(data stored in ACNUC7421 zone)

HOGENOMDNA: DEIDV_4

ID   DEIDV_4; SV 1; empty ; DNA; empty ; PRO; 314317 BP.
XX
AC   NC_012529;
XX
PR   Project:58615;
XX
DE   Deinococcus deserti VCD115 plasmid 2, complete sequence.
XX
OS   Deinococcus deserti VCD115
OC   Bacteria; Deinococcus-Thermus; Deinococci; Deinococcales; Deinococcaceae;
OC   Deinococcus.
XX
RN   [1]
RP   1-314317
RX   PUBMED; 19875382.
RA   Baudet,M., Ortet,P., Gaillard,J.C., Fernandez,B., Guerin,P., Enjalbal,C.,
RA   Subra,G., de Groot,A., Barakat,M., Dedieu,A. and Armengaud,J.;
RT   "Proteomics-based refinement of Deinococcus deserti genome annotation
RT   reveals an unwonted use of non-canonical translation initiation codons";
RL   Mol. Cell Proteomics 9 (2), 415-426 (2010)
XX
RN   [2]
RP   1-314317
RX   PUBMED; 19370165.
RA   de Groot,A., Dulermo,R., Ortet,P., Blanchard,L., Guerin,P., Fernandez,B.,
RA   Vacherie,B., Dossat,C., Jolivet,E., Siguier,P., Chandler,M., Barakat,M.,
RA   Dedieu,A., Barbe,V., Heulin,T., Sommer,S., Achouak,W. and Armengaud,J.;
RT   "Alliance of proteomics and genomics to unravel the specificities of
RT   Sahara bacterium Deinococcus deserti";
RL   PLoS Genet. 5 (3), E1000434 (2009)
XX
RN   [3]
RP   1-314317
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-314317
RA   De Groot,A., Dulermo,R., Ortet,P., Blanchard,L., Guerin,P., Fernandez,B.,
RA   Vacherie,B., Dossat,C., Jolivet,E., Siguier,P., Chandler,M., Barakat,M.,
RA   Dedieu,A., Barbe,V., Heulin,T., Sommer,S., Achouak,W. and Jean,A.;
RT   "Direct Submission";
RL   Submitted (09-JUL-2008) DSV, EBEB, SBVME, LEMIRE, CEA, CEA Cadarache,
RL   Saint Paul Lez Durnance 13108, France
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001116.
CC   Genome sequencing was performed by Genoscope, www.genoscope.cns.fr.
CC   Source DNA is available from de Groot at nicolaas.degroot@cea.fr.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..314317
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:546414"
FT                   /note="type strain of Deinococcus deserti VCD115"
FT                   /strain="VCD115"
FT                   /plasmid="2"
FT                   /organism="Deinococcus deserti VCD115"
FT   gene            266..1111
FT                   /db_xref="GeneID:7740769"
FT                   /locus_tag="Deide_2p00001"
FT   CDS_pept        266..1111
FT                   /locus_tag="Deide_2p00001"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome partitioning ATPase, ParA family"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358015"
FT                   /db_xref="GeneID:7740769"
FT                   /translation="MKTDTATCLHVKTPAGQTTYAAQEMRTLTFFNHAGGAAKTSLALN
FT                   VGHALSMEGYRVLLIDLDPQANLSTWLGHSMVTDNQTAFQTAINSEARLPTPQIVHGMR
FT                   LIPSNLHLALSEGQMMAQEGSTLNLRFALEELKGDYDVVLVDSPPSLGKLAVLAALAAD
FT                   LLIVPVPTRAKGLNGLPGVAAALNTYRRLRPDLRVGLFVPTLYDGRNTHDREVLEALRR
FT                   QIQPLAAPLSYRPATWNDSAGVGEPILVYAPNSPAAAEVQALTREIAIIAGLEKQVHHG
FT                   "
FT                   /protein_id="YP_002787754.1"
FT   gene            1104..1997
FT                   /db_xref="GeneID:7740520"
FT                   /locus_tag="Deide_2p00002"
FT   CDS_pept        1104..1997
FT                   /locus_tag="Deide_2p00002"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB-like partition protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358016"
FT                   /db_xref="GeneID:7740520"
FT                   /translation="MAKRKFDATATLDALLGPAGAGNLVSQDQLRMLDVRQLTPTPHQP
FT                   RTTFTEGNLRELADSIRENGVLQPILVRTTPAGLEIVAGERRWRAAQLAGLTTIPAYVR
FT                   DLDDQQAAAASAVENLIREDLNPLEEVEAKRRIAALALDIPEDQVMTRLRRLLDKPEED
FT                   PDGVRELDTAFGRLGGEKWQSFLRNKGRILNLPEDVKEAVRGGLDYRKALVIGGAGDAE
FT                   ERGRLLALARDGATVQALHDAQKPPHTQREAQIKAVARALGQKRLLERISPRQQSRVDK
FT                   LVAELHRILVEVDEAN"
FT                   /protein_id="YP_002787755.1"
FT   gene            3785..5152
FT                   /db_xref="GeneID:7740521"
FT                   /locus_tag="Deide_2p00010"
FT   CDS_pept        3785..5152
FT                   /locus_tag="Deide_2p00010"
FT                   /gene_family="HOG000099793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Plasmid replication initiator protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358017"
FT                   /db_xref="GeneID:7740521"
FT                   /translation="MGRLGLISIQERVPDTFSSWTVEFQVDGRPATLTCDAMPKYGGVP
FT                   HGLDGDIATAIMDLYVESGCPDDGLLHTTAYQILKRAGLDDSGRYYTNLKQTLYRLRTA
FT                   TYSASEAWRDHRRGNWTTVTFNYLQGLEFTSGDEDLNLSRSSALRIRLAEPIVRSVRSQ
FT                   YTKPLDIEFLTSLDRPLTRALYRLLDARRYSPEDPRTPRMTYSVNLIDWAAACKIIDQR
FT                   SNKIRSTLQGAHDELIERQYLESVEYDGRGKKQVITYRFVEVGGRKAELDLQSSPVMAE
FT                   LVGHKVSISVARRLMEEFGEDHIRERLQKFRRLLDSGYRVRNRSALLVDVIRDQEDKYP
FT                   EPSSTAVSAPGRAPASAPQPARMPTLEEAMHEPETLEAQVEKAMKTIQFLLRDRLSVSE
FT                   YGLLRMGLIVGQPDPDRTMRAALQAKRDGTLDAFTDDLLSVLATVNQDVLSASPAV"
FT                   /protein_id="YP_002787756.1"
FT   gene            5512..5811
FT                   /db_xref="GeneID:7740522"
FT                   /locus_tag="Deide_2p00011"
FT   CDS_pept        5512..5811
FT                   /locus_tag="Deide_2p00011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358018"
FT                   /db_xref="GeneID:7740522"
FT                   /translation="MQSRGRTMHLIETLRIEVQELRDEASRHAGAGAIYAAGEAARAAA
FT                   GLTGLIARLETMPEWHARQATEDHAYWLGLEAPRSLAAEWEVAACERALCWRQA"
FT                   /protein_id="YP_002787757.1"
FT   gene            complement(5845..6540)
FT                   /db_xref="GeneID:7740523"
FT                   /locus_tag="Deide_2p00020"
FT   CDS_pept        complement(5845..6540)
FT                   /locus_tag="Deide_2p00020"
FT                   /gene_family="HOG000229190" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358019"
FT                   /db_xref="GeneID:7740523"
FT                   /translation="MIIAFVNPLGTLLSPLEDGAPDFSAGLGQLLQQAELVPVTGMDEV
FT                   ELLMVPASFTSWQILRHGAVVLTPDGAEDPAWRRLTLETQAEIADALTLAHQAAVHIGQ
FT                   LGQLDTEAELLTHGAYPLLLKVTHPHQLPLATDQLFQELQAWLEESPFRSKLRITQLGT
FT                   EVLVLPRDITPESAVNYVLSRWEGTITLTVGVSVYPTDLPFMSQCDLALTPGAPLAELQ
FT                   EREQEPQDD"
FT                   /protein_id="YP_002787758.1"
FT   gene            complement(6809..7570)
FT                   /db_xref="GeneID:7740524"
FT                   /locus_tag="Deide_2p00030"
FT   CDS_pept        complement(6809..7570)
FT                   /locus_tag="Deide_2p00030"
FT                   /gene_family="HOG000179750" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358020"
FT                   /db_xref="GeneID:7740524"
FT                   /translation="MSENLFKAALAGGKPQIGLWLALADPYSAELCAGAGFDWLAVDGE
FT                   HAPNDLRSTLSCLQAIAPYPSHAVVRPPVGNDVVIKQLLDIGAQTLLIPMVDTPEQARA
FT                   LVAATRYPPLGVRGVGAALARASRFGRDAGYLGEANDGVCLLLQVESVAGLEALEAIAS
FT                   VAGVDGVFIGPADLAASMGHLGLPGHPEVQDAIRDAARRIRATGRAAGILSTDEAQART
FT                   YLSWGYNFVAVGTDVTLLSRSTAALAAAFRS"
FT                   /protein_id="YP_002787759.1"
FT   gene            complement(7563..8378)
FT                   /db_xref="GeneID:7740525"
FT                   /locus_tag="Deide_2p00040"
FT   CDS_pept        complement(7563..8378)
FT                   /locus_tag="Deide_2p00040"
FT                   /gene_family="HOG000179639" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358021"
FT                   /db_xref="GeneID:7740525"
FT                   /translation="MGLAAELEAAESSGVQLSPFSERFPGMTVADAYAVQRAWVALKIE
FT                   DGRRVVGHKIGLTSRAMQMAVQINEPDYGALLDDMFFEPNGDIPLSRFVEPRVEVELGF
FT                   LLGRDLQGPHVTVFDVLRATEYVTPAAEIIDARIARVSRETGKPRRVMDTISDNAANSG
FT                   VIMGGRTVAPDAIDLRWAAALCVRNGVIEETGVAAGVLGHPAQGIAWLANRLAAHGEGL
FT                   RAGEFVLAGSFTRPVDISSGDVFTFDYGPLGAFSCRFVGTPRGQGGAHV"
FT                   /protein_id="YP_002787760.1"
FT   gene            complement(8431..9411)
FT                   /db_xref="GeneID:7740526"
FT                   /locus_tag="Deide_2p00050"
FT   CDS_pept        complement(8431..9411)
FT                   /locus_tag="Deide_2p00050"
FT                   /gene_family="HOG000251039" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="catechol 2,3-dioxygenase; biphenyl-2,3-diol
FT                   1,2-dioxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358022"
FT                   /db_xref="GeneID:7740526"
FT                   /translation="MTKPDVIRIAQAIFTVSDLAASREFYVDLLGMNILHEEGNALYLR
FT                   GVEDREWTLKLEQSRGPEDPVRVRQLGYRVRGEQSLDALIALAAQQNLPWRWEEELDRP
FT                   RMLRLQDPFGIPLSFYHEVGTHPWMLQEFHRHRGPGLQRVDHVNVMVPDVKATMDWYLN
FT                   ELDFRLSEYTVDEHDAYWAAWIQRRGGVHDLALTNGPGPRLHHWAYWMPDVNSIIRTCD
FT                   ILAGARQPERIERGPGRHGISNAFFLYIRDPDGHRIELYTSDYITVDPDFKPIRWMRDD
FT                   PRRQTLWGAKTPLSWFEEASVMEAFGGGLQAHEAGALTGIPVHVI"
FT                   /protein_id="YP_002787761.1"
FT   gene            complement(9404..10936)
FT                   /db_xref="GeneID:7740527"
FT                   /locus_tag="Deide_2p00060"
FT   CDS_pept        complement(9404..10936)
FT                   /locus_tag="Deide_2p00060"
FT                   /gene_family="HOG000145842" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-hydroxyphenylacetate-3-hydroxylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358023"
FT                   /db_xref="GeneID:7740527"
FT                   /translation="MTQTTTGPIADSSAGTRVPGAVTGQQFLDRLRQNPPTLYIDGKRV
FT                   EDPTTHPSTANMCRSLAGLYDLQHQPELRDLLTYEEGGVRYATSFMVPRTKEDLAKIGE
FT                   AHRVRANYGLGFLGRAPDYMNANVMAAGMGAEYFSTCSASIAGDPKRDFAANMRRYYEY
FT                   VRDHDLCLTHALTNPQVNRAKMASELPDPYIALGVVEEREEGIIVRGARMMATLPIADE
FT                   ILIFPSTVLKENADRSRYAMGFGLPTNTPGLSFQCREPIDVGRDPEDHPLSSRFDEQDA
FT                   FVIFDDVLVPWERVFLLYDVELANKAYAGTDAVLHMAYQVVNLKVSKTETFLGTAQSIV
FT                   NAIGSGQFQHVQSKVAEIIIMLEIMKALEVAAREQATLNSYGVMTPARAPLDAARNYYP
FT                   ANHARLPELLQLLGASGIIMMPSKADREGPLGPQIARFLQAGNASADERLKLFRLAWDM
FT                   AMSSFAGRQELYERFFFGDPVRMHSALYEVYDSSEAVGRIQAFLNQGGAARD"
FT                   /protein_id="YP_002787762.1"
FT   gene            complement(10949..11761)
FT                   /db_xref="GeneID:7740528"
FT                   /locus_tag="Deide_2p00070"
FT   CDS_pept        complement(10949..11761)
FT                   /locus_tag="Deide_2p00070"
FT                   /gene_family="HOG000129432" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358024"
FT                   /db_xref="GeneID:7740528"
FT                   /translation="MNSPQRVLITGAAGTIGQALREGLRGHFPLLRLTDLRDLSEAQAG
FT                   EEIVQADLTHFDEVLAAMQGVDAVIHLGAIADEHTYERIRAVNMDGTYHVLEAARQAGV
FT                   RRVAFASSIHTVGFYPRSETISPDVPVRPDTYYGVSKVFGEALGRMYWERYGMEFVSVR
FT                   ICSFQPQPKDRRHLSTWLSPRDATQLFSRAVTAPDVGYLTVAGISGNTRRWMSPEGWDR
FT                   LDYQPQDDAEGYASQVEHLHGDPDHITEQRQGGLFVDPNYTGLASQDR"
FT                   /protein_id="YP_002787763.1"
FT   gene            complement(11758..13311)
FT                   /db_xref="GeneID:7740529"
FT                   /locus_tag="Deide_2p00080"
FT   CDS_pept        complement(11758..13311)
FT                   /locus_tag="Deide_2p00080"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358025"
FT                   /db_xref="GeneID:7740529"
FT                   /translation="MTQTISPNHDLARRLREERLIGGLQHFVGGQWVASSSGETFDTHS
FT                   PVDNAFLTQVASGDAQDIDRAAQAAHEAFRTWREVSGAERRRILHRIADLIEARAQEIA
FT                   VLESIDTGQAIRFMKSAATRGAENFRFYADRAPGAGDGQSLPAPGFINYTLRQPIGPVG
FT                   VITPWNTPFMLSTWKIAPALAAGCTVVHKPAEWSPVSATLLAEIMDEAGLPGGVHNLVH
FT                   GFGESAGKALTEHPLIKAIAFVGETTTGSHIMRQGAETLKRVHFELGGKNPVVVFDDAD
FT                   LDRALDAVVFMIYSLNGERCTSSSRVLVQEGIYDEFTARIAERARNIRVGDPLDPETEV
FT                   GPLVHPRHFEKVMSYFGKAREEGATIAAGGERVGQAGNFVSPTLFTGARNDMAIAQEEI
FT                   FGPVLTAIPFTDEADALALANDVKYGLAGYLWTNDLTRAHRFAQGLEAGMIWVNSENVR
FT                   HLPTPFGGVKNSGIGRDGGDYSFEFYMETKNIAISLGTHKTAKLGVGQAPKVDKTVVEG
FT                   "
FT                   /protein_id="YP_002787764.1"
FT   gene            complement(13365..14165)
FT                   /db_xref="GeneID:7740530"
FT                   /locus_tag="Deide_2p00090"
FT   CDS_pept        complement(13365..14165)
FT                   /locus_tag="Deide_2p00090"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fumarylacetoacetate (FAA) hydrolase, reated to"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358026"
FT                   /db_xref="GeneID:7740530"
FT                   /translation="MKYARFISGGRPLTGHLHDNHLIDAAGVAHDPSKVHFRLPVDPPK
FT                   VIALALNFNDHAGELGLTQPKEPALFWKPNTTLLPHGGTVIYPRGAQFMHYEVELGVII
FT                   GRDARRVKAKDAMDYVGGYTIGNDLVVRDYVTNTFRPPMRGKGWDTFGPLGPYYVTADE
FT                   IKDPHDLTLRAYVNDELRQEGSTRDMIFGIPELIEHISRFMTLQKDDVILTGTPKGISH
FT                   VHPGDVMRLEIEGLGTLINDIQEEDNLAEPITGQESKEGEWDGR"
FT                   /protein_id="YP_002787765.1"
FT   gene            14281..15468
FT                   /db_xref="GeneID:7740531"
FT                   /locus_tag="Deide_2p00100"
FT   CDS_pept        14281..15468
FT                   /locus_tag="Deide_2p00100"
FT                   /gene_family="HOG000099794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:226358027"
FT                   /db_xref="GeneID:7740531"
FT                   /translation="MPQLSDLCVALDLPVPDHGSCAWTTPEDACALLPDQPAEVVRTAV
FT                   LAFRAQQMAAVPGSASVFAALREAVAHPQPERELTRLLARLTGGFVAIHASWGDLVASS
FT                   GDPRPGQVWKLIHKTRHVGTLTMAVAARWAPLMPVAAEYALLARLQSAAAGAARRRVGE
FT                   RSLDALLSGQDDAPGLGSGPFALAVARFSHETAATKTARAAQEHALDVLASAGEGYFME
FT                   RGVTAYSTVRGQRAVWLWPTRDLPREGVALHAALLASTEQDVRLGVSARHHAGNVRGAF
FT                   DEASQALTGTREARGCTLFQELDPLHTLLTSGALSTLQAQVRSRLATLDDSGRTEVTLR
FT                   AYLNHTGPLTGLAAQLHIHVNTLRYRLRRAEEVLGGPLDDPHLLARLYLAFEARP"
FT                   /protein_id="YP_002787766.1"
FT   gene            15697..16050
FT                   /db_xref="GeneID:7740532"
FT                   /locus_tag="Deide_2p00101"