(data stored in ACNUC7421 zone)

HOGENOMDNA: CYTH3_1

ID   CYTH3_1; SV 1; empty ; DNA; empty ; PRO; 4433218 BP.
XX
AC   NC_008255;
XX
PR   Project: 57651;
XX
DE   Cytophaga hutchinsonii ATCC 33406, complete genome.
XX
OS   Cytophaga hutchinsonii ATCC 33406
OC   Bacteria; Bacteroidetes; Cytophagia; Cytophagales; Cytophagaceae;
OC   Cytophaga.
XX
RN   [1]
RP   1-4433218
RX   PUBMED; 17400776.
RA   Xie,G., Bruce,D.C., Challacombe,J.F., Chertkov,O., Detter,J.C., Gilna,P.,
RA   Han,C.S., Lucas,S., Misra,M., Myers,G.L., Richardson,P., Tapia,R.,
RA   Thayer,N., Thompson,L.S., Brettin,T.S., Henrissat,B., Wilson,D.B. and
RA   McBride,M.J.;
RT   "Genome sequence of the cellulolytic gliding bacterium Cytophaga
RT   hutchinsonii";
RL   Appl. Environ. Microbiol. 73 (11), 3536-3546 (2007)
XX
RN   [2]
RP   1-4433218
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-JUL-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4433218
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Brettin,T.,
RA   Bruce,D., Challacombe,J.F., Chertkov,O., Han,S., Tapia,R., McBride,M.J.,
RA   Misra,M., Myers,G.L., Thayer,N.N., Thompson,L.S., Xie,G., Gilna,P.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Lykidis,A.,
RA   Ivanova,N., Mavrommatis,K., Rubin,E. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (02-JUN-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000383.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351473
CC   Source DNA and bacteria available from Mark McBride
CC   Contacts: Mark McBride (mcbride@uwm.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Plasmid and fosmid libraries were prepared at the Joint Genome
CC   Institute (JGI) Production Genomics Facility (JGI-PGF) in Walnut
CC   Creek, CA. Shotgun sequencing was performed at the JGI-PGF to a
CC   coverage of 15x. Large (40 kb), medium (8 kb) and small (3 kb)
CC   insert random libraries were partially sequenced with average
CC   success rate of 90% and average high-quality read lengths of 634
CC   nucleotides. Finishing was performed at JGI-LANL starting with 29
CC   contigs and 2 scaffolds. Repetitive regions were identified,
CC   assembled and finished by manually checking paired reads close to
CC   each repeat in the assembly with consed and then making a
CC   subassembly for each repetitive region. 27 gaps were closed with
CC   primer walks and 2 by PCR. Gene predictions were obtained using
CC   Glimmer and tRNAs were identified using tRNAScan-SE. Basic analysis
CC   of the gene predictions was performed by comparing coding sequences
CC   against the PFam, BLOCKS and Prodom databases. Gene definitions and
CC   functional classes were added manually by a team of annotators at
CC   JGI-LANL, using BLAST results in addition to information from the
CC   basic analysis. A total of 3793 features have been annotated on the
CC   sequence record.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4433218
FT                   /strain="ATCC 33406"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cytophaga hutchinsonii ATCC 33406"
FT                   /db_xref="taxon:269798"
FT                   /db_xref="ATCC:33406"
FT   gene            173..850
FT                   /db_xref="GeneID:4186882"
FT                   /locus_tag="CHU_0001"
FT   CDS_pept        173..850
FT                   /locus_tag="CHU_0001"
FT                   /gene_family="HOG000030615" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="capsular polysaccharide biosythesis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:110636428"
FT                   /db_xref="GeneID:4186882"
FT                   /translation="MHSHLIPGIDDGSKSMEESLSLIQEFKKLGYKKIITTPHIMGDFF
FT                   KNSKETIFPGLIELRASIAEAGIDIEIEAAAEYYLDEWFIEKLERNEPLLKLGGNYVLF
FT                   ETSYMNRPTQLHQAIFLMRSLGYIPVLAHPERYTYLYEDFKLFKEIYEMDVLFQINLNS
FT                   LAGYYSKTAKLYAEKLIDNNMVDFVGTDCHGQRHIDVLAKVKVSNYYQKLQKLSILNNT
FT                   LIS"
FT                   /protein_id="YP_676635.1"
FT   misc_feature    173..844
FT                   /note="Capsular polysaccharide biosynthesis protein
FT                   [Carbohydrate transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane]; Region: CapC; COG4464"
FT                   /db_xref="CDD:34142"
FT                   /locus_tag="CHU_0001"
FT   gene            847..1815
FT                   /db_xref="GeneID:4186883"
FT                   /locus_tag="CHU_0002"
FT   CDS_pept        847..1815
FT                   /locus_tag="CHU_0002"
FT                   /gene_family="HOG000168005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:110636429"
FT                   /db_xref="GeneID:4186883"
FT                   /translation="MILVTGANGLVGSFLCNELAGKGYRVKALVREKSDTSLLKAVAGS
FT                   IELVYGDITDAGSLVDAMEDVMCVVHTAAVISFWNKKNKEMYQTNVVGTRNVVDVALEK
FT                   GVKKMIHISSIAAIGRKATDTRIDEKNNWEESAVNTAYAVTKHQAELEIFRAVEEGLHA
FT                   VIINPSVILGPGLKGTSSVRLFEYVQQKGKFYTDGDLNYVDVRDVVESIEYFISHETPA
FT                   GERYILNGGTVSFKTFFEKIAEMLHTNPPSVKASDWMKQIVWRVEAIKAFITGKEPLIT
FT                   KSTARTATNKFEYSADKIMQLSQRSFRPLQDTIYWTCKQLF"
FT                   /protein_id="YP_676636.1"
FT   misc_feature    847..1617
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="CHU_0002"
FT   misc_feature    853..1794
FT                   /note="hopanoid-associated sugar epimerase; Region: HpnA;
FT                   TIGR03466"
FT                   /db_xref="CDD:163279"
FT                   /locus_tag="CHU_0002"
FT   gene            1955..3355
FT                   /db_xref="GeneID:4186884"
FT                   /locus_tag="CHU_0003"
FT   CDS_pept        1955..3355
FT                   /locus_tag="CHU_0003"
FT                   /gene_family="HOG000103067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:110636430"
FT                   /db_xref="GeneID:4186884"
FT                   /translation="MARQNKRQSDDRELARKFEELLKEGTPGFFDVSVYESIIQYYLEG
FT                   TKFRKAHRTCDIAMEQHPYSVEIMLLKVQVLMQMTQFEEALEILDRAQLYQPNDTDIQL
FT                   LRANIMAQQDDFEGAIELLEEILTLAEEKDEIHYHMGVIYQDMGNFEESINHLKEAIML
FT                   NSQHEDAIYELSYSLEVLDRLEESIDFFKQLIEKDPYSHFAWFCLGVSYFKQGKLDEAL
FT                   DAYEFVIAINDKYSSAYYNIGECYVYKNEYEKALEYFFQTMDMEDKTADVFYNIGFCYE
FT                   HLGMHPKAIEFYRKASKADAYFHEAYYGIGKCLEAQDKSYESIHFFKRALKLDEANAEY
FT                   WLAKANAEYKTGNIISSLEAFEEACVLEPSNPEVWKNWSFVHYESGDMDKAIDLINAGI
FT                   DEMPGNADLYYRAVAYLITAGRYKEAFNYLENALTLNFDSHTVLFEFFPKLETQKALFR
FT                   IIDQYRNK"
FT                   /protein_id="YP_676637.1"
FT   misc_feature    <1958..2299
FT                   /note="Putative Zn-dependent protease, contains TPR repeats
FT                   [General function prediction only]; Region: COG4783"
FT                   /db_xref="CDD:34394"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    2153..2452
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2153..2158,2162..2167,2174..2179,2264..2269,
FT                   2273..2278,2285..2290,2366..2371,2378..2383,2390..2395)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2171..2173,2207..2209,2219..2221,2228..2230,
FT                   2273..2275,2309..2311,2321..2323,2330..2332,2375..2377,
FT                   2411..2413,2423..2425,2432..2434)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    2357..2650
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2357..2362,2366..2371,2378..2383,2468..2473,
FT                   2477..2482,2489..2494,2570..2575,2582..2587,2594..2599)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2375..2377,2411..2413,2423..2425,2432..2434,
FT                   2477..2479,2513..2515,2525..2527,2534..2536,2579..2581,
FT                   2615..2617,2627..2629,2636..2638)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    2564..2854
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2564..2566,2570..2575,2582..2587,2672..2677,
FT                   2681..2686,2693..2698,2774..2779,2786..2791,2798..2803)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2579..2581,2615..2617,2627..2629,2636..2638,
FT                   2681..2683,2717..2719,2729..2731,2738..2740,2783..2785,
FT                   2819..2821,2831..2833,2840..2842)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    2765..3064
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2765..2770,2774..2779,2786..2791,2876..2881,
FT                   2885..2890,2897..2902,2978..2983,2990..2995,3002..3007)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2783..2785,2819..2821,2831..2833,2840..2842,
FT                   2885..2887,2921..2923,2933..2935,2942..2944,2987..2989,
FT                   3023..3025,3035..3037,3044..3046)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    2969..3262
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2969..2974,2978..2983,2990..2995,3080..3085,
FT                   3089..3094,3101..3106,3182..3187,3194..3199,3206..3211)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   misc_feature    order(2987..2989,3023..3025,3035..3037,3044..3046,
FT                   3089..3091,3125..3127,3137..3139,3146..3148,3191..3193,
FT                   3227..3229,3239..3241,3248..3250)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="CHU_0003"
FT   gene            3357..4127
FT                   /db_xref="GeneID:4186885"
FT                   /locus_tag="CHU_0004"
FT   CDS_pept        3357..4127
FT                   /product="phosphosulfolactate synthase"
FT                   /gene_family="HOG000223610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="CHU_0004"
FT                   /EC_number="4.4.1.19"
FT                   /db_xref="GI:110636431"
FT                   /db_xref="GeneID:4186885"
FT                   /translation="MYQNFTLSKVPERTTKPRESGFTMVMDKGLSCREVEDMLSVSSNY
FT                   IDIVKLGWATSFVTPTLKEKLALYKSAGIPCYLGGTLFEAFIVRDQFDDYRKLLDKYDL
FT                   GYAEVSDGSIELGHAEKCEYIAKLAKQVTVLSEVGSKDAEKIIPPSKWIKLMNTELEAG
FT                   AWKVIGEAREAGNVGLFRSTGEVRSGLVEDILSAVPVEKIIWEAPQKEQQVFFVKLCGA
FT                   NVNLGNIAPNELIPLETVRLGLRSDTFHHFIDKL"
FT                   /transl_table="11"
FT                   /protein_id="YP_676638.1"
FT   misc_feature    3381..4097
FT                   /note="(2R)-phospho-3-sulfolactate synthase (ComA); Region:
FT                   ComA; cl00782"
FT                   /db_xref="CDD:163907"
FT                   /locus_tag="CHU_0004"
FT   gene            4137..4793
FT                   /db_xref="GeneID:4186886"
FT                   /locus_tag="CHU_0005"