTCG TTGTACAAGC CCCGCATCCA TTGCACTGAT    172320
     AAGGCTCCCA TCACCGCCAG TGGAACCGAC AGTATGATGA TCAACGGATC GAAAAAATTA    172380
     TTGTACTGAG CCGCTAATAC CAGGAAGACG AAGAATACAC CCAAACCAAA GATTAACGGT    172440
     GCCTTTCCTC CAGACTCTAA TTCTTCCAGG GAAATCCCCG ACCACTCAAA CCCCATATTG    172500
     GGAGGAATGA TTTCAGCCGC TATTTTTTCC ATTGCCTGAA TCGCCTGACC GGAACTAAAT    172560
     CCAGGAGCCG CAGCACCATT AATCTCAATT GACCGATGCA GGTTGTAATG ATTAATCGTC    172620
     TGGGGTCCAG CAGTTGAAGT TATTGTCACC AGATTATTGA GAGGGATCAT TTCTCCCAGG    172680
     CGCGATCTCA CATACAACTG ACCGATATCT TCTGGGTTAG AACGAAACTG CTGGTCTGCT    172740
     TGAACATAGA CCCGGTAAGT GCGACCAAAG GCATTGAAAT CATTCACATA GCGGGAACCA    172800
     ATATAGGTTT GTAGGGTACT GTAAATCTCT TCTACAGGCA CCTGTAATGC TTCTGCCTTA    172860
     TTACGATCAA CCTCAATTTG TAACTGGGGT GCATTTGCTG TGTAGGTGCT GAAAACTCCC    172920
     TGGAGCTATG TTTATTTGTG GTGTATGAGC AAAGGAGAGG AAAGGGCGTA TCCTGCTGGA    172980
     TAAGCAAAAG TAAAAACCAG ACGAGGATAC CCCATGAGTA ACGACAATCT TATTGCATTT    173040
     CAAGCGCCAG ACCCTCCCGC ATCGTTTAGT GATGCCCTGA CAGAACTGGT CCGTAACGGT    173100
     GCTCGCCAAA TCATTGCTCA AGCTGTGGAG GCGGAATTGC AGGGGTTTTT AGCTCAGTAC    173160
     GAATCGCTTC AAGATGACCA GGGACGCCAA GCGGTGGTGC GCAATGGGTA TCTGCCTGAA    173220
     CGCACGATTG TGACTGGCGT GGGGGAGGTT GCCATTCAAG TGCCTAAGGT GCGCGACCGC    173280
     AGTGGTAGGG GGATCAAGTT CAATTCGACG CTGTTACCTC CGTACCTCAA ACGGGTCCAG    173340
     AGTGTGGAGG AGGTGCTGCC CTGGCTGTAT CTCAAGGGCA TTTCAACCGG GGATTTTTCC    173400
     GAAGCCTTGG CATCCTTGCT GGGAGCCCAA GCGGCAGGAC TTTCGGCCAG CACCATCAGC    173460
     CGCCTGAAAG CCAAATGGAT CAAAGAGCAC CAGCAATGGC AACAACGATC ACTACTGGGG    173520
     AAACGGTACG TGTATCTGTG GGCGGATGGG ATCTACTTCA ACATCCGCAA CGAGGACGAC    173580
     CGCCAATGCA TCCTTGTTGT CATCGGTGTC ACCAACACAG GCAGCAAGGA ACTGCTGGGA    173640
     TTGGAAGCCG GATTTCGAGA GTCCGAACTG AGTTGGAAGC CGTTGTTGTT ACGTCTGCAA    173700
     GACCAGGGGC TCAAACAGTC CCCCGAACTG GCGGTTGGAG ATGGCGCCTT AGGGTTTTGG    173760
     AAGGCGCTCG CGCAAGTGTT CCCGACCACT CGTGTCCAAC GCTGCTGGGT GCACAAAACT    173820
     GCTAACGTCC TCAACCACTT GCCCAAGGGT CAGCAACCCA AAGCCAAATC AGCCCTGCAT    173880
     GAGATCTACA TGGCAGAGAC TCAAGCTGAA GCACAGACAG CGTTTGACCG ATTTATCAAG    173940
     ACCTATGATG CCAAATACCC CAAGGCGGTG GCGTGTTTAT CCAAAGACCG TGAAGCCTTG    174000
     TTAGCCTTTT ATGATTTTCC GGCTGAACAT TGGGTGCACC TTCGCACCAC CAATCCCATT    174060
     GAATCCACCT TTGCGACGGT GCGCTTAAGG ACGGATAAAA CGCGAGGCTG TGTTTCACAG    174120
     GAGAGCATTT TGTCCTTGGT GTTCAAACTG GTACAAAGTG CCCAGAAACG GTGGTTACGC    174180
     ATTCGAGGCT TCAAACATTT AGCAGAGGTA ATTGAAGGAG TGAAATTCAA GGATGGCCTT    174240
     CGAGCAGACC AGCAACTCGA TTTCAAGGAC AGTAGGAACG CCGCTTAATT CTTCTTCATA    174300
     CACCAGATTT GACAATAACT CTGAATCCTC AAAGATGGTT ATCCAGTGGT AGCAATAGAT    174360
     AAAGCTCAAA GGAGATTGAT CCAATAATAG AGACATACAA GGAACTAACC TTTCATCAGG    174420
     CCCAAACAAT AAATATCGGT ATGACATGAA AATTCTGCAT CTAAATCTAT CCACAGGTAG    174480
     ATCCATACAA AGTCACCTAA CGTTGAGATA GATTTCAACT TGATTAACGA GGACAAAAGC    174540
     TGAAGGACTA ACTTTCCCCC TAATTTTTCC TTTGCCATTG TGGGGCTGCT TACCGATATA    174600
     ATGCTCGTTC CAGGGCTGCA AGCCGGAGTT ATTGTCCAAG CTGCTAACTG GGTTACCGCG    174660
     ACGATTCAAA CCCCCACGAA TGCTTCTGTA GCTCCCCGTT AAGGGCAAGT TGCCAAATCT    174720
     GAGATTTTTT AGCTGAAATA CTCGCTGTAT AAGTATTTTA GTAGTAGCGT CGCGTCTGGA    174780
     TATAGTTATG CAACTCGTTA GGCAGCAAGA GCTACACTCA AACTAAACTA GAACTCCTTG    174840
     CAGATCGTGA TCGACTGATT TCTTTTTCAC TAGGATTAGA AGCCGTCAGC AAAGGCTGAA    174900
     ACATCCGCCG ATATTGGCTT GGAGTTATTC CAGTGAGCCG CTTAAAGAGA CGTCTAAAAA    174960
     AAGAGACCTC TTCATAACCG ACCTCGTAAC AAATGCTTTC TACAGATTTG TCACTAACCT    175020
     CGAACTGATG TTTGGCCTCC TCAATTCGTA GGTTTTGCAA GTACTCGATT AAAGTGGAAC    175080
     CCGTAGCAGC CTTGAAACGC CGTTTAAGGG TACGTTCTGG AATTTTGGAC TGGCTCACTA    175140
     TTTGCTGAAT AGCATTACTT TCACGGAAAC ACTGCCGCAG TAATTGTTCG CAATTGGTTA    175200
     CGACAGAATC AGCATGGACG TGATTTCGAA TGAGGGTCTC GTAGGGTAGT TGCCCCTCGC    175260
     TATGCCACTT CAATAAGTAA ACCTTTGCAA TCCGTAACGC CTCTCCAGGA CTGCAATGCC    175320
     GCGAGATGAT GAAAATCGCC AAGTCATGCC ATGACGTTGT TCCCCCCGCC GTAACGATCT    175380
     GTCCAGAGGC ATCGGCAAAG GTGAGATTGG GGGCTGGTTT AAATCGAATG GTTGGAAAGC    175440
     GCTTTCGGAA TAAATCTTGA TACCCCCAGT GGGACGTGGC ATCGCAGCCA TCTAAGAGAC    175500
     CTGTGGATGC CAACATAATG GCACCAGAGC AGGCCGAGTA AATAAACGCT CCCTTGGCAT    175560
     GTTGCTGACA AATCCACTTC ATCAAGTCTG GATAACGACC TTGCATATCC TCATCAGGAC    175620
     CCAGCCAAAG CTCTGGAAGA ATGACTATCT CGGGGGTATA ACTATCTCGC ACAGAAAGAT    175680
     CAGGTCTCAC TGGAATACCA TTCCCACACA CGAACGGATC GCGCCTGACA GACAAAATAC    175740
     GAACCCTGAA TAGCCTGGCT GTTTCTTCAG ACCGCACGAG CGTTTGCCAA AGGTTTCCTG    175800
     CCGCTAAGAG CACATCGACC ATGCCGTAGA GGGCTGAACC AGCCGTTTCA GGGACAGCCA    175860
     CGATCGCAAC GTCAATGGGA GGTTTCTGAG GCAGTGTCAT GGAATTGTGG CTCCTCTCTG    175920
     GCACGAATGA ACCTTTTTTG TCTTAAACGC ATCTTACTGT ACCCTCGATG CCAGTCATAG    175980
     GATTAAAGCA AGAAAGGGGT AAGGTCCAAT TTCCCAAGCC CACACTATCA ACAATACAGA    176040
     GGATATAGAT CATGTCTCAG CAATTGATGA ATCAAACCAT GAACGGACTC AATGTAGACA    176100
     CTTTGGTGGT CACAGTTGAT GCGATCAAGC AAACTCCTTC ATTGGCTCAG TTTGAGTTTC    176160
     GGGCCACTAA TCAATGGATT AATGGAGGCG AAAATCGATC GCGAATCAAG GAGTTTTATG    176220
     GTGCGGGTCA AGAGGATGAA TCTCGCACAG AAGCCTTTGA GTTTACCAAC GGTGAGCCTC    176280
     CAGTCTTGCT GGGCGCAAAT GAAGGTGCCA ATCCAGTCGA GTACTTACTC CATGCTTTGG    176340
     CTGGATGTGT CACCACTACA ACGGTCGTAC ACGCCGCTGC TCGGGGCATT CAAATTGACA    176400
     GTATTTCGAC TAAACTGGTT GGACAGATCG ATTTACAGGG GTTTCTGGGG CTCAATGATT    176460
     CTGTACCAGT GGGTTACGAG ACCATTCAGA TTGAGATGGA TATTAAGGCT GACTGTAGTG    176520
     ACGAAGAGTT GAATGAACTT TTATCTTTTG CCAAGGACCA TTCTCCGGTG TGTAACACCG    176580
     TTTGCCGGCC GGTACCTGTG ACTTTAAAGC GAGTTAGCTA AACACCAACG CTTGTCTACC    176640
     TTCAAAACGG GGCAACTGGA CTGAATAACG ACCATAACTT CATTACCTGG CCATCATCGC    176700
     TTCACTATCC GGTTGCACCC AATGGAGATC AAAATTCTGA TTCAACCCAT GCAAGAGGAA    176760
     GCCGACCAAT GGACATTGAT TGTCTCCCGG CTCACCCCTG CTGAATTTGT CAAAACCTTG    176820
     GGTCAGGTAG CACTGACTGA TCAATCTCAA CTCGCAGAGG TTGATCAAGT CTACGGTCAT    176880
     TAAGGTCTTT ATTGCTAGCA GAGCAGGTTG ATTAGGAACT GAATTGGCTT GATCTAACCC    176940
     TAATTTTTAG TCAAAAGGAC GAATTACGAT GAAACTGAAT CACGTTACTC TCATTATTTC    177000
     TAATTTTGAG CGATCGCTCA CTTTCTACAA AACCTTAGGG TTAATCCAGA TCGTTCATGC    177060
     GCCTCCCAGA TATGCTCGTT TTCAATGTCC TGATGGTGAT GCAACGCTTT CCATCGAGGT    177120
     TACTGGGGAA TTACCCGCCC CACCCTGCGT CCAGATTTTT TTGGAATGTT CTGCTCTCGA    177180
     TCGCACTGTG GCTGATCTCA AAATCAGAGG CTTGATCTTT GAACAGGACC CAACCGACAT    177240
     GCCCTACCTG TGGCGTGAAG CACGGTTAAA AGATCCGGAT GGGCACGATA TTCGTCTTTA    177300
     CTTCGCTGGC GATAATCGAC TCAACCCTCC CTGGAAAATT GGTGGTTAAA GTTGAGTCAG    177360
     GAGCATGGTG TATGACGTTA CGACAAAAGT TATCACTACT GAGCGGTTGG AGCACCGAAA    177420
     TTCTGATTGA TGCTCCCCAG CAACTTGTAT GGGAGCGGAT CACCGACTTC GAGCGATATT    177480
     CCGAATGGAA CCCATTTATG TTAGAAGCTC ATGCCCAGTT TAAAGTGGGT TCAACCATTC    177540
     GCTTTCTTGA AGACCTGAAG CAATTTGGCC AACATTGGCT AACGGCAAAG TTTCTGGCGA    177600
     TCGCCCCACC GAATGAATTC ATCTGGCAAG GACACGTTGG TGCACCGTTT CTCTTTAGCG    177660
     TTCGTCATAC ATTCTGTCTA GAAACCGTCA GCGATACAGT CACACGGTTC ATTCAGAAAC    177720
     ATGAAAACTT TGGTGTCCTA GTTCCGTATC TGGCTTTGCG AGGGGTATAT CTTGTAAGTT    177780
     ATCAAGGATA TTTGGCTTAC AACCAAGCCT TAAAAGAGCG CTGCAGTGAG ACTGATCCGC    177840
     ATTTGTGGAT CGATTGCTAA GAACCAGACG CAGATAAGCT GAGTTTATCA TAGTACTTTT    177900
     GTTTGAAATC CAAGGTGAAG TTTTTGCGTC CTTTACCTGT TTGCTCACAT CATAACCAAC    177960
     GGCTAAATTT GGATGCTGCT GAGGAGTGAA AACCTTTCTG GAATGTGCTG CTAACAAGGT    178020
     TTCTAGCTGT CACCTGGCAT GTCGTTGCGG CTTCGCTTAC CCCAGGTTGA AACCGACATA    178080
     GACCTGACAC TACACAGTCA TTGCCTTGTC AAACTGGGTT GCTACTTTGG GACCATCAAA    178140
     CCCAGTTCTC AGGAGCACCC CAATCATGAA ACTCAGCTAT CGCGGCATTC AATACGACTA    178200
     CCACCCCCGG CCCGGCACTA CTGGCAAACC GGCTCCTGCG GCTCAAGCTC AACCCTATAC    178260
     CCTGACCTAC CGCGGCACCA GCTATCAGAT CAATCCTCGC GTTCCCAAAC CCCCGGCTGT    178320
     CAACTTCCCC AACGGCTACG AGTTAATCTA TCGGGGCAAT CGCTACTCTG TCCCCTCGAC    178380
     CCAGACCCTA CAACCTGCAG CGGTGCTGGC CCATTCCCTG TAAACATGAC AAGCCCAGCC    178440
     AATCACCGCC ATAAGCAGGA CTGCATACCA TATTTACCAA AATGCTTGCA ACTTTCTTAA    178500
     CATGGTGTTA CATCTAGTTT ACAAAGATTT ACAAAGCCTT ATAGGAGCAT CCACTATGAC    178560
     TTACACCGCT GATTCCGCCA TTGACTTCAA TGCTGTTGCC CGTGAACTGC TCAGTGCCCA    178620
     GCCTCTCCGC AGTGTTGCCA CCCCGGTTGC AGGACGCAGT AATGGCACAG AACTGGTTCC    178680
     CACCGAAGTA AATGCCCGAA TCCGGCGGGA AGGCCAAACC TTTGGTCGGT CTCTGGGATT    178740
     GGGTGCCACA GTGGATCGGG AAGGGTTGTC AAATAATTAC GCGGTTGAAC CCCAATCCTA    178800
     CCTGGCCCTC TACCCCTCCC CTAATGAACA GCGGGTTTAT TGGCTGCAAG GAGCTGCTGC    178860
     TTTAGTGTTG GTGACGCTTA CCCTGCTGAC AGCGGTTGCC GTGAGCTAAT TCCCTGGCTT    178920
     AATTGCACTC ATCAATTTAA CGGTTCTCCC GATAAACTGT CCCTGGCCTA ATATGCTGGG    178980
     GATTTTTATT AGCATGAGAT AGATTGCCAA ACTGATCAGA ACGACATAAT CATAAGCACG    179040
     CGATCGCTGA GTATTTAAGG TTTTGAGGCT AGCCAGAGTT GTCTGCAACT CCAGAGTGCT    179100
     GGTATTGATA TACTCACAAT CCAAAAATAG AAGCCGATCT TGAGCGATTG TAACTGTAAC    179160
     GTTGCACCTG CACCATCAGC GTAAACTCTC TGGTAAAAGA GAAAGAAAGT ATTCAATCCT    179220
     AGAACGATCG CTATGGTCCC CAGCACTGCA ACCCCTTTCC AGACTCGACC CCACCACAAC    179280
     CCGATACTGA TGATGTAAAG CGGATTTGCG TACCAACCAA CCTGATAGAA AAAAATTCCC    179340
     AGCCATCCCA TAAATAATAC TTGCCAACCA GGCCAGACTT CTATCCTTGG ACCACGGGAA    179400
     TGGAGAAACT CAAAGGCAGG AAAAGCAAGG GATAGCCCAT ACAGAATTAA GCTAATGAGA    179460
     CTTGGAAAAA GTACCTTTAA GTTTGATTTC ATGTTACAAC TATTTTCAAT TTAAAGTATT    179520
     TTTAATAGAA AGATTTTTCA TGGGAAATAA AGCTAATGCT ACAGCTACGC TATAGGCGAA    179580
     TACCAATCCT GGAAATGCAT TTTCTACAAA CGTCCAGTGC GAGACTTTGC CAGGTCCAGT    179640
     GCGAGGAGCA TTACCAATCA AAATTTGCAG ATTAGAATAA CAGGGAGAAC CTTCTTTTGC    179700
     TTGAAAACAA TTACCTGGAG ACACTAGAAT AGTTATGATT TGCAATAGTA AAACACAACC    179760
     CCAAATCCAT TTTTTTATTT GCACTTTCTT GTTTCGATTT TGCAATACAA TGATCCACAA    179820
     TATTAATAGA ACAGTGGCAT AAAATGGCAA AAGCAAAAAC AAATATACTA TCCCACCAAC    179880
     TATCGTATTA GAGGTGCTCA AGAATAGGAC ATAACTTAAG CCAAAATAAG CTGTTACCGC    179940
     TAAGCCATAT TGACCATATT TAATCATCAG TTT                                 179973
//

If you have problems or comments...

PBIL Back to PBIL home page