(data stored in ACNUC7421 zone)

EMBL: D38161.PE7

D38161.PE7           Location/Qualifiers
FT   CDS_pept        6562..7311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="similar to hypothetical 29,7 kDa E. coli protein"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /protein_id="BAA07356.1"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKTKSSEITNS
FT                   SPTNIEVNALGINKAAAPCQGYGKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
     atgtctgtcc aaagagaaga tgtagatatc aagctgatcg caattgatat ggatggtaca        60
     ctgctgaacg acgagcagct gatctcggat gaaaaccgca aagccattcg tgaagcggag       120
     gataaaggtg tgtatgtggt gatcagcacg ggccggacgc tgatgacgtg cagggagctg       180
     gcggaatcgc taaagctgtc atcctttcta atcacggcaa acggcagtga aatttgggat       240
     tcgaatttta atttggtgga acggaagctg cttcatacgg accatattca aatgatgtgg       300
     gatttgcgga ataagcacaa cactaatttc tgggcttcta cggtgaataa agtatggaga       360
     ggcgagtttc cggaaaacat tacggatcat gaatggctca aattcggctt tgacatcgag       420
     gatgacgata tccgaaacga agtgcttgag gagctgagga aaacaaagag ctctgaaatc       480
     acaaattcaa gtccgacaaa cattgaagtc aacgcgcttg gcatcaacaa agctgcagcc       540
     ccttgccaag gttacggaaa actcggcttt acaatggaga atgtgatggc gatgggcgac       600
     agccttaatg acattgcgat gatcaaagaa gcgggtcttg gcgtcgcaat gggcaatgcg       660
     caagacatcg taaaagaaac ggctgattat atcacggata caaatattga ggatggtgtc       720
     gctaaagcga ttcgccattg ggtactataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page