(data stored in ACNUC7421 zone)

EMBL: D38161.PE10

D38161.PE10          Location/Qualifiers
FT   CDS_pept        8978..9517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07359.1"
FT                   /translation="MTKSSVVGILITSVMRIALFFAVLGVVSKGLHIDESNPAASVFKL
FT                   AAGNVGYKIFGLIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAF
FT                   VTIGQPAKILVLVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMA
FT                   VMGIYTLCTQLPQLWS"
     gtgacaaaga gctcggttgt cggcatttta attacatctg tcatgcgtat cgctcttttt        60
     tttgcggttc taggcgttgt atcgaaaggc ctgcacatcg atgaaagcaa cccggcggct       120
     tctgtcttca agctggctgc tggaaatgtc ggttataaaa ttttcggatt gatcatgtgg       180
     tctgcggcga ttacgtctgt tattggagca gcctatacat ctgtttcatt ttttaaaacc       240
     ttttctccaa aaattgaaaa gaattcacgc ggtattatta tcggatttat tgtggtttct       300
     acgttagctt ttgtcacaat cggccagcct gcgaagatcc tcgtccttgt gggttcactg       360
     aacggcttaa ttctgccgat tgcgctcgga acgctgcttg ttgccgccta caagaaaaac       420
     attgtcggtg attataagca tccgctttgg ctgacaagca caggcgcgct tgtagtgatt       480
     gtaatggcag ttatgggaat ctacacgtta tgtacacaac ttcctcaatt gtggagctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page