(data stored in ACNUC1829 zone)

EMBL: DQ074789.CD151

DQ074789.CD151       Location/Qualifiers
FT   CDS_pept        join(7621..7704,7808..7999,8326..8400,8807..8911,
FT                   9017..9175,9499..9585,9690..9749)
FT                   /codon_start=1
FT                   /gene="CD151"
FT                   /product="CD151 antigen"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="AAY68211.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
     atgggtgagt tcaacgagaa gaagacaaca tgtggcaccg tttgcctcaa gtacctgctg        60
     tttacctaca attgctgctt ctggctggct ggcctggctg tcatggcagt gggcatctgg       120
     acgctggccc tcaagagtga ctacatcagc ctgctggcct caggcaccta cctggccaca       180
     gcctacatcc tggtggtggc gggcactgtc gtcatggtga ctggggtctt gggctgctgc       240
     gccaccttca aggagcgtcg gaacctgctg cgcctgtact tcatcctgct cctcatcatc       300
     tttctgctgg agatcatcgc tggtatcctc gcctacgcct actaccagca gctgaacacg       360
     gagctcaagg agaacctgaa ggacaccatg accaagcgct accaccagcc gggccatgag       420
     gctgtgacca gcgctgtgga ccagctgcag caggagttcc actgctgtgg cagcaacaac       480
     tcacaggact ggcgagacag tgagtggatc cgctcacagg aggccggtgg ccgtgtggtc       540
     ccagacagct gctgcaagac ggtggtggct ctttgtggac agcgagacca tgcctccaac       600
     atctacaagg tggagggcgg ctgcatcacc aagttggaga ccttcatcca ggagcacctg       660
     agggtcattg gggctgtggg gatcggcatt gcctgtgtgc aggtctttgg catgatcttc       720
     acgtgctgcc tgtacaggag tctcaagctg gagcactact ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page