(data stored in ACNUC7421 zone)

EMBL: D38161.PE5

D38161.PE5           Location/Qualifiers
FT   CDS_pept        5399..5845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JMQ0"
FT                   /protein_id="BAA07354.1"
FT                   /translation="MMKRVAYPGTVITNRSAHLRHTAAFPCDSSPHAESNHKDVPSGVL
FT                   PDHRLDDGFSRFQPFVFCKLFVCRFFFFQCVDFILAEQVGRQHIISSHFDQPAHLFHMA
FT                   VYTIYFVCENDKRFWEHNGLLLCFFHYILSFHFRLRYNGQKKEI"
     gtgatgaaga gagtcgcgta tccgggaacc gtaataacaa accgatccgc tcacctcagg        60
     catactgctg catttccatg cgatagtagc ccccacgctg aatccaatca caaagatgtg       120
     ccgtccggcg ttttgcctga tcacaggctg gatgatggtt tctcccgttt tcagcctttc       180
     gtgttttgta aattgttcgt atgccgtttt ttcttctttc agtgtgtaga cttcatcctc       240
     gccgagcagg ttgggcgtca acacatcata tccagccatt ttgatcagcc ggcccatctt       300
     tttcatatgg ctgtttacac catatatttc gtgtgcgaga atgacaagcg gttttgggaa       360
     cataacggcc tccttttgtg ttttttccat tatatcctat cgtttcactt taggctgaga       420
     tataatggtc aaaaaaagga gatataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page