(data stored in ACNUC8465 zone)

HOGENOMDNA: DIDIS1_3

ID   DIDIS1_3; SV 3; empty ; DNA; empty ; UNC; 6357099 BP.
XX
AC   NC_007089;
XX
DE   Dictyostelium discoideum AX4 chromosome 3, complete sequence.
XX
OS   Dictyostelium discoideum AX4
OC   Eukaryota; Mycetozoa; Dictyosteliida; Dictyostelium.
XX
RN   [1]
RP   1-6357099
RX   PUBMED; 15875012.
RA   Eichinger,L., Pachebat,J.A., Glockner,G., Rajandream,M.A., Sucgang,R.,
RA   Berriman,M., Song,J., Olsen,R., Szafranski,K., Xu,Q., Tunggal,B.,
RA   Kummerfeld,S., Madera,M., Konfortov,B.A., Rivero,F., Bankier,A.T.,
RA   Lehmann,R., Hamlin,N., Davies,R., Gaudet,P., Fey,P., Pilcher,K., Chen,G.,
RA   Saunders,D., Sodergren,E., Davis,P., Kerhornou,A., Nie,X., Hall,N.,
RA   Anjard,C., Hemphill,L., Bason,N., Farbrother,P., Desany,B., Just,E.,
RA   Morio,T., Rost,R., Churcher,C., Cooper,J., Haydock,S., van Driessche,N.,
RA   Cronin,A., Goodhead,I., Muzny,D., Mourier,T., Pain,A., Lu,M., Harper,D.,
RA   Lindsay,R., Hauser,H., James,K., Quiles,M., Madan Babu,M., Saito,T.,
RA   Buchrieser,C., Wardroper,A., Felder,M., Thangavelu,M., Johnson,D.,
RA   Knights,A., Loulseged,H., Mungall,K., Oliver,K., Price,C., Quail,M.A.,
RA   Urushihara,H., Hernandez,J., Rabbinowitsch,E., Steffen,D., Sanders,M.,
RA   Ma,J., Kohara,Y., Sharp,S., Simmonds,M., Spiegler,S., Tivey,A., Sugano,S.,
RA   White,B., Walker,D., Woodward,J., Winckler,T., Tanaka,Y., Shaulsky,G.,
RA   Schleicher,M., Weinstock,G., Rosenthal,A., Cox,E.C., Chisholm,R.L.,
RA   Gibbs,R., Loomis,W.F., Platzer,M., Kay,R.R., Williams,J., Dear,P.H.,
RA   Noegel,A.A., Barrell,B. and Kuspa,A.;
RT   "The genome of the social amoeba Dictyostelium discoideum";
RL   Nature 435 (7038), 43-57 (2005)
XX
RN   [2]
RP   1-6357099
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-JUN-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-6357099
RG   The Dictyostelium discoideum Sequencing Consortium
RA   Eichinger,L., Pachebat,J.A., Gloeckner,G., Rajandream,M.-A., Sucgang,R.,
RA   Song,J., Cox,E.C., Tunggal,B., Szafranski,K., Konfortov,B.A.,
RA   Farbrother,P., Bankier,A.T., Lehmann,R., Hamlin,N., Xu,Q., Davies,R.,
RA   Gaudet,P., Fey,P., Pilcher,K., Chen,G., Saunders,D., Sodergren,E.,
RA   Davis,P., Nie,X., Kerhornou,A., Hemphill,L., Bason,N., Berriman,M.,
RA   Desany,B., Churcher,C., Cooper,J., van Driessche,N., Cronin,A.,
RA   Goodhead,I., Muzny,D., Hall,N., Harper,D., Lindsay,R., Hauser,H.,
RA   James,K., Quiles,M., Buchrieser,C., Wardroper,A., Thangavelu,M.,
RA   Johnson,D., Knights,A., Loulseged,H., Mungall,K., Price,C., Ma,J.,
RA   Quail,M., Hernandez,J., Rabbinowitsch,E., Steffen,D., Sanders,M.,
RA   Weinstock,G., Sharp,S., Just,E., Shaulsky,G., Simmonds,M., Tivey,A.,
RA   White,B., Walker,D., Woodward,J., Winckler,T., Schleicher,M.,
RA   Rosenthal,A., Rivero,F., Chisholm,R.L., Gibbs,R., Loomis,W.F., Platzer,M.,
RA   Kay,R.R., Williams,J., Dear,P.H., Noegel,A.A., Barrell,B. and Kuspa,A.;
RT   "Direct Submission";
RL   Submitted (08-OCT-2004) dictyBase, Center for Genetic Medicine,
RL   Northwestern University, 303 E Chicago Ave, Chicago, IL 60611, USA
XX
CC   REVIEWED REFSEQ: This record has been curated by NCBI staff. The
CC   reference sequence was derived from CM000152.
CC   On Aug 10, 2006 this sequence version replaced gi:111435651.
CC   COMPLETENESS: not full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..6357099
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:352472"
FT                   /note="terminal gaps represent complex repetitive elements"
FT                   /strain="AX4"
FT                   /organism="Dictyostelium discoideum AX4"
FT                   /chromosome="3"
FT   gene            complement(<12056..>14309)
FT                   /old_locus_tag="DDB0204299"
FT                   /db_xref="GeneID:3393586"
FT                   /locus_tag="DDBDRAFT_0204299"
FT   mRNA            complement(join(<12056..13173,13418..>14309))
FT                   /old_locus_tag="DDB0204299"
FT                   /db_xref="dictyBase:DDB0204299"
FT                   /db_xref="GI:66815978"
FT                   /db_xref="GeneID:3393586"
FT                   /locus_tag="DDBDRAFT_0204299"
FT                   /transcript_id="XM_636914.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(12056..13173,13418..14309))
FT                   /locus_tag="DDBDRAFT_0204299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="DDB0204299"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Q9UUA2 DNA repair and recombination
FT                   protein pif1, mitochondrial precursor."
FT                   /db_xref="dictyBase:DDB0204299"
FT                   /db_xref="GI:66815979"
FT                   /db_xref="GeneID:3393586"
FT                   /translation="MFLRLSLKTIKKCQSNFITSFNSKQYKFFTTHYGYDFFNNDENDS
FT                   GGGEYQTSFDYDVDIEVPILSNVTTSNTTIINRPFYNNNNNNNLQVSSLTAEKLPKKIK
FT                   INKKPLVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNSNNVNLTKTTKSTNT
FT                   STTQSQPNDQGLFSPTKTKNKTSSVNEKEEIEILNNFAKSLQDQQQKVKTIFDKFENIE
FT                   NDNSDNVDSQNLLELDELLTSEQQKIVNLIVDGGKNVFFTGSAGTGKSFVLKHLVSKLR
FT                   KKYPKSVYVTAATGIAAVNIGGTTLHSFAGIKLGVAPAQRLAVEILQSKKLLQKWLDCS
FT                   VLIIDEISMIDAELFEKLDTIGQMVRGNNQPFGGIQLVLVGDFFQLPPVHGNYAFECKA
FT                   WKKSIDISVELTTVMRQKETEFIDILNKIRVGDIKEDMINRLVSTCNKPLDISNGILPT
FT                   RLYSTNASVDQENQSSLDKLLGEPFSFQAVDSGNKELIELLDRDCPAMKNLTLKVGAQV
FT                   VLLRKIEKGDGLVNGSRGVVVDFVKARVSRKNNKFHKVNQYLPVVLFNDGQKVTIPPSE
FT                   WCVWSEEKAYRNQIPLKLAWALTIHRAQGMTLDKVECELSRTFASGQGYVALSRVKSLA
FT                   GLHLKSLNTPALKTSPKVVTFNKKIIRSINNSHI"
FT                   /protein_id="XP_642006.1"
FT   gene            <14987..>16033
FT                   /old_locus_tag="DDB0214989"
FT                   /db_xref="GeneID:3393585"
FT                   /locus_tag="DDB_0214989"