(data stored in ACNUC7421 zone)

EMBL: D38161.PE13

D38161.PE13          Location/Qualifiers
FT   CDS_pept        12107..12850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="regulatory protein for aceAB"
FT                   /db_xref="GOA:P42968"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42968"
FT                   /protein_id="BAA07362.1"
FT                   /translation="MMQNKNKTVVKSMALLNLFLHKPSLTLSELVSLTGMPKTSVHRMV
FT                   SSLEEMGFLSRDASGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIM
FT                   RDGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIEAYIKQTELIS
FT                   IGSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHERQVAAGISIAGFE
FT                   ARFTEDRLPYLTEKVKDAALQISRK"
     atgatgcaga ataaaaataa aaccgtagtc aaatctatgg cgctgcttaa tttgtttttg        60
     cataaaccaa gcctaacctt aagtgaactg gtgtcgctga cgggaatgcc gaagacctct       120
     gttcaccgga tggtcagctc cttggaggaa atggggttcc tcagtcggga tgcgtccggc       180
     gcttattcgc tgggattggt gtttttggaa ttcggacagc ttgtcgctga caggctggat       240
     atcagaaaaa tagcgaaacc ggtgatggaa gagctgtgcc gggaagtgga tgaggccgtg       300
     cagttgatca tgagggacgg caatgaagcg atatacgttg agaaaataga agggacacag       360
     actgtgcggc tgtatacggc gatcggcagg cgttcccccc tatacgcggg agcgtgcgcc       420
     agaagcattc tgtcctttct tccccgtgaa gaaatcgaag catacatcaa acaaaccgag       480
     ctcatttcga ttggctccgg aacgattacc gatcccgaaa aactgcttca ggagattgat       540
     gcctctgtgc aaaatggcta tactgtcagc tattcagagc tcgaaaacta tacggcggcg       600
     atcggcgccc cgatctttaa ccatgagcgc caggtggcag ccggcattag cattgcaggc       660
     tttgaagcga gatttacaga agacaggctg ccctatttaa cagaaaaggt gaaggacgcc       720
     gctttacaga tttcaagaaa atag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page