(data stored in SCRATCH zone)

HOGENOMDNA: ECOCB_2

ID   ECOCB_2; SV 1; empty ; DNA; empty ; PRO; 66001 BP.
XX
AC   NC_013942;
XX
PR   Project: 46655;
XX
DE   Escherichia coli O55:H7 str. CB9615 plasmid pO55, complete sequence.
XX
OS   Escherichia coli O55:H7 str. CB9615
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-66001
RX   PUBMED; 20090843.
RA   Zhou,Z., Li,X., Liu,B., Beutin,L., Xu,J., Ren,Y., Feng,L., Lan,R.,
RA   Reeves,P.R. and Wang,L.;
RT   "Derivation of Escherichia coli O157:H7 from its O55:H7 precursor";
RL   PLoS ONE 5 (1), E8700 (2010)
XX
RN   [2]
RP   1-66001
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (18-MAR-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-66001
RA   Wang,L., Zhou,Z., Li,X., Liu,B., Beutin,L., Xu,J., Ren,Y., Feng,L., Lan,R.
RA   and Reeves,P.R.;
RT   "Direct Submission";
RL   Submitted (22-DEC-2009) TEDA School of Biological Sciences and
RL   Biotechnology, Nankai University, No. 23, Hongda Street, TEDA, Tianjin,
RL   Tianjin 300457, The People's Republic of China
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001847.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..66001
FT                   /note="ST11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:701177"
FT                   /serotype="O55:H7"
FT                   /isolation_source="infant with diarrhea"
FT                   /strain="CB9615"
FT                   /host="Homo sapiens"
FT                   /plasmid="pO55"
FT                   /organism="Escherichia coli O55:H7 str. CB9615"
FT   gene            51..452
FT                   /db_xref="GeneID:8874334"
FT                   /locus_tag="G2583_pO550001"
FT   CDS_pept        51..452
FT                   /locus_tag="G2583_pO550001"
FT                   /gene_family="HOG000124758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:291285840"
FT                   /db_xref="GeneID:8874334"
FT                   /translation="MQYAKPVTLNVEECDSLSFLPYLFGLGFLYAEASVYALAKQMMPE
FT                   YEGGFWHFIRLPDGDRFHLVNGANWFDRTVSADAAGIILTSLVINRQLWLYHDSGDAGL
FT                   THLYRMRDAQSWSHIEVHPECNAIYAALD"
FT                   /protein_id="YP_003502657.1"
FT   misc_feature    174..449
FT                   /note="Antirestriction protein; Region: Antirestrict;
FT                   pfam03230"
FT                   /db_xref="CDD:146054"
FT                   /locus_tag="G2583_pO550001"
FT   gene            499..921
FT                   /db_xref="GeneID:8874227"
FT                   /locus_tag="G2583_pO550002"