(data stored in ACNUC7421 zone)

EMBL: D38161.MTLA

D38161.MTLA          Location/Qualifiers
FT   CDS_pept        249..2081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /product="mannitol-specific phophotransferase enzyme II"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /protein_id="BAA07350.1"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFGIRINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGIFLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPGPDSRSHC
FT                   RRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEKRLSCLLKARTKLSFRVIRD
FT                   GIKCHGGIHLKKQSEKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHIS
FT                   VDNFLNSPKYDELIEKLKSNLIEREYCHASTRKGNIKLNQTVSSKEEAIKLAGQTLIDN
FT                   GYVTEDYISKMFDREETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGN
FT                   TAKVVFGIAGKNNEHLDILSNIAIICSEEETLNA"
     atgcagcagc aagaacagca gcaaggcggc atgaaagtga aagtgcaacg ctttgggagt        60
     tatttgagcg gaatgatcat gccgaatatc ggcgcgttta tcgcgtgggg tatcattacc       120
     gcgctgttta ttccggcagg atggtttccg aatgaacagc tgaacacgct ggtcagcccg       180
     atgattacgt atttattgcc gcttttgata gcgtatacag gcggaaaaat gatctacgac       240
     caccgcggcg gagttgtcgg agcgacagcg gcaattgggg tgattgtagg atcggatatt       300
     ccaatgtttt taggcgcaat gattatgggt ccgcttggcg gatacctcat taaacagact       360
     gataaattat tcaaggataa agtcaagcaa ggctttggaa ttcggatcaa caactttacg       420
     gcagggattg tcggcgcggc tttaacgatt ctcgcgtttt acgccatcgg cccggttgtt       480
     ttgacgctaa ataaattgct ggcggctggt gtggaagtca ttgtacacgc taatttactg       540
     ccggtagcca gtgttttttt agaaccggcg aaagtgttgt tccttaacaa cgccataaac       600
     catggaatct taagcccgat cggaatcgag caagcatctc aaacaggaaa atcaattctg       660
     tttttagtag aagcaaaccc tggaccgggg ctcggcattt tcctggccta catgttcttt       720
     ggcaaaggat cttcaaaatc aacggctccc ggtgcggcga tcatccattt cttcggaggg       780
     attcacgaga tttacttccc gtacattctg atgaaacctg gccctgattc tcgcagccat       840
     tgccggcgga gcaagcggac tcttaacatt acgatcttta atgccggact tgtcgcggca       900
     gcgtcaccgg gaagcattat cgcattgatg gcaatgacgc caagaggagg ctatttcggc       960
     gtattggcgg gtgtattggt cgctgcagct gtatcgttca tcgtttcagc agtgatcctg      1020
     aaatcctcta aagctagtga agaagacctg gctgccgcaa cagaaaaaat gcagtccatg      1080
     aaggggaaga aaagccaagc agcagctgct ttagaggcgg aacaagccaa agcagagaag      1140
     cgtctgagct gtctcctgaa agcgcgaaca aaattatctt ttcgtgtgat ccgggatggg      1200
     atcaagtgcc atgggggcat ccatcttaag aaacaaagtg aaaaagcgga gcttgacatc      1260
     agtgtgacca acacggccat taacaatctg ccaagcgatg cggatattgt catcacccac      1320
     aaagatttaa cagaccgcgc gaaagcaaag ctgccgaacg cgacgcacat atcagtggat      1380
     aacttcttaa acagcccgaa atacgacgag ctgattgaaa agctgaaaag taatcttata      1440
     gaaagagagt attgtcatgc aagtactcgc aaaggaaaca ttaaactcaa tcaaacggta      1500
     tcatcaaaag aagaggctat caaattggca ggccagacgc tgattgacaa cggctacgtg      1560
     acagaggatt acattagcaa aatgtttgac cgtgaagaaa cgtcttctac gtttatgggg      1620
     aatttcattg ccattccaca cggcacagaa gaagcgaaaa gcgaggtgct tcactcagga      1680
     atttcaatca tacagattcc agagggcgtt gagtacggag aaggcaacac ggcaaaagtg      1740
     gtattcggca ttgcgggtaa aaataatgag catttagaca ttttgtctaa catcgccatt      1800
     atctgttcag aagaagaaac attgaacgcc tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page