(data stored in ACNUC7421 zone)

EMBL: D38161.PE8

D38161.PE8           Location/Qualifiers
FT   CDS_pept        7651..8151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lactam utilization protein"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /protein_id="BAA07357.1"
FT                   /translation="MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVY
FT                   QIGALSGFLKAEGLHMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESE
FT                   LVKAGERIGLQTANEVFADRTYQSDGTLTPAPSRTHSLKVMMPRHPGHQNGERRGGQIS
FT                   ARP"
     atgcgaaaaa ccgtcgcgct tgcagcagaa agaggcgtga aaatgggtgc gcatccgggc        60
     ttgccggatt tactcggttt tgggcgccgc aatatggcga tttctcctga ggaagcgtat       120
     gatcttgtcg tttatcaaat tggcgcgctc tctggctttc taaaagcaga gggacttcac       180
     atgcagcacg tcaagccgca tggcgcttta tacaatatgg cggcagtcga tcaaaaactg       240
     tcggatgcta tcgcgaaagc tgtctataag gttgatcccg gcctgattct tttcggtctt       300
     gctgagagcg agcttgtaaa agcgggagaa cggatcggac ttcagaccgc aaatgaagtg       360
     ttcgccgaca gaacatacca atcggacggc acgctgacac cggctcccag ccggacgcac       420
     tcattgaaag tgatgatgcc gcgtcaccca ggtcatcaaa atggtgaaag aaggggcggt       480
     caaatttcag caaggccatg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page