(data stored in ACNUC7421 zone)

EMBL: D38161.PE15

D38161.PE15          Location/Qualifiers
FT   CDS_pept        13755..14069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /protein_id="BAA07364.1"
FT                   /translation="MSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERK
FT                   KENDGSGAFNIYTAVLYGLSPLSVLHFILYKSILHILKMLDRRERGIEPMKQGFPLLIL
FT                   "
     atgtcttttg cggttatcat tattatactg gcgcttattg cttttaacta tacggaacac        60
     acctctgtaa tccaatcggt catgctcgtc tttcttggtg cggtcatgtt tatgcagggg       120
     cttgaagagc gcaaaaaaga aaatgacggc tcaggcgctt ttaatattta taccgccgtt       180
     ttgtatggtc tgtctccctt atcggtttta cacttcatat tatataaatc tatattacac       240
     atcctgaaaa tgctcgaccg tcgggaacgg ggtatagaac cgatgaagca aggctttcca       300
     ctcttgatac tctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page