(data stored in ACNUC7421 zone)

HOGENOMDNA: DEIDV_3

ID   DEIDV_3; SV 1; empty ; DNA; empty ; PRO; 396459 BP.
XX
AC   NC_012528;
XX
PR   Project:58615;
XX
DE   Deinococcus deserti VCD115 plasmid 3, complete sequence.
XX
OS   Deinococcus deserti VCD115
OC   Bacteria; Deinococcus-Thermus; Deinococci; Deinococcales; Deinococcaceae;
OC   Deinococcus.
XX
RN   [1]
RP   1-396459
RX   PUBMED; 19875382.
RA   Baudet,M., Ortet,P., Gaillard,J.C., Fernandez,B., Guerin,P., Enjalbal,C.,
RA   Subra,G., de Groot,A., Barakat,M., Dedieu,A. and Armengaud,J.;
RT   "Proteomics-based refinement of Deinococcus deserti genome annotation
RT   reveals an unwonted use of non-canonical translation initiation codons";
RL   Mol. Cell Proteomics 9 (2), 415-426 (2010)
XX
RN   [2]
RP   1-396459
RX   PUBMED; 19370165.
RA   de Groot,A., Dulermo,R., Ortet,P., Blanchard,L., Guerin,P., Fernandez,B.,
RA   Vacherie,B., Dossat,C., Jolivet,E., Siguier,P., Chandler,M., Barakat,M.,
RA   Dedieu,A., Barbe,V., Heulin,T., Sommer,S., Achouak,W. and Armengaud,J.;
RT   "Alliance of proteomics and genomics to unravel the specificities of
RT   Sahara bacterium Deinococcus deserti";
RL   PLoS Genet. 5 (3), E1000434 (2009)
XX
RN   [3]
RP   1-396459
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-396459
RA   De Groot,A., Dulermo,R., Ortet,P., Blanchard,L., Guerin,P., Fernandez,B.,
RA   Vacherie,B., Dossat,C., Jolivet,E., Siguier,P., Chandler,M., Barakat,M.,
RA   Dedieu,A., Barbe,V., Heulin,T., Sommer,S., Achouak,W. and Jean,A.;
RT   "Direct Submission";
RL   Submitted (09-JUL-2008) DSV, EBEB, SBVME, LEMIRE, CEA, CEA Cadarache,
RL   Saint Paul Lez Durnance 13108, France
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001117.
CC   Genome sequencing was performed by Genoscope, www.genoscope.cns.fr.
CC   Source DNA is available from de Groot at nicolaas.degroot@cea.fr.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..396459
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:546414"
FT                   /note="type strain of Deinococcus deserti VCD115"
FT                   /strain="VCD115"
FT                   /plasmid="3"
FT                   /organism="Deinococcus deserti VCD115"
FT   gene            160..945
FT                   /db_xref="GeneID:7740518"
FT                   /locus_tag="Deide_3p00001"
FT   CDS_pept        160..945
FT                   /locus_tag="Deide_3p00001"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase involved in plasmid/chromosome
FT                   partitioning, ParA/Soj-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357667"
FT                   /db_xref="GeneID:7740518"
FT                   /translation="MTKVITFFSNAGGVGKTSATRDFGYELSQQGYRVLLIDLDSQANL
FT                   TDWLGATVDESLDLEQEKNFTMFNAIINGAPLPVPVTRHGMDIIPSGISITEIEGILPN
FT                   KPLGGENLLRKALAPVKQEKQYDFILIDSPPTLGKIVNLCLMASDEIVVPVSSRNKGYK
FT                   AVAMVHKKIADFRENNPSLNVATHLITQLNNTSHSKITDEVARQTLKNVSGPLRHRPAV
FT                   YDNCQLAMMPVGAYEPNGEARKEVMAAVQQMLTYIGVSA"
FT                   /protein_id="YP_002787406.1"
FT   gene            942..1832
FT                   /db_xref="GeneID:7740172"
FT                   /locus_tag="Deide_3p00010"
FT   CDS_pept        942..1832
FT                   /locus_tag="Deide_3p00010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB-like partition protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357668"
FT                   /db_xref="GeneID:7740172"
FT                   /translation="MSPKPDIRASLLNSKTSKEAVYNQRSKTILEVPLDQVVPFSGQAR
FT                   RYFDHDSIKALADSIEKHGQLSPLLVWRNNDEQYEIIAGERRWKALRMLKRRVALADVI
FT                   MDVTRDQAFEIALVDNLQRENLNRYEEVRAKLDLIARRLMMTPDDARAELLRLRNGTSS
FT                   NTQHLVIVEEVLKMAGNESLQSFVANGFPVLDLPQVLRQAVEDGSLHPSKATVIKGAPE
FT                   EHHAVLIQQTVEEKLTRQQVLDRVRALAAPKGITYRSNADAVRKLLTPSRLKTLDTARR
FT                   NELETLLAKVKSLLQ"
FT                   /protein_id="YP_002787407.1"
FT   gene            2633..4579
FT                   /db_xref="GeneID:7740173"
FT                   /locus_tag="Deide_3p00030"
FT   CDS_pept        2633..4579
FT                   /locus_tag="Deide_3p00030"
FT                   /gene_family="HOG000099223" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidine kinase, classic"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357669"
FT                   /db_xref="GeneID:7740173"
FT                   /translation="MTANETPQLQDLELVQLINGIVWEADPVTRVNTFVSDRITSLLGY
FT                   TPEQWRSPGFWEAHIHPDDQARIVAEGEALMGRGQPYQLEYRMTRADGQTMWLRDLITP
FT                   VFRGGVMVKLGGVMLDITAEKNAQAELLAARARFSRIIESSPVGMVLSDIKTSRVLETN
FT                   DAFLRIINCPRAIFMGEEDDFNPWVSADDRAELVRRLKEDRTVRDFETLHKRRLTGEQR
FT                   NVLISAEYLEMDGQETLLVMAQDITDRKASEMALEESRRTFEALFEHSPDAIKLIDFDT
FT                   EEMPILQCNKVAARMSGYTREEIIGKSAYATLPDDQRAAILASGDAEFRASLESELEMR
FT                   FESVQQRKDGSLYPVDINLALLTVGDKRVVLSIERDMTARKKAEAELKSSQERLLLSEK
FT                   LASLGRLTAGLAHEINTPLAAAMNYLHEAERLAREYQASIGEASVTDDDHREIAGELIS
FT                   TLGEGAKTATRIGEFIRRMREHTRDTVTGVLDFDAGRGAEATLTMLTHQARAANVELIF
FT                   EAPEQLVVLRGEPGRFTQVVTNLVVNAIHACEGTSQQAGTVTVRLFEQLGHPVLQVQDT
FT                   GTGISPEVLPKIFDPMFTTKDVGKGTGLGLSIIHDIVTGHFGGEISVQTSIGEGSTFSV
FT                   SFPRRTRSEALAG"
FT                   /protein_id="YP_002787408.1"
FT   gene            complement(5103..5357)
FT                   /db_xref="GeneID:7740174"
FT                   /locus_tag="Deide_3p00040"
FT   CDS_pept        complement(5103..5357)
FT                   /locus_tag="Deide_3p00040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357670"
FT                   /db_xref="GeneID:7740174"
FT                   /translation="MLAAYVEMKLMELGNDTSVAVETGNLSSPRRDVTDRKRTTSSAHV
FT                   FRYASVMTARYQTEKAFKGAGLIFRGFHPARRYAGGHLL"
FT                   /protein_id="YP_002787409.1"
FT   gene            complement(5710..7002)
FT                   /db_xref="GeneID:7740175"
FT                   /locus_tag="Deide_3p00050"
FT   CDS_pept        complement(5710..7002)
FT                   /locus_tag="Deide_3p00050"
FT                   /gene_family="HOG000271725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357671"
FT                   /db_xref="GeneID:7740175"
FT                   /translation="MNGELAASFALGVANEATGQPLTPRHLFRIASHSKTFTATAVFQL
FT                   VETGALRLDDLAGLWLPELAGSPAAGLTVRALLGHQSGINRDGADSDYWQQLCDFPNRD
FT                   ALITLCRADAVFAPDQFFKYSNMGYSLLGLIIEAVSGQTYEEYIAAHITGPLTLTNLGP
FT                   ELPLERESELAAGHSGRLAGNDARRVLPSTDTRAMAAATGFYGTAEDVTAYLAAHAMGL
FT                   DELLTDASKRLMQRKESEIRRPVKRWYGLGFIVEEIGDRLVVGHSGGFPGHITQSWLDP
FT                   ESGLTVSVLTNCLGGPATEWATNLIKLIDLAMNLSEKKTSDGSVFNLDSYTGRFATDWG
FT                   VFDLVDLGGRLVSLAPQGDPALSVTELTVVDANTVTPKPEAGFGSVGEPFQFQRTAAGD
FT                   IEWVRQGGGRAWPIAAYRQRVGLAPLASTVR"
FT                   /protein_id="YP_002787410.1"
FT   gene            complement(7271..8299)
FT                   /db_xref="GeneID:7740176"
FT                   /locus_tag="Deide_3p00052"
FT   CDS_pept        complement(7271..8299)
FT                   /locus_tag="Deide_3p00052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357672"
FT                   /db_xref="GeneID:7740176"
FT                   /translation="MPDLHLALIDLCGAIGNYHDRSRTDGVFHLQIGGPGSVPALKALD
FT                   MPELHVDLLPGPITSTQVDVLRSLGYVPAGLHWQHPGGWRLVLPDEASGWRAGQQALRA
FT                   LLLDSPEAAAAYVQVFGSHGRDTADLAFQERASAHYACTVGFHPACFVARMFAGLDLPW
FT                   MFAGGVALDLYMGRVTRPHDDLDVIVPYDQQAELHDHLQQSGWRLDASVNRTYQPWVPP
FT                   LEPPSFQVHARHPDLPDVVMLDLMLTDLSGGRWRYRRDPNITLPLERARLQGPHGLPYL
FT                   TPEAALLFKAGRGEGGMRLKDARDFARLRPSLTAGQQRWLHSQLKSSQPDHPWLPQLNG
FT                   SI"
FT                   /protein_id="YP_002787411.1"
FT   gene            8604..8969
FT                   /db_xref="GeneID:7740177"
FT                   /locus_tag="Deide_3p00060"
FT   CDS_pept        8604..8969
FT                   /locus_tag="Deide_3p00060"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding protein HU (Histone-like protein)"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357673"
FT                   /db_xref="GeneID:7740177"
FT                   /translation="MTKKNTKAPAKKPAATKSAASAAPKKAAAAEKIGKTQMVDMIADR
FT                   AGLTKKQSEEVVSVMLESIVEAVRSGKSVGLPGLGTLSVRETAARTGVRPGTSEKIQIA
FT                   AGKKLAFKAATTLKGTL"
FT                   /protein_id="YP_002787412.1"
FT   gene            9702..10262
FT                   /db_xref="GeneID:7740178"
FT                   /locus_tag="Deide_3p00061"
FT   CDS_pept        9702..10262
FT                   /locus_tag="Deide_3p00061"
FT                   /gene_family="HOG000221033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357674"
FT                   /db_xref="GeneID:7740178"
FT                   /translation="MPQVALSAKLSYTDLARHCQTTPYYLRTRGVRMTRPPLPPFTIHT
FT                   ARDKVRLAEDAWNSRDPARVAQAYTEDSVWRNRDEFFSGRPAIEAFLTHKWEREHDYRL
FT                   IKELWTFHENRISVRFQYEFHDHSGQWYRAHGNEQWEFDDRGLMRRREASINDVPIREE
FT                   ERLFRWPAGRRPDDHPGLTELGR"
FT                   /protein_id="YP_002787413.1"
FT   gene            complement(10837..11568)
FT                   /db_xref="GeneID:7740179"
FT                   /locus_tag="Deide_3p00080"
FT   CDS_pept        complement(10837..11568)
FT                   /locus_tag="Deide_3p00080"
FT                   /gene_family="HOG000273991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357675"
FT                   /db_xref="GeneID:7740179"
FT                   /translation="MTTKSLSRRHLVQSELTRRIVSGHVSPLSRLPKETELAEEFDVSR
FT                   VVIREAMKVLAEKGLIEIQQGRGTTVNPAHRWNPMDPQVLMHLGKGSSFYTVQSELLEA
FT                   RLVFEVKLAGLAATRMTDRDLGHMESLLRTMDQFLDDPDRFSELDAEFHVALIQGGKNA
FT                   ILAKLLEPVHELLKVGFRQTILKPGAAQQAQVFHWAIYDGLKRRDPVATQDAVQRHLIR
FT                   AQENLQALGDWLNPVPDEVKS"
FT                   /protein_id="YP_002787414.1"
FT   gene            11832..13115
FT                   /db_xref="GeneID:7740180"
FT                   /locus_tag="Deide_3p00090"
FT   CDS_pept        11832..13115
FT                   /locus_tag="Deide_3p00090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar ABC transporter, periplasmic component"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357676"
FT                   /db_xref="GeneID:7740180"
FT                   /translation="MSRTSLPVTLALTLCALSVASNAQAQTFNWKAQRGKTISVSVVKS
FT                   PWSDILQDRLGEFEKLSGINVNLSVLPEQQARQKLAIDFASGGRTVDVFDSSLTVEKTR
FT                   FAQAGWYEPLNKYMVAGKLDPTYRFDDFFTSARTAVKTSDGRIIGLPWKADVQVLYYRK
FT                   DLFAQAGLKVPTTLDELENAAEKLHVPGKMYGYAARGLKNANVYTFAFPLQAFGGKWID
FT                   GKGNSTVNSAQAVKALNWYSSMLKKYAPPSVISYNWSEVLGLFQQEQLAMFNDGIGFAV
FT                   QLEDKSKSKVAGKVGYAVLPGRLAPATYNALAMSSRSGNKDAAFIFMQWATNRAFDKHL
FT                   VENGVTSPRQSSWTTATNKPLETIPWAKTYFDALKVAKPAFPEVPPVQEMRDTVGIAIV
FT                   QSIQGSASKPALDQASRDFQTALNSAKQ"
FT                   /protein_id="YP_002787415.1"
FT   gene            13117..14028
FT                   /db_xref="GeneID:7740181"
FT                   /locus_tag="Deide_3p00100"
FT   CDS_pept        13117..14028
FT                   /locus_tag="Deide_3p00100"
FT                   /gene_family="HOG000220407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar ABC transporter, permease component"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357677"
FT                   /db_xref="GeneID:7740181"
FT                   /translation="MTTSPLPGTAVRRAKRRPAAPILFVLPALLLTVIVIAFPLGYTLY
FT                   QSMTNWVITSPNPPKFIGLANYAELLRDQRAMQSLVRTLLITVCSVSLQMVLGVAMALV
FT                   MNKHFFGRGLFRTLALFPVVATPVAISLIFVTMMNPQTGVLNHFLTSLGLSAQQWIYAE
FT                   KSVLPALILVDTWQWTPFVMLIALAGLATLPSEPYEAAKIDGATAWQTFWGITLPMLMP
FT                   SLFVALLFRAIDTLKLFDTIYAMTQGGPGTASETINLYLYTLSFNYFRMGYASSMVIAL
FT                   LVLVLGITLLLIRARKLAEDRS"
FT                   /protein_id="YP_002787416.1"
FT   gene            14094..14897
FT                   /db_xref="GeneID:7740182"
FT                   /locus_tag="Deide_3p00110"
FT   CDS_pept        14094..14897
FT                   /locus_tag="Deide_3p00110"
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar ABC transporter, permease component,
FT                   maltose ABC transporter malG"
FT                   /transl_table="11"
FT                   /db_xref="GI:226357678"
FT                   /db_xref="GeneID:7740182"
FT                   /translation="MTHLLPLLISAFFIVPIVFVFYWMVSMSFQTQVEISASPPTFWSA
FT                   NPTTEWYSQLMRRMPFLQYTWNSMVVGVSATAIGLAIGLPAAYAIARWKLTSLSTLFLI
FT                   TRITPAISFLIPWYIIAKRLGLGDSLVIITLLHITITLPLIIWIMIGFFEALPTDLEQA
FT                   ATVDGCNAWQSFALIAVPLVKPGIVAAIILAFIQSWNNFLFAAVLGGPGSQTLPVTVYG
FT                   MLSFEQANWGPLAAAATLVCLPVIVGTIFFQRQLVEGLTAGAMKG"
FT                   /protein_id="YP_002787417.1"
FT   gene            15017..15982
FT                   /db_xref="GeneID:7740183"
FT                   /locus_tag="Deide_3p00120"