(data stored in ACNUC7421 zone)

EMBL: D38161.PE14

D38161.PE14          Location/Qualifiers
FT   CDS_pept        12925..13566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /protein_id="BAA07363.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
     atggtgcttc gatatacagc tctgggcgat tccttgacga cagggagagg ctccgggctg        60
     ttttcacccg gcttcgtcca gcgttttggg gacatgatgg aagctgactt gaaaacaaga       120
     acggcaataa acatatttgc cagatcaggt ctgaatacag aagagatttt gggactcctg       180
     tcatatccct atgtgcaaaa atgtattcga gatgctgata tgataacgat cacagggtgc       240
     ggaaacgatc tcatcgattc ggtcttagcc taccaaacct ctaaggatga aacgattttc       300
     agccgtgtat ccgcccattg ccatgagaat tttgaaaaga tgattgccaa agtcgccgag       360
     attaaaggag aaaatccttc cccgtacgcc attcgtgtgt tcaacttata caatccgttt       420
     cccgaaattg atatcgccgg caaatggatc acttcgttta attcacattt agaaacactt       480
     gcatcagcac cccatgtcaa aatcgcggat gcctatagca tcttcaaagg caaagaacag       540
     gaatatctgt cctttgacgg tgtccatccg aacagcaaag gctatcaagc gatggctgaa       600
     gccgttcaca agctaggcta taaagaatta tcagtttcat ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page