(data stored in ACNUC7421 zone)

HOGENOMDNA: ECOLU_1

ID   ECOLU_1; SV 1; empty ; DNA; empty ; PRO; 33809 BP.
XX
AC   NC_011739;
XX
PR   Project: 33415;
XX
DE   Escherichia coli UMN026 plasmid p2ESCUM, complete sequence.
XX
OS   Escherichia coli UMN026
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-33809
RX   PUBMED; 19165319.
RA   Touchon,M., Hoede,C., Tenaillon,O., Barbe,V., Baeriswyl,S., Bidet,P.,
RA   Bingen,E., Bonacorsi,S., Bouchier,C., Bouvet,O., Calteau,A., Chiapello,H.,
RA   Clermont,O., Cruveiller,S., Danchin,A., Diard,M., Dossat,C., Karoui,M.E.,
RA   Frapy,E., Garry,L., Ghigo,J.M., Gilles,A.M., Johnson,J., Le Bouguenec,C.,
RA   Lescat,M., Mangenot,S., Martinez-Jehanne,V., Matic,I., Nassif,X.,
RA   Oztas,S., Petit,M.A., Pichon,C., Rouy,Z., Ruf,C.S., Schneider,D.,
RA   Tourret,J., Vacherie,B., Vallenet,D., Medigue,C., Rocha,E.P. and
RA   Denamur,E.;
RT   "Organised genome dynamics in the Escherichia coli species results in
RT   highly diverse adaptive paths";
RL   PLoS Genet. 5 (1), E1000344 (2009)
XX
RN   [2]
RP   1-33809
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (18-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-33809
RA   Genoscope -,C.E.A.;
RT   "Direct Submission";
RL   Submitted (15-DEC-2008) Genoscope - Centre National de Sequencage : BP 191
RL   91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr - Web :
RL   www.genoscope.cns.fr)
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CU928149.
CC   Annotation results relative to BLAST similarities, COG
CC   assignations, enzymatic function prediction (PRIAM software), TMHMM
CC   and SignalP predictions, and synteny conservation (Syntonizer
CC   software) are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..33809
FT                   /strain="UMN026"
FT                   /mol_type="genomic DNA"
FT                   /organism="Escherichia coli UMN026"
FT                   /plasmid="p2ESCUM"
FT                   /db_xref="taxon:585056"
FT   gene            250..1251
FT                   /db_xref="GeneID:7169423"
FT                   /locus_tag="p2ECUMN_0001"
FT   CDS_pept        250..1251
FT                   /locus_tag="p2ECUMN_0001"
FT                   /gene_family="HOG000052192" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="PI protein (Replication initiation protein)"
FT                   /transl_table="11"
FT                   /db_xref="GI:218454960"
FT                   /db_xref="GeneID:7169423"
FT                   /translation="MLNMMGFVIKHDDFLLSHHVWFGIFIRQTVGEDGAMPIRKISEKT
FT                   KIRHRNEINKTLAQLPLSAKRVLCLALVSVDTKKPLEPGMIFKITADTYTSITKVKPSV
FT                   AYRQLKEGAELLNTSKLSLSSDDILALSTELGLPDAMRKSLERLDMGITDYCAYSPNEG
FT                   YVVLKFTHTIHPYISNLIGGENKFTTQLLTSAMRLSGQYSWALYQLIRKNYSKFRTKNY
FT                   FSIHLNELKDELIAYTIEDDEVVYKYPEFPIFKREVINKAIKEIKEKTEIEFLSCLIES
FT                   KEGRKVSVLRFEFLVSEDKFTGIDNETHEFMNDDDAAFLTEFDKVVPPKKNK"
FT                   /protein_id="YP_002381183.1"
FT   misc_feature    376..1131
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:186548"
FT                   /locus_tag="p2ECUMN_0001"
FT   gene            1260..1703
FT                   /db_xref="GeneID:7169448"
FT                   /locus_tag="p2ECUMN_0002"
FT   CDS_pept        1260..1703
FT                   /locus_tag="p2ECUMN_0002"
FT                   /gene_family="HOG000073488" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454961"
FT                   /db_xref="GeneID:7169448"
FT                   /translation="MAKIYQFPQGEERGKFRKEIARERKKRFAVNTGSIFVKWLGWGWF
FT                   YLRLLAASVLHFVSVFVLAILGAFKWAVFWLGGILCVITWYHLDHQLWTPQNLTIPVIT
FT                   ATWILGLLAEPLMELLNKTMPWHKLLVPEPADESTENSSEISQ"
FT                   /protein_id="YP_002381184.1"
FT   gene            1722..2186
FT                   /db_xref="GeneID:7169461"
FT                   /locus_tag="p2ECUMN_0003"
FT   CDS_pept        1722..2186
FT                   /locus_tag="p2ECUMN_0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454962"
FT                   /db_xref="GeneID:7169461"
FT                   /translation="MPVPAFSLRCRIGQTPQNASISLVCPMTYSRFLLENFMKYQVKEF
FT                   VNEKYSKAINILKDNLKENYHIFYGVRLSEILFPASEYGTDAFFKEFESINSITLPLII
FT                   FEMNERKPVAIIGFEQIAGAVFVEQLDIKVLVIDDLSELLTNETLASLYN"
FT                   /protein_id="YP_002381185.1"
FT   gene            complement(2569..2784)
FT                   /db_xref="GeneID:7169459"
FT                   /locus_tag="p2ECUMN_0004"
FT   CDS_pept        complement(2569..2784)
FT                   /locus_tag="p2ECUMN_0004"
FT                   /gene_family="HOG000061697" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="hypothetical protein, putative membrane protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454963"
FT                   /db_xref="GeneID:7169459"
FT                   /translation="MEHCIVDLGIINYHPVITWTVPVAFFFLVVLAGIAFNIGRKSNLI
FT                   VFILAMLLPVTTVFIFMLLGGKIDMC"
FT                   /protein_id="YP_002381186.1"
FT   gene            complement(2935..3216)
FT                   /db_xref="GeneID:7169457"
FT                   /locus_tag="p2ECUMN_0005"
FT   CDS_pept        complement(2935..3216)
FT                   /locus_tag="p2ECUMN_0005"
FT                   /gene_family="HOG000294648" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454964"
FT                   /db_xref="GeneID:7169457"
FT                   /translation="MSEIYCIAIAVIIVGYVYLMISVITAPQKLFPILQLITLIGISSL
FT                   FSFMSFKSESMWTGEPELLVAIMFGTFSATLIFYMFKILIRAFDSLTK"
FT                   /protein_id="YP_002381187.1"
FT   gene            complement(3378..3662)
FT                   /db_xref="GeneID:7169449"
FT                   /locus_tag="p2ECUMN_0006"
FT   CDS_pept        complement(3378..3662)
FT                   /locus_tag="p2ECUMN_0006"
FT                   /gene_family="HOG000061696" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="hypothetical protein, putative membrane protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454965"
FT                   /db_xref="GeneID:7169449"
FT                   /translation="MLIKIIKSVFNFYMLCVQPLLGLFLMGYSIWSFSGDGICTADKVI
FT                   ACDISIYLEPAFYLLIGTVVLFVWYIAWQTERSKEEDFKSSIKPEDFVK"
FT                   /protein_id="YP_002381188.1"
FT   gene            complement(3699..4046)
FT                   /db_xref="GeneID:7169467"
FT                   /locus_tag="p2ECUMN_0007"
FT   CDS_pept        complement(3699..4046)
FT                   /locus_tag="p2ECUMN_0007"
FT                   /gene_family="HOG000061695" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="hypothetical protein, putative Methionine
FT                   repressor-like protein"
FT                   /transl_table="11"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="GI:218454966"
FT                   /db_xref="GeneID:7169467"
FT                   /translation="MCIITHLTKNRIPNLMAKLPKKIDQEIKPLDLRQFVSSAAQKPAS
FT                   ASAVTRINLTMTDDDLDTAQVFQNKYGASRAEVIRAALAALRLVSAEERRRLFDDIRKN
FT                   SPKAGRPTVNK"
FT                   /protein_id="YP_002381189.1"
FT   gene            complement(4095..4757)
FT                   /db_xref="GeneID:7169450"
FT                   /locus_tag="p2ECUMN_0008"
FT   CDS_pept        complement(4095..4757)
FT                   /locus_tag="p2ECUMN_0008"
FT                   /gene_family="HOG000061694" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="putative YafB protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218454967"
FT                   /db_xref="GeneID:7169450"
FT                   /translation="MMGKIITVAGHKGGIGKSTVLCSLCVCVIIKGKTACFLETDSQGS
FT                   IKDFIEERKTNDRLSEIPYFECYTDIPAMARKLAARFDYVFVDTPGMKSPAFVKALSCA
FT                   DILFTFIEPGAGIEINTLGRLVFDIKTAQAGVNPSMKAWIVLNKCSTNPSDSEASELRR
FT                   QLNDDPDWLPVPRQRIYMRTVHKKAYNSGMGVHEYDDKRGNKARGEIELLLKETDVL"
FT                   /protein_id="YP_002381190.1"
FT   misc_feature    complement(4107..4748)
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="p2ECUMN_0008"
FT   misc_feature    complement(4317..4745)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="p2ECUMN_0008"
FT   misc_feature    complement(4704..4724)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="p2ECUMN_0008"
FT   misc_feature    complement(order(4494..4496,4704..4706))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="p2ECUMN_0008"
FT   gene            complement(4869..5759)
FT                   /db_xref="GeneID:7169458"
FT                   /locus_tag="p2ECUMN_0009"
FT   CDS_pept        complement(4869..5759)
FT                   /locus_tag="p2ECUMN_0009"
FT                   /gene_family="HOG000219633" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="putative resolvase (Protein D)"
FT                   /transl_table="11"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="GI:218454968"
FT                   /db_xref="GeneID:7169458"
FT                   /translation="MLSDAPLLQVIIAGTSKKTGAEIKKLSHLPASIFQISRSDAWNLT
FT                   LSPDAARNMRDLAAQIGAGMPKYLIAPEVSLLLSYIDDLSIRMYFETLWNTGARLNEAL
FT                   ALKPADFMLTPTRQYPQPVVILKTLKQRIKEAERRPGRPTTRHPPLHPDPRYRKPPEPA
FT                   VRLVPVLDAGYALRMREYLATWKKRIKHQPVWDITSRQTPLNWINTAVARAGRDGVTFS
FT                   VPVTPHTFRHSYAMHLTMSGVPPRVLQSLLGHRYARSTEIYTRVFSLDVLTGSGLSFTC
FT                   DPQLAKQLLGYPDAP"
FT                   /protein_id="YP_002381191.1"
FT   misc_feature    complement(4965..5501)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="p2ECUMN_0009"
FT   misc_feature    complement(order(4971..4973,5076..5081,5370..5372,
FT                   5460..5465))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="p2ECUMN_0009"
FT   misc_feature    complement(order(4971..4973,4998..5000,5067..5069,
FT                   5076..5078,5370..5372,5463..5465))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="p2ECUMN_0009"
FT   misc_feature    complement(order(4971..4973,4998..5000,5067..5069,
FT                   5076..5078,5463..5465))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="p2ECUMN_0009"
FT   misc_feature    complement(order(4971..4973,5067..5069,5463..5465))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="p2ECUMN_0009"
FT   gene            complement(6240..6896)
FT                   /db_xref="GeneID:7169447"
FT                   /locus_tag="p2ECUMN_0010"
FT   CDS_pept        complement(6240..6896)
FT                   /locus_tag="p2ECUMN_0010"
FT                   /gene_family="HOG000061349" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /transl_table="11"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="GI:218454969"
FT                   /db_xref="GeneID:7169447"
FT                   /translation="MMIKSKKVVVIFVALSSFLLAGCDSPKDANKQNFEKAINTRLEKE
FT                   CITISPLGMFDSKPYPVQVAVAQANRYTSQERADEINSRQFSALDVLVKADLLTVKDTL
FT                   VDDVIGFTKTGKKVPGREYALTDEGKKYLKSPERPDFCVGHYKVDEIVDFTEPGDAMGM
FT                   KITQVNYTFSPTSIAEWAKRDDVRAAFLGLESDLKEKQTKRITLVLKNDGWSAER"
FT                   /protein_id="YP_002381192.1"
FT   gene            complement(7000..7464)
FT                   /db_xref="GeneID:7169465"
FT                   /locus_tag="p2ECUMN_0011"