(data stored in ACNUC7421 zone)

EMBL: D38161.PE11

D38161.PE11          Location/Qualifiers
FT   CDS_pept        9541..10314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42966"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42966"
FT                   /protein_id="BAA07360.1"
FT                   /translation="MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLF
FT                   CQRNQKPCPVLDVTEAGSPVPSLLRRMLISRTDFPKYRIYRHGILTEEVSDITPYWEDD
FT                   FVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCFPVGAFHGQMVVSMRPVP
FT                   ERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGV
FT                   TPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
     atggcgccaa aggatgtacg cgccctgata cgagagggga aaataaacgg gccgaccgca        60
     ggcatgtccg gcggctacgc ccaagcgaat cttgtggttt tgaaaaagga ccttgcgttt       120
     gattttctgc tgttttgcca gcgaaatcaa aagccctgcc ccgtgctgga tgtgactgaa       180
     gcaggttcgc ctgtgccgtc tctgctgcgc cggatgctga tatccagaac ggactttccg       240
     aaataccgta tttacaggca cggtatccta acggaagaag tatctgatat tacgccatac       300
     tgggaggacg attttgtcgg ctttctgatc ggatgcagtt tctcctttga acaggcactg       360
     atcaataatg ggatagctgt ccggcatatt gatgagggga caaacgtctc aatgtataaa       420
     acgaatatcg attgttttcc ggtgggggcg tttcacggac agatggttgt cagcatgagg       480
     ccggttcctg aacggctggc tgtacgtgct gcacaagtga cctcgcgttt tccggctgtg       540
     cacggagggc cgatccatat tggcaatccg ggagcaatcg ggattcgcga tctcgggaaa       600
     ccggatttcg gagatgccgt ttccattcgt gacggcgagg ttcctgtttt ttgggcatgc       660
     ggagtgaccc cgcaagccgt ggctatgaat gtaaagcctg aaatggtcat cacacatgcg       720
     ccggggcata tgctcatcac agatattcga gacgagtcgc ttgcggtgct gtag             774
//

If you have problems or comments...

PBIL Back to PBIL home page