(data stored in ACNUC7421 zone)

EMBL: D38161.PE9

D38161.PE9           Location/Qualifiers
FT   CDS_pept        8350..8688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07358.1"
FT                   /translation="MLMGAAFLMATSAIGPGFLTQTATFTNTLAASFGFVILISIILDI
FT                   FAQTNVWRIIAVSGKRGQEIANMVLPGLGYSIAILVVLGGLAFNIGNIGGAGWDFRCCS
FT                   ALHLKQAL"
     ttgctgatgg gcgccgcctt tttaatggcg acatcagcaa tcggaccggg tttcctcacc        60
     caaaccgcaa cattcacaaa cacactcgca gcaagcttcg gttttgtcat cttaatctct       120
     attattttag atattttcgc ccaaaccaat gtgtggcgca tcatcgcagt ttctggaaaa       180
     cgaggtcagg aaattgcgaa tatggtgctt cccggactgg ggtattccat cgccattctc       240
     gtcgtgcttg gcggactagc ttttaatatt gggaatatcg gaggggcggg ctgggacttc       300
     aggtgctgtt cggcattaca cctgaaacag gcgctttaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page