(data stored in ACNUC7421 zone)

HOGENOMDNA: ECO5T_1

ID   ECO5T_1; SV 1; empty ; DNA; empty ; PRO; 5528136 BP.
XX
AC   NC_013008;
XX
PR   Project: 59235;
XX
DE   Escherichia coli O157:H7 str. TW14359, complete genome.
XX
OS   Escherichia coli O157:H7 str. TW14359
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5528136
RX   PUBMED; 19564389.
RA   Kulasekara,B.R., Jacobs,M., Zhou,Y., Wu,Z., Sims,E., Saenphimmachak,C.,
RA   Rohmer,L., Ritchie,J.M., Radey,M., McKevitt,M., Freeman,T.L., Hayden,H.,
RA   Haugen,E., Gillett,W., Fong,C., Chang,J., Beskhlebnaya,V., Waldor,M.K.,
RA   Samadpour,M., Whittam,T.S., Kaul,R., Brittnacher,M. and Miller,S.I.;
RT   "Analysis of the genome of the Escherichia coli O157:H7 2006
RT   spinach-associated outbreak isolate indicates candidate genes that may
RT   enhance virulence";
RL   Infect. Immun. 77 (9), 3713-3721 (2009)
XX
RN   [2]
RP   1-5528136
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-JUL-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-5528136
RA   Brittnacher,M., Jacobs,M., Zhou,Y., Chang,J., Fong,C., Gillett,W.,
RA   Haugen,E., Hayden,H., Kulasekara,B., Larson Freeman,T., Radey,M.,
RA   Rohmer,L., Sims,E., Wu,Z., Whittam,T., Kaul,R., Olson,M.V. and
RA   Miller,S.I.;
RT   "Direct Submission";
RL   Submitted (15-JAN-2009) Genome Center, Department of Medicine, University
RL   of Washington, Box 352145, Seattle, WA 98195, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001368.
CC   Source DNA is available from Samuel I. Miller, University of
CC   Washington, E-mail: millersi@u.washington.edu.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..5528136
FT                   /strain="TW14359"
FT                   /mol_type="genomic DNA"
FT                   /organism="Escherichia coli O157:H7 str. TW14359"
FT                   /serotype="O157:H7"
FT                   /db_xref="taxon:544404"
FT   gene            complement(133..351)
FT                   /db_xref="GeneID:8220053"
FT                   /locus_tag="ECSP_0001"
FT   CDS_pept        complement(133..351)
FT                   /locus_tag="ECSP_0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:254791137"
FT                   /db_xref="GeneID:8220053"
FT                   /translation="MLPRYLWSKKKPALSGAGFFLCFLYASARTVTCGNGNGDGGGDGG
FT                   GNGGANAFHGCCVLCNFYLSVRYAYIG"
FT                   /protein_id="YP_003075974.1"
FT   gene            360..2816
FT                   /db_xref="GeneID:8214568"
FT                   /locus_tag="ECSP_0002"