(data stored in ACNUC7421 zone)

EMBL: D38161.PE6

D38161.PE6           Location/Qualifiers
FT   CDS_pept        5847..6359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /protein_id="BAA07355.1"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEGLRKPRLLQELQMRTAWDYCLRKRKSWEKLCLVTGLILRLKSRAIGAGLC
FT                   SDMPRHQLESSLLLKLKSASILKNEKNPSQHFVRGSILCRNPVRFESYLFAGVCVFHHS
FT                   YFPSALH"
     atgaactcat tatctttgcc tcaccgctat ccatttttgt ttattgatgg cgtgacggat        60
     agcgagcccg gcaaacatgc ggcagcttat aagctgatta gtgagaacga ctggtttatc       120
     actgatacgc aaacagaaat gccgttttca cttgtgattg aaggcttgcg caaaccgcgg       180
     cttttacagg aattacagat gagaacagct tgggattatt gtcttcgaaa gcggaaaagc       240
     tgggagaagc tgtgcctggt gaccggcttg atcttacgtt tgaagtcacg cgcaatcggc       300
     gcgggtttgt gttcggacat gccaaggcat cagttggaga gcagcctgtt gctgaagctg       360
     aaatcggcat ctatattgaa aaatgaaaaa aacccttcac aacattttgt gaggggttct       420
     attttgtgtc gtaatcccgt tcgctttgag agttatctct ttgctggcgt ttgtgttttt       480
     catcattcat attttccttc agctcttcat tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page